F440971

General Info

Members Datasets Scaffolds Average Seq Length
425 301 850 320

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000711|Ga0105249_1000071125
Length 365
Sequence LFLLDRRTHIVVDRTAKSSTIDLLRYPLQAAKCRNARKKTMTAANKPDLILTGPMMPLIEEQADALFRVHRLAKAKDRDMLIAEIAPHVRAVATAGHFPVDGALMKRLPKLEIVANFGVGYDSVDAKWAGANGIVVTNTPDVLNDEVADTTVALLLQTVRQLPQAEKYLRAGKWLEKPFPLSHTLRDRTIGIVGMGRIGKAIAKRLEAFGLPIVYHSRNKAADVGYKHYPDLIAMARDVDVLIVIVPGGPTTKNMINREVLKALGPNGILINVARGSVVDEPALIEALMSKTILSAGLDVFAAEPKVPQELIDMEHVVLLPHVGSASHYTRRAMGQLVVDNLASWAKGSGPLTPVPETPWPVKRK

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
145 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
232 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
233 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
240 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
241 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
246 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
247 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
248 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
249 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
250 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
251 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
252 2643221568 Rhizobium sp. Root564 Isolate Unclassified
253 2643221582 Rhizobium sp. Root651 Isolate Unclassified
254 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
255 2643221693 Rhizobium sp. Root491 Isolate Unclassified
256 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
257 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
258 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
259 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
260 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
261 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
262 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
263 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
264 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
265 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
266 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
267 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
268 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
269 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
270 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
271 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
272 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
273 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
274 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
275 2842694124 Methylopila sp. R-72369 Isolate Unclassified
276 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
277 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
278 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
279 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
280 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
281 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
282 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
283 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
284 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
285 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
286 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
287 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
288 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
289 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
290 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
291 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
292 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
293 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
294 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
295 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
296 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
297 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
298 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
299 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
300 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
301 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.59
Metatranscriptomes 0
Isolates 13.41

Biome Distribution

Category Percentage (%)
Aerial Root 1.18
Bulb 0
Endosphere 5.88
Nodule 5.65
Rhizoplane 5.18
Rhizosphere 70.35
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10000711 3300009553 Bacteria 30203
2 2214884086 2209111006 Bacteria 7660
3 ARcpr5oldR_c000046 3300000041 Bacteria 22854
4 ARSoilYngRDRAFT_c00078 3300000042 Bacteria 16119
5 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
6 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
7 JGI24737J22298_10018526 3300001990 Bacteria 2234
8 Ga0058692_1002395 3300003856 Bacteria 6294
9 Ga0065716_1001655 3300005277 Bacteria 4516
10 Ga0065704_10118997 3300005289 Bacteria 1807
11 Ga0065704_10130784 3300005289 Bacteria 1631
12 Ga0065712_10007326 3300005290 Bacteria 3674
13 Ga0065712_10098870 3300005290 Bacteria 2107
14 Ga0070658_10102674 3300005327 Bacteria 2365
15 Ga0070658_10202484 3300005327 Bacteria 1675
16 Ga0070658_10233107 3300005327 Bacteria 1559
17 Ga0070676_10114559 3300005328 Bacteria 1684
18 Ga0070683_100123684 3300005329 Bacteria 2445
19 Ga0070690_100258853 3300005330 Bacteria 1234
20 Ga0070670_100194763 3300005331 Bacteria 1760
21 Ga0070670_100205998 3300005331 Bacteria 1710
22 Ga0070677_10071015 3300005333 Bacteria 1465
23 Ga0070680_100013123 3300005336 Bacteria 6448
24 Ga0070682_100001130 3300005337 Bacteria 15253
25 Ga0070660_100070188 3300005339 Bacteria 2734
26 Ga0070660_100310306 3300005339 Bacteria 1294
27 Ga0070689_100001031 3300005340 Bacteria 17472
28 Ga0070689_100011793 3300005340 Bacteria 6271
29 Ga0070689_100017172 3300005340 Bacteria 5309
30 Ga