F440970

General Info

Members Datasets Scaffolds Average Seq Length
425 286 850 298

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10094672|Ga0105237_100946725
Length 318
Sequence MRYDVLVVGGSFAGLSAAMQLARARRKVCVVDAGAPRNRFAAASHGFFGQDGTPPLKMVADARAKLLAYPSVDFVQGSVAAAEADDSGGFTVSVADGAQLSTRKLLLSFGVQDGLPDIPGIGQRWGKSVLHCPYCHGYEFGDRQLGLLFHAGGPPDHALLIAEWGPTTLFLNGSKGPDAEVRARLQSRGVTVEPGRIAGLEGEATDLAGVRLEDGRLMPVEALFVAPHTRPASPLAEQLGCAFDDGPMGQVLRVDAMKMSTVPGVYVAGDLAMAFSNATLASADGLMAGVSMHRSLVFGAERTFFPDSEKPVKNHPII

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
148 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
154 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
155 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
156 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
171 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
175 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
181 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
182 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
234 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
235 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
243 2547132374 Acidovorax radicis N35 Isolate Unclassified
244 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
245 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
246 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
247 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
248 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
249 2643221570 Acidovorax sp. Root568 Isolate Unclassified
250 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
251 2643221596 Acidovorax sp. Root70 Isolate Unclassified
252 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
253 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
254 2643221658 Variovorax sp. Root411 Isolate Unclassified
255 2643221672 Variovorax sp. Root434 Isolate Unclassified
256 2643221683 Variovorax sp. Root473 Isolate Unclassified
257 2643221717 Acidovorax sp. Root267 Isolate Unclassified
258 2738541277 Variovorax sp. GV051 Isolate Unclassified
259 2738543019 Variovorax sp. GV040 Isolate Unclassified
260 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
261 2818991446 Variovorax sp. 1180 Isolate Unclassified
262 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
263 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
264 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
265 2842677519 Variovorax sp. R-72495 Isolate Unclassified
266 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
267 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
268 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
269 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
270 2885198086 Variovorax sp. 679 Isolate Unclassified
271 2885211737 Variovorax sp. 553 Isolate Unclassified
272 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
273 2899924645 Variovorax sp. 369 Isolate Unclassified
274 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
275 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
276 2928037797 Variovorax sp. 1126 Isolate Unclassified
277 2928044640 Variovorax sp. 1128 Isolate Unclassified
278 2928051484 Variovorax sp. 1133 Isolate Unclassified
279 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
280 2928070936 Variovorax gossypii 1167 Isolate Unclassified
281 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
282 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
283 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
284 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
285 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
286 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.18
Metatranscriptomes 0.47
Isolates 10.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.65
Nodule 1.41
Rhizoplane 1.65
Rhizosphere 49.65
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10094672 3300009545 Bacteria 2976
2 JGI24740J21852_10015956 3300001979 Bacteria 2727
3 JGI24737J22298_10001096 3300001990 Bacteria 9522
4 JGI24735J21928_10000741 3300002067 Bacteria 11611
5 JGI25152J39213_1002395 3300002773 Bacteria 7178
6 JGI25152J39213_1002636 3300002773 Bacteria 6664
7 JGI25152J39213_1014138 3300002773 Bacteria 1631
8 JGI25150J39212_1005132 3300002774 Bacteria 2827
9 JGI25150J39212_1015371 3300002774 Bacteria 1278
10 JGI25159J45721_1004150 3300002987 Bacteria 4903
11 JGI25151J46595_10001235 3300003187 Bacteria 18220
12 JGI25151J46595_10004704 3300003187 Bacteria 7178
13 JGI25153J46596_10001688 3300003215 Bacteria 13091
14 JGI25153J46596_10005453 3300003215 Bacteria 6673
15 JGI25153J46596_10005503 3300003215 Bacteria 6632
16 rootH1_10000730 3300003316 Bacteria 3756
17 rootH2_10009632 3300003320 Bacteria 3145
18 rootH2_10009634 3300003320 Bacteria 4641
19 JGI25160J50197_1005394 3300003354 Bacteria 5332
20 JGI25160J50197_1006129 3300003354 Bacteria 4903
21 JGI25161J50226_1001811 3300003374 Bacteria 6003
22 JGI25161J50226_1003240 3300003374 Bacteria 3805
23 Ga0006562J51391_1133847 3300003578 Bacteria 1290
24 Ga0006562J51391_1133848 3300003578 Bacteria 2160
25 Ga0055532_1005166 3300003758 Bacteria 1861
26 Ga0055535_1000214 3300003761 Bacteria 61307
27 Ga0055542_1000003 3300003762 Bacteria 582721
28 Ga0055526_1008953 3300003771 Bacteria 4903
29 Ga0055526_1026557 3300003771 Bacteria 1820
30 Ga0055537_1002031 3300003773 Bacteria 7178
31 Ga0055524_1000125 3300003775 Bacteria 90042
32 Ga0055524_1004174 3300003775 Bacteria 6738
33 Ga0055536_1001902 3300003781 Bacteria 12110
34 Ga0055536_1003492 3300003781 Bacteria 8428
35 Ga0055536_1006452 3300003781 Bacteria 5475
36 Ga0055534_1000211 3300003784 Bacteria 43081
37 Ga0055534_1003512 3300003784 Bacteria 4903
38 Ga0055528_1004037 3300003790 Bacteria 7178
39 Ga0055528_1009264 3300003790 Bacteria 4130
40 Ga0055530_10000470 3300003791 Bacteria 35231
41 Ga0055530_10002453 3300003791 Bacteria 11925
42 Ga0055530_10006040 3300003791 Bacteria 5538
43 Ga0055530_10011304 3300003791 Bacteria 3216
44 Ga0055540_1000011 3300003792 Bacteria 282927
45 Ga0055540_1000816 3300003792 Bacteria 21060
46 Ga0055540_1002194 3300003792 Bacteria 10616
47 Ga0055540_1004703 3300003792 Bacteria 6046
48 Ga0055531_10000408 3300003794 Bacteria 41358
49 Ga0055531_10002420 3300003794 Bacteria 12500
50 Ga0055531_10004006 3300003794 Bacteria 9136
51 Ga0055531_10006515 3300003794 Bacteria 6620
52 Ga0055543_1002067 3300004625 Bacteria 7012
53 Ga0055543_1002159 3300004625 Bacteria 6776
54 Ga0065165_1002512 3300005262 Bacteria 15315
55 Ga0065165_1008985 3300005262 Bacteria 4568
56 Ga0065165_1028372 3300005262 Bacteria 1808
57 Ga0070658_10019169 3300005327 Bacteria 5480
58 Ga0070683_100011787 3300005329 Bacteria 7571
59 Ga0070670_100034638 3300005331 Bacteria 4345
60 Ga0070680_100082430 3300005336 Bacteria 2655
61 Ga0068868_100244081 3300005338 Bacteria 1510
62 Ga0070660_100040845 3300005339 Bacteria 3533
63 Ga0070660_100117649 3300005339 Bacteria 2120
64 Ga0070661_100001154 3300005344 Bacteria 18602
65 Ga0070661_100012211 3300005344 Bacteria 6005
66 Ga0070668_100014658 3300005347 Bacteria 5858
67 Ga0070669_100034014 3300005353 Bacteria 3689
68 Ga0070675_100020962 3300005354 Bacteria 5219
69 Ga0070674_100341080 3300005356 Bacteria 1207
70 Ga0070673_100263531 3300005364 Bacteria 1506
71 Ga0070659_100019634 3300005366 Bacteria 5126
72 Ga0070667_100077595 3300005367 Bacteria 2837
73 Ga0070662_100002942 3300005457 Bacteria 10592
74 Ga0070681_10004263 3300005458 Bacteria 13563
75 Ga0070679_100013215 3300005530 Bacteria 7905
76 Ga0070684_100023179 3300005535 Bacteria 5187
77 Ga0070697_100034595 3300005536 Bacteria 4074
78 Ga0068853_100521791 3300005539 Bacteria 1123
79 Ga0068853_100576224 3300005539 Unclassified 1068
80 Ga0070672_100005227 3300005543 Bacteria 8592
81 Ga0070686_100142317 3300005544 Unclassified 1671
82 Ga0068855_100395372 3300005563 Bacteria 1516
83 Ga0070664_100002304 3300005564 Bacteria 15336
84 Ga0070664_100005110 3300005564 Bacteria 10533
85 Ga0070664_100006588 3300005564 Bacteria 9365
86 Ga0070664_100021022 3300005564 Bacteria 5376
87 Ga0070664_100414252 3300005564 Bacteria 1233
88 Ga0068857_100000324 3300005577 Bacteria 32787
89 Ga0068857_100001499 3300005577 Bacteria 18604
90 Ga0068857_100014686 3300005577 Bacteria 6833
91 Ga0070702_100294939 3300005615 Bacteria 1119
92 Ga0068852_100057433 3300005616 Bacteria 3367
93 Ga0068852_100090875 3300005616 Bacteria 2731
94 Ga0068852_100154586 3300005616 Bacteria 2136
95 Ga0068859_100117906 3300005617 Bacteria 2720
96 Ga0068864_100295307 3300005618 Bacteria 1516
97 Ga0068861_100029795 3300005719 Bacteria 3994
98 Ga0068851_10270284 3300005834 Bacteria 969
99 Ga0068863_100276724 3300005841 Bacteria 1625
100 Ga0068860_100077425 3300005843 Bacteria 3162
101 Ga0075363_100125300 3300006048 Bacteria 1438
102 Ga0075367_10020286 3300006178 Bacteria 3698
103 Ga0075367_10119575 3300006178 Bacteria 1623
104 Ga0075366_10057013 3300006195 Bacteria 2321
105 Ga0097621_100584634 3300006237 Bacteria 1019
106 Ga0075370_10005814 3300006353 Bacteria 6162
107 Ga0075370_10054626 3300006353 Bacteria 2269
108 Ga0075370_10085475 3300006353 Bacteria 1816
109 Ga0068871_100114654 3300006358 Bacteria 2271
110 Ga0075428_100068398 3300006844 Bacteria 3885
111 Ga0075431_100226882 3300006847 Bacteria 1904
112 Ga0075433_10059122 3300006852 Bacteria 3353
113 Ga0075434_100293937 3300006871 Unclassified 1644
114 Ga0068865_100465376 3300006881 Bacteria 1048
115 Ga0097620_100117912 3300006931 Bacteria 2720
116 Ga0079104_1000465 3300006946 Bacteria 45434
117 Ga0099826_10001011 3300006948 Bacteria 15767
118 Ga0099826_10154337 3300006948 Bacteria 1309
119 Ga0105244_10001299 3300009036 Bacteria 20450
120 Ga0105244_10081567 3300009036 Bacteria 1600
121 Ga0105240_10294655 3300009093 Bacteria 1858
122 Ga0105240_10372366 3300009093 Bacteria 1615
123 Ga0111539_10161217 3300009094 Bacteria 2623
124 Ga0111539_10589531 3300009094 Unclassified 1294
125 Ga0114129_10461408 3300009147 Unclassified 1665
126 Ga0105243_10001670 3300009148 Bacteria 19215
127 Ga0105243_10002062 3300009148 Bacteria 17038
128 Ga0105243_10032280 3300009148 Bacteria 4044
129 Ga0105243_10363652 3300009148 Bacteria 1333
130 Ga0105248_10127732 3300009177 Bacteria 2868
131 Ga0105238_10000040 3300009551 Bacteria 156685
132 Ga0105238_10164912 3300009551 Bacteria 2191
133 Ga0105249_10004213 3300009553 Bacteria 12430
134 Ga0105239_10061561 3300010375 Bacteria 4119
135 Ga0105239_10481474 3300010375 Bacteria 1410
136 Ga0157373_10078252 3300013100 Bacteria 2332
137 Ga0157371_10008992 3300013102 Bacteria 7900
138 Ga0157370_10302188 3300013104 Bacteria 1477
139 Ga0157369_10032484 3300013105 Bacteria 5740
140 Ga0163162_10001822 3300013306 Bacteria 20042
141 Ga0157372_10027095 3300013307 Bacteria 6238
142 Ga0157375_10071390 3300013308 Bacteria 3485
143 Ga0163163_10378501 3300014325 Bacteria 1473
144 Ga0157380_10274555 3300014326 Bacteria 1539
145 Ga0157376_10120622 3300014969 Bacteria 2323
146 Ga0182007_10041064 3300015262 Bacteria 1543
147 Ga0163161_10038402 3300017792 Bacteria 3434
148 Ga0163161_10153769 3300017792 Bacteria 1750
149 Ga0213876_10044919 3300021384 Bacteria 2336
150 Ga0209436_102317 3300025208 Bacteria 5828
151 Ga0209436_104669 3300025208 Bacteria 3333
152 Ga0209672_100703 3300025228 Bacteria 16671
153 Ga0209147_101828 3300025229 Bacteria 6591
154 Ga0209258_100015 3300025242 Bacteria 706310
155 Ga0207425_1001226 3300025245 Bacteria 11262
156 Ga0207425_1001941 3300025245 Bacteria 7783
157 Ga0209148_1000028 3300025254 Bacteria 582773
158 Ga0209129_1000043 3300025258 Bacteria 298978
159 Ga0209129_1001448 3300025258 Bacteria 13238
160 Ga0209129_1002697 3300025258 Bacteria 8341
161 Ga0209565_1000302 3300025263 Bacteria 46480
162 Ga0209565_1000766 3300025263 Bacteria 18809
163 Ga0209565_1006277 3300025263 Bacteria 3356
164 Ga0209673_1000293 3300025273 Bacteria 93142
165 Ga0209673_1000400 3300025273 Bacteria 77176
166 Ga0209673_1003165 3300025273 Bacteria 10032
167 Ga0209673_1022506 3300025273 Bacteria 2172
168 Ga0209130_1000881 3300025284 Bacteria 24538
169 Ga0209130_1001173 3300025284 Bacteria 18818
170 Ga0209130_1035745 3300025284 Bacteria 992
171 Ga0209675_1000294 3300025291 Bacteria 46480
172 Ga0209675_1002416 3300025291 Bacteria 9633
173 Ga0209675_1004467 3300025291 Bacteria 6202
174 Ga0209675_1015925 3300025291 Bacteria 2212
175 Ga0209676_1000432 3300025292 Bacteria 72513
176 Ga0209676_1000575 3300025292 Bacteria 55372
177 Ga0209676_1001522 3300025292 Bacteria 21084
178 Ga0209025_1000305 3300025294 Bacteria 109479
179 Ga0209025_1000736 3300025294 Bacteria 55372
180 Ga0209025_1009673 3300025294 Bacteria 6669
181 Ga0209025_1028489 3300025294 Bacteria 2734
182 Ga0209025_1052548 3300025294 Bacteria 1607
183 Ga0209564_1000014 3300025295 Bacteria 621501
184 Ga0209564_1000110 3300025295 Bacteria 212842
185 Ga0209564_1000123 3300025295 Bacteria 202487
186 Ga0209564_1029237 3300025295 Bacteria 1740
187 Ga0209758_1000039 3300025297 Bacteria 428951
188 Ga0209758_1000093 3300025297 Bacteria 241169
189 Ga0209758_1048591 3300025297 Bacteria 1506
190 Ga0209050_1000015 3300025298 Bacteria 759102
191 Ga0209050_1000179 3300025298 Bacteria 143878
192 Ga0209050_1000532 3300025298 Bacteria 63063
193 Ga0209050_1000788 3300025298 Bacteria 45047
194 Ga0209050_1002916 3300025298 Bacteria 13427
195 Ga0209050_1012085 3300025298 Bacteria 4007
196 Ga0209256_1000074 3300025299 Bacteria 236893
197 Ga0209256_1000082 3300025299 Bacteria 221491
198 Ga0209256_1000113 3300025299 Bacteria 175296
199 Ga0209256_1040707 3300025299 Bacteria 1185
200 Ga0207426_1000112 3300025302 Bacteria 231436
201 Ga0207426_1000121 3300025302 Bacteria 219007
202 Ga0209051_1000020 3300025303 Bacteria 508628
203 Ga0209051_1000081 3300025303 Bacteria 195619
204 Ga0209051_1001360 3300025303 Bacteria 21203
205 Ga0209051_1003816 3300025303 Bacteria 9642
206 Ga0209257_1000026 3300025304 Bacteria 723225
207 Ga0209257_1000085 3300025304 Bacteria 291117
208 Ga0209257_1000607 3300025304 Bacteria 58779
209 Ga0209257_1001634 3300025304 Bacteria 25690
210 Ga0207656_10036733 3300025321 Bacteria 2057
211 Ga0207647_10207968 3300025904 Unclassified 1131
212 Ga0207705_10055338 3300025909 Bacteria 2860
213 Ga0207707_10005391 3300025912 Bacteria 11181
214 Ga0207695_10428914 3300025913 Bacteria 1206
215 Ga0207660_10076795 3300025917 Bacteria 2443
216 Ga0207657_10054753 3300025919 Bacteria 3448
217 Ga0207657_10214835 3300025919 Bacteria 1542
218 Ga0207649_10018601 3300025920 Bacteria 3955
219 Ga0207649_10042299 3300025920 Bacteria 2779
220 Ga0207649_10198021 3300025920 Unclassified 1417
221 Ga0207652_10004196 3300025921 Bacteria 11758
222 Ga0207681_10021449 3300025923 Bacteria 4106
223 Ga0207694_10000048 3300025924 Bacteria 163095
224 Ga0207694_10251765 3300025924 Bacteria 1445
225 Ga0207690_10021860 3300025932 Bacteria 3973
226 Ga0207706_10002015 3300025933 Bacteria 19881
227 Ga0207706_10011169 3300025933 Bacteria 8187
228 Ga0207709_10000234 3300025935 Bacteria 70092
229 Ga0207709_10000680 3300025935 Bacteria 27456
230 Ga0207691_10003037 3300025940 Bacteria 16370
231 Ga0207689_10318428 3300025942 Bacteria 1291
232 Ga0207661_10464707 3300025944 Unclassified 1154
233 Ga0207661_10574990 3300025944 Bacteria 1033
234 Ga0207679_10003141 3300025945 Bacteria 10201
235 Ga0207679_10021674 3300025945 Bacteria 4361
236 Ga0207679_10023787 3300025945 Bacteria 4194
237 Ga0207679_10032762 3300025945 Bacteria 3652
238 Ga0207667_10653109 3300025949 Bacteria 1057
239 Ga0207651_10181061 3300025960 Bacteria 1672
240 Ga0207712_10016007 3300025961 Bacteria 4848
241 Ga0207668_10259438 3300025972 Bacteria 1415
242 Ga0207640_10303116 3300025981 Bacteria 1265
243 Ga0207640_10370102 3300025981 Bacteria 1158
244 Ga0207658_10248031 3300025986 Bacteria 1512
245 Ga0207639_10159613 3300026041 Bacteria 1899
246 Ga0207678_10288737 3300026067 Bacteria 1409
247 Ga0207674_10000960 3300026116 Bacteria 37672
248 Ga0207674_10006572 3300026116 Bacteria 13668
249 Ga0207674_10019360 3300026116 Bacteria 7374
250 Ga0207674_10023727 3300026116 Bacteria 6565
251 Ga0207675_100002308 3300026118 Bacteria 18953
252 Ga0207698_10365901 3300026142 Bacteria 1367
253 Ga0209281_1000195 3300027111 Bacteria 139144
254 Ga0209282_1000088 3300027666 Bacteria 66037
255 Ga0209974_10008312 3300027876 Bacteria 3551
256 Ga0268266_10014844 3300028379 Bacteria 6691
257 Ga0268265_10111613 3300028380 Bacteria 2233
258 Ga0307515_10307680 3300028794 Bacteria 1263
259 Ga0316177_1195665 3300030731 Bacteria 3542
260 Ga0316176_1204520 3300030732 Bacteria 2195
261 Ga0314311_1124740 3300030733 Bacteria 2094
262 Ga0316180_1097591 3300030736 Bacteria 2594
263 Ga0316183_1032638 3300030742 Bacteria 1148
264 Ga0316181_1051519 3300030744 Bacteria 3050
265 Ga0316181_1089574 3300030744 Bacteria 1652
266 Ga0316182_1061760 3300030745 Bacteria 2520
267 Ga0316182_1145333 3300030745 Bacteria 2192
268 Ga0307408_100000599 3300031548 Bacteria 30998
269 Ga0307408_100002321 3300031548 Bacteria 13477
270 Ga0307408_100663742 3300031548 Bacteria 933
271 Ga0307405_10011321 3300031731 Bacteria 4668
272 Ga0307405_10021484 3300031731 Bacteria 3629
273 Ga0307405_10027863 3300031731 Bacteria 3282
274 Ga0307406_10000353 3300031901 Bacteria 26800
275 Ga0307406_10001141 3300031901 Bacteria 14860
276 Ga0307412_10029935 3300031911 Bacteria 3421
277 Ga0307412_10369522 3300031911 Bacteria 1157
278 Ga0307416_100661187 3300032002 Bacteria 1130
279 Ga0307414_10021035 3300032004 Bacteria 4082
280 Ga0307414_10050501 3300032004 Bacteria 2881
281 Ga0307414_10059388 3300032004 Bacteria 2700
282 Ga0307414_10133666 3300032004 Bacteria 1930
283 Ga0307411_10054131 3300032005 Bacteria 2633
284 Ga0307415_100113063 3300032126 Bacteria 2019
285 Ga0373935_0207905 3300035692 Bacteria 1355
286 Ga0436365_1781462 3300039437 Bacteria 6113
287 Ga0439436_0002354 3300041404 Bacteria 5660
288 Ga0439466_0004302 3300041411 Bacteria 5498
289 Ga0439465_0037578 3300041413 Bacteria 1557
290 Ga0439431_0002934 3300041997 Bacteria 3749
291 Ga0439433_0001267 3300041999 Bacteria 5219
292 Ga0439445_0002895 3300042004 Bacteria 3832
293 Ga0439432_017015 3300042006 Bacteria 2442
294 Ga0439449_0058187 3300042007 Bacteria 1427
295 Ga0439452_006085 3300042010 Bacteria 3811
296 Ga0439455_0006039 3300042012 Bacteria 2491
297 Ga0439457_005166 3300042014 Bacteria 3314
298 Ga0439462_0001753 3300042015 Bacteria 4907
299 Ga0450911_001043 3300042115 Bacteria 7064
300 Ga0439446_0002492 3300042156 Bacteria 4425
301 Ga0439434_0001200 3300042435 Bacteria 7465
302 Ga0495638_0013133 3300046460 Bacteria 5654
303 Ga0495610_0015480 3300046512 Bacteria 4429
304 Ga0495616_0006928 3300046513 Bacteria 6823
305 Ga0495631_0000757 3300046518 Bacteria 20736
306 Ga0495654_0005594 3300046530 Bacteria 7273
307 Ga0495622_0066075 3300046557 Bacteria 1672
308 Ga0495581_0274509 3300047315 Bacteria 985
309 Ga0495676_0136463 3300047321 Bacteria 1763
310 Ga0495593_0072115 3300047673 Bacteria 1793
311 Ga0495614_0043631 3300048089 Bacteria 1923
312 Ga0496101_0402751 3300048904 Bacteria 1078
313 Ga0496102_0124822 3300048905 Bacteria 2406
314 Ga0496102_0227431 3300048905 Bacteria 1759
315 Ga0496102_0714620 3300048905 Bacteria 925
316 Ga0496116_0005411 3300048919 Bacteria 11873
317 Ga0496116_0016488 3300048919 Bacteria 5777
318 Ga0496117_0021099 3300048920 Bacteria 5286
319 Ga0496117_0071572 3300048920 Bacteria 2323
320 Ga0496118_0009572 3300048921 Bacteria 9756
321 Ga0496118_0009755 3300048921 Bacteria 9631
322 Ga0496118_0207318 3300048921 Bacteria 1154
323 Ga0496121_0014004 3300048924 Bacteria 8562
324 Ga0496121_0050112 3300048924 Bacteria 3531
325 Ga0496121_0109301 3300048924 Bacteria 2113
326 Ga0496122_0187281 3300048925 Bacteria 1226
327 Ga0496123_0024284 3300048926 Bacteria 4612
328 Ga0496123_0064758 3300048926 Bacteria 2328
329 Ga0496124_0031681 3300048927 Bacteria 4678
330 Ga0496124_0034265 3300048927 Bacteria 4458
331 Ga0496125_0024998 3300048928 Bacteria 5480
332 Ga0496125_0074398 3300048928 Bacteria 2634
333 Ga0496125_0085982 3300048928 Bacteria 2380
334 Ga0496125_0088824 3300048928 Bacteria 2327
335 Ga0496125_0143266 3300048928 Bacteria 1657
336 Ga0496126_0423288 3300048929 Bacteria 1076
337 Ga0501300_004498 3300049523 Bacteria 2065
338 Ga0501036_0144173 3300049572 Bacteria 2009
339 Ga0501039_0515966 3300049575 Bacteria 938
340 Ga0501040_0118956 3300049576 Bacteria 1853
341 Ga0501072_0027513 3300049588 Bacteria 4436
342 Ga0501074_0034685 3300049590 Bacteria 3658
343 Ga0501076_0144773 3300049592 Bacteria 1932
344 Ga0501249_000834 3300049679 Bacteria 6812
345 Ga0501225_0004746 3300049705 Bacteria 4030
346 Ga0501282_001239 3300049778 Bacteria 2864
347 Ga0501045_0024863 3300049824 Bacteria 4302
348 nmdc:mga03n38_134498_c1 3300050490 Bacteria 1229
349 nmdc:mga00v17_65256_c1 3300050491 Bacteria 2245
350 nmdc:mga06z11_29853_c1 3300050494 Bacteria 2631
351 nmdc:mga06z11_40125_c1 3300050494 Bacteria 2334
352 nmdc:mga07m45_10459_c1 3300050496 Bacteria 4847
353 nmdc:mga07m45_241478_c1 3300050496 Bacteria 1051
354 nmdc:mga07m45_2577_c1 3300050496 Bacteria 8541
355 nmdc:mga07m45_46558_c1 3300050496 Bacteria 2437
356 nmdc:mga05p37_441242_c1 3300050507 Unclassified 1509
357 nmdc:mga09592_112088_c1 3300050508 Bacteria 2340
358 nmdc:mga08y16_411987_c1 3300050511 Bacteria 1382
359 nmdc:mga08y16_706710_c1 3300050511 Bacteria 1007
360 nmdc:mga0n895_77272_c1 3300050512 Bacteria 3311
361 nmdc:mga0a205_61271_c1 3300050515 Bacteria 3634
362 Ga0500578_0000039 3300053086 Bacteria 134602
363 Ga0500643_013301 3300053087 Bacteria 2912
364 Ga0500651_0000064 3300053093 Bacteria 70497
365 Ga0500566_0151769 3300053094 Bacteria 1217
366 Ga0500571_000147 3300053110 Bacteria 24353
367 Ga0500572_085273 3300053111 Bacteria 994
368 Ga0500594_0000997 3300053118 Bacteria 6067
369 Ga0500607_010480 3300053121 Bacteria 5510
370 Ga0500608_000150 3300053122 Bacteria 29081
371 Ga0500608_073203 3300053122 Bacteria 1627
372 Ga0500655_003477 3300053133 Bacteria 2845
373 Ga0500658_0000353 3300053134 Bacteria 20359
374 Ga0500658_0000482 3300053134 Bacteria 17073
375 Ga0500564_000616 3300053138 Bacteria 10840
376 Ga0500564_026436 3300053138 Bacteria 2668
377 Ga0500568_0000491 3300053139 Bacteria 29108
378 Ga0500616_0075447 3300053153 Bacteria 1706
379 Ga0500624_000618 3300053157 Bacteria 9681
380 Ga0500634_0024349 3300053161 Bacteria 3292
381 Ga0500637_0001682 3300053178 Bacteria 9517
382 2548498557 2547132374 Bacteria 5530232
383 2599621402 2599185214 Bacteria 8209958
384 2599670914 2599185226 Bacteria 8233575
385 2599679404 2599185227 Bacteria 8246414
386 2599690913 2599185229 Bacteria 8216126
387 2643770883 2643221550 Bacteria 4619371
388 2643866929 2643221570 Bacteria 5103772
389 2643972689 2643221592 Bacteria 6608788
390 2643993656 2643221596 Bacteria 5006805
391 2644143464 2643221625 Bacteria 6512927
392 2644276099 2643221648 Bacteria 6521465
393 2644327351 2643221658 Bacteria 6064537
394 2644401957 2643221672 Bacteria 6322190
395 2644465619 2643221683 Bacteria 5749203
396 2644649293 2643221717 Bacteria 5676132
397 2738722755 2738541277 Bacteria 7458140
398 2739283326 2738543019 Bacteria 7459457
399 2739792619 2739367756 Bacteria 4553612
400 2819597577 2818991446 Bacteria 7757362
401 2831268568 2831265667 Bacteria 7184833
402 2834645226 2834641062 Bacteria 5559922
403 2838057993 2838054893 Bacteria 7451788
404 2842681674 2842677519 Bacteria 5615038
405 2857544961 2857542790 Bacteria 5326616
406 2861694262 2861691609 Bacteria 5628931
407 2882807325 2882806704 Bacteria 3007728
408 2885195722 2885192300 Bacteria 5882526
409 2885200144 2885198086 Bacteria 7212419
410 2885213796 2885211737 Bacteria 7212420
411 2894417693 2894414249 Bacteria 4405451
412 2899929000 2899924645 Bacteria 7487985
413 2902409983 2902405164 Bacteria 6784948
414 2919466577 2919462493 Bacteria 5817112
415 2928040568 2928037797 Bacteria 7273642
416 2928046683 2928044640 Bacteria 7271509
417 2928058132 2928051484 Bacteria 7773759
418 2928067533 2928064002 Bacteria 7419480
419 2928072061 2928070936 Bacteria 8062541
420 2928085277 2928084124 Bacteria 7159212
421 2945950635 2945945610 Bacteria 5951079
422 2990712880 2990710928 Bacteria 5002431
423 3003669209 3003665799 Bacteria 7279786
424 8003403569 8003400568 Bacteria 5535898
425 8045865826 8045864390 Bacteria 5043873
426 Ga0105237_10094672
427 JGI24740J21852_10015956
428 JGI24737J22298_10001096
429 JGI24735J21928_10000741
430 JGI25152J39213_1002395
431 JGI25152J39213_1002636
432 JGI25152J39213_1014138
433 JGI25150J39212_1005132
434 JGI25150J39212_1015371
435 JGI25159J45721_1004150
436 JGI25151J46595_10001235
437 JGI25151J46595_10004704
438 JGI25153J46596_10001688
439 JGI25153J46596_10005453
440 JGI25153J46596_10005503
441 rootH1_10000730
442 rootH2_10009632
443 rootH2_10009634
444 JGI25160J50197_1005394
445 JGI25160J50197_1006129
446 JGI25161J50226_1001811
447 JGI25161J50226_1003240
448 Ga0006562J51391_1133847
449 Ga0006562J51391_1133848
450 Ga0055532_1005166
451 Ga0055535_1000214
452 Ga0055542_1000003
453 Ga0055526_1008953
454 Ga0055526_1026557
455 Ga0055537_1002031
456 Ga0055524_1000125
457 Ga0055524_1004174
458 Ga0055536_1001902
459 Ga0055536_1003492
460 Ga0055536_1006452
461 Ga0055534_1000211
462 Ga0055534_1003512
463 Ga0055528_1004037
464 Ga0055528_1009264
465 Ga0055530_10000470
466 Ga0055530_10002453
467 Ga0055530_10006040
468 Ga0055530_10011304
469 Ga0055540_1000011
470 Ga0055540_1000816
471 Ga0055540_1002194
472 Ga0055540_1004703
473 Ga0055531_10000408
474 Ga0055531_10002420
475 Ga0055531_10004006
476 Ga0055531_10006515
477 Ga0055543_1002067
478 Ga0055543_1002159
479 Ga0065165_1002512
480 Ga0065165_1008985
481 Ga0065165_1028372
482 Ga0070658_10019169
483 Ga0070683_100011787
484 Ga0070670_100034638
485 Ga0070680_100082430
486 Ga0068868_100244081
487 Ga0070660_100040845
488 Ga0070660_100117649
489 Ga0070661_100001154
490 Ga0070661_100012211
491 Ga0070668_100014658
492 Ga0070669_100034014
493 Ga0070675_100020962
494 Ga0070674_100341080
495 Ga0070673_100263531
496 Ga0070659_100019634
497 Ga0070667_100077595
498 Ga0070662_100002942
499 Ga0070681_10004263
500 Ga0070679_100013215
501 Ga0070684_100023179
502 Ga0070697_100034595
503 Ga0068853_100521791
504 Ga0068853_100576224
505 Ga0070672_100005227
506 Ga0070686_100142317
507 Ga0068855_100395372
508 Ga0070664_100002304
509 Ga0070664_100005110
510 Ga0070664_100006588
511 Ga0070664_100021022
512 Ga0070664_100414252
513 Ga0068857_100000324
514 Ga0068857_100001499
515 Ga0068857_100014686
516 Ga0070702_100294939
517 Ga0068852_100057433
518 Ga0068852_100090875
519 Ga0068852_100154586
520 Ga0068859_100117906
521 Ga0068864_100295307
522 Ga0068861_100029795
523 Ga0068851_10270284
524 Ga0068863_100276724
525 Ga0068860_100077425
526 Ga0075363_100125300
527 Ga0075367_10020286
528 Ga0075367_10119575
529 Ga0075366_10057013
530 Ga0097621_100584634
531 Ga0075370_10005814
532 Ga0075370_10054626
533 Ga0075370_10085475
534 Ga0068871_100114654
535 Ga0075428_100068398
536 Ga0075431_100226882
537 Ga0075433_10059122
538 Ga0075434_100293937
539 Ga0068865_100465376
540 Ga0097620_100117912
541 Ga0079104_1000465
542 Ga0099826_10001011
543 Ga0099826_10154337
544 Ga0105244_10001299
545 Ga0105244_10081567
546 Ga0105240_10294655
547 Ga0105240_10372366
548 Ga0111539_10161217
549 Ga0111539_10589531
550 Ga0114129_10461408
551 Ga0105243_10001670
552 Ga0105243_10002062
553 Ga0105243_10032280
554 Ga0105243_10363652
555 Ga0105248_10127732
556 Ga0105238_10000040
557 Ga0105238_10164912
558 Ga0105249_10004213
559 Ga0105239_10061561
560 Ga0105239_10481474
561 Ga0157373_10078252
562 Ga0157371_10008992
563 Ga0157370_10302188
564 Ga0157369_10032484
565 Ga0163162_10001822
566 Ga0157372_10027095
567 Ga0157375_10071390
568 Ga0163163_10378501
569 Ga0157380_10274555
570 Ga0157376_10120622
571 Ga0182007_10041064
572 Ga0163161_10038402
573 Ga0163161_10153769
574 Ga0213876_10044919
575 Ga0209436_102317
576 Ga0209436_104669
577 Ga0209672_100703
578 Ga0209147_101828
579 Ga0209258_100015
580 Ga0207425_1001226
581 Ga0207425_1001941
582 Ga0209148_1000028
583 Ga0209129_1000043
584 Ga0209129_1001448
585 Ga0209129_1002697
586 Ga0209565_1000302
587 Ga0209565_1000766
588 Ga0209565_1006277
589 Ga0209673_1000293
590 Ga0209673_1000400
591 Ga0209673_1003165
592 Ga0209673_1022506
593 Ga0209130_1000881
594 Ga0209130_1001173
595 Ga0209130_1035745
596 Ga0209675_1000294
597 Ga0209675_1002416
598 Ga0209675_1004467
599 Ga0209675_1015925
600 Ga0209676_1000432
601 Ga0209676_1000575
602 Ga0209676_1001522
603 Ga0209025_1000305
604 Ga0209025_1000736
605 Ga0209025_1009673
606 Ga0209025_1028489
607 Ga0209025_1052548
608 Ga0209564_1000014
609 Ga0209564_1000110
610 Ga0209564_1000123
611 Ga0209564_1029237
612 Ga0209758_1000039
613 Ga0209758_1000093
614 Ga0209758_1048591
615 Ga0209050_1000015
616 Ga0209050_1000179
617 Ga0209050_1000532
618 Ga0209050_1000788
619 Ga0209050_1002916
620 Ga0209050_1012085
621 Ga0209256_1000074
622 Ga0209256_1000082
623 Ga0209256_1000113
624 Ga0209256_1040707
625 Ga0207426_1000112
626 Ga0207426_1000121
627 Ga0209051_1000020
628 Ga0209051_1000081
629 Ga0209051_1001360
630 Ga0209051_1003816
631 Ga0209257_1000026
632 Ga0209257_1000085
633 Ga0209257_1000607
634 Ga0209257_1001634
635 Ga0207656_10036733
636 Ga0207647_10207968
637 Ga0207705_10055338
638 Ga0207707_10005391
639 Ga0207695_10428914
640 Ga0207660_10076795
641 Ga0207657_10054753
642 Ga0207657_10214835
643 Ga0207649_10018601
644 Ga0207649_10042299
645 Ga0207649_10198021
646 Ga0207652_10004196
647 Ga0207681_10021449
648 Ga0207694_10000048
649 Ga0207694_10251765
650 Ga0207690_10021860
651 Ga0207706_10002015
652 Ga0207706_10011169
653 Ga0207709_10000234
654 Ga0207709_10000680
655 Ga0207691_10003037
656 Ga0207689_10318428
657 Ga0207661_10464707
658 Ga0207661_10574990
659 Ga0207679_10003141
660 Ga0207679_10021674
661 Ga0207679_10023787
662 Ga0207679_10032762
663 Ga0207667_10653109
664 Ga0207651_10181061
665 Ga0207712_10016007
666 Ga0207668_10259438
667 Ga0207640_10303116
668 Ga0207640_10370102
669 Ga0207658_10248031
670 Ga0207639_10159613
671 Ga0207678_10288737
672 Ga0207674_10000960
673 Ga0207674_10006572
674 Ga0207674_10019360
675 Ga0207674_10023727
676 Ga0207675_100002308
677 Ga0207698_10365901
678 Ga0209281_1000195
679 Ga0209282_1000088
680 Ga0209974_10008312
681 Ga0268266_10014844
682 Ga0268265_10111613
683 Ga0307515_10307680
684 Ga0316177_1195665
685 Ga0316176_1204520
686 Ga0314311_1124740
687 Ga0316180_1097591
688 Ga0316183_1032638
689 Ga0316181_1051519
690 Ga0316181_1089574
691 Ga0316182_1061760
692 Ga0316182_1145333
693 Ga0307408_100000599
694 Ga0307408_100002321
695 Ga0307408_100663742
696 Ga0307405_10011321
697 Ga0307405_10021484
698 Ga0307405_10027863
699 Ga0307406_10000353
700 Ga0307406_10001141
701 Ga0307412_10029935
702 Ga0307412_10369522
703 Ga0307416_100661187
704 Ga0307414_10021035
705 Ga0307414_10050501
706 Ga0307414_10059388
707 Ga0307414_10133666
708 Ga0307411_10054131
709 Ga0307415_100113063
710 Ga0373935_0207905
711 Ga0436365_1781462
712 Ga0439436_0002354
713 Ga0439466_0004302
714 Ga0439465_0037578
715 Ga0439431_0002934
716 Ga0439433_0001267
717 Ga0439445_0002895
718 Ga0439432_017015
719 Ga0439449_0058187
720 Ga0439452_006085
721 Ga0439455_0006039
722 Ga0439457_005166
723 Ga0439462_0001753
724 Ga0450911_001043
725 Ga0439446_0002492
726 Ga0439434_0001200
727 Ga0495638_0013133
728 Ga0495610_0015480
729 Ga0495616_0006928
730 Ga0495631_0000757
731 Ga0495654_0005594
732 Ga0495622_0066075
733 Ga0495581_0274509
734 Ga0495676_0136463
735 Ga0495593_0072115
736 Ga0495614_0043631
737 Ga0496101_0402751
738 Ga0496102_0124822
739 Ga0496102_0227431
740 Ga0496102_0714620
741 Ga0496116_0005411
742 Ga0496116_0016488
743 Ga0496117_0021099
744 Ga0496117_0071572
745 Ga0496118_0009572
746 Ga0496118_0009755
747 Ga0496118_0207318
748 Ga0496121_0014004
749 Ga0496121_0050112
750 Ga0496121_0109301
751 Ga0496122_0187281
752 Ga0496123_0024284
753 Ga0496123_0064758
754 Ga0496124_0031681
755 Ga0496124_0034265
756 Ga0496125_0024998
757 Ga0496125_0074398
758 Ga0496125_0085982
759 Ga0496125_0088824
760 Ga0496125_0143266
761 Ga0496126_0423288
762 Ga0501300_004498
763 Ga0501036_0144173
764 Ga0501039_0515966
765 Ga0501040_0118956
766 Ga0501072_0027513
767 Ga0501074_0034685
768 Ga0501076_0144773
769 Ga0501249_000834
770 Ga0501225_0004746
771 Ga0501282_001239
772 Ga0501045_0024863
773 nmdc:mga03n38_134498_c1
774 nmdc:mga00v17_65256_c1
775 nmdc:mga06z11_29853_c1
776 nmdc:mga06z11_40125_c1
777 nmdc:mga07m45_10459_c1
778 nmdc:mga07m45_241478_c1
779 nmdc:mga07m45_2577_c1
780 nmdc:mga07m45_46558_c1
781 nmdc:mga05p37_441242_c1
782 nmdc:mga09592_112088_c1
783 nmdc:mga08y16_411987_c1
784 nmdc:mga08y16_706710_c1
785 nmdc:mga0n895_77272_c1
786 nmdc:mga0a205_61271_c1
787 Ga0500578_0000039
788 Ga0500643_013301
789 Ga0500651_0000064
790 Ga0500566_0151769
791 Ga0500571_000147
792 Ga0500572_085273
793 Ga0500594_0000997
794 Ga0500607_010480
795 Ga0500608_000150
796 Ga0500608_073203
797 Ga0500655_003477
798 Ga0500658_0000353
799 Ga0500658_0000482
800 Ga0500564_000616
801 Ga0500564_026436
802 Ga0500568_0000491
803 Ga0500616_0075447
804 Ga0500624_000618
805 Ga0500634_0024349
806 Ga0500637_0001682
807 2548498557
808 2599621402
809 2599670914
810 2599679404
811 2599690913
812 2643770883
813 2643866929
814 2643972689
815 2643993656
816 2644143464
817 2644276099
818 2644327351
819 2644401957
820 2644465619
821 2644649293
822 2738722755
823 2739283326
824 2739792619
825 2819597577
826 2831268568
827 2834645226
828 2838057993
829 2842681674
830 2857544961
831 2861694262
832 2882807325
833 2885195722
834 2885200144
835 2885213796
836 2894417693
837 2899929000
838 2902409983
839 2919466577
840 2928040568
841 2928046683
842 2928058132
843 2928067533
844 2928072061
845 2928085277
846 2945950635
847 2990712880
848 3003669209
849 8003403569
850 8045865826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01134

GIDA

Glucose inhibited division protein A

4

114

0.93

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

172

285

0.87

PF00890

FAD_binding_2

FAD binding domain

4

69

0.85

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

3

152

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nte-assembly1.cif.gz_B crystal structure of deph 0.9755 1 299
4nte-assembly1.cif.gz_A crystal structure of deph 0.9628 1 299
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.96 3 299
4nte-assembly1.cif.gz_B crystal structure of deph 0.9593 1 299
4nte-assembly1.cif.gz_A crystal structure of deph 0.9563 1 299
ID Description Score Start End Superfamily
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9597 1 299 3.50.50.60
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9467 3 33 3.30.300.30
4jn9A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9425 116 226 3.50.50.60
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9399 1 299 3.50.50.60
af_K7K8P2_5_195_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9312 3 33 3.80.10.10
ID Description Score Start End GO Terms
AF-H8H2W4-F1-model_v4 FAD-dependent pyridine nucleotide-disulfide oxidoreductase 0.9779 2 300 GO:0016491
AF-A0A258LVP3-F1-model_v4 Thioredoxin reductase 0.9765 1 299 GO:0016491
AF-A0A7X1AZZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.973 1 299 GO:0016020
GO:0016491
AF-C4APT1-F1-model_v4 deleted 0.9716 1 274
AF-A0A7X1AZZ6-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9698 1 299 GO:0016020
GO:0016491

Map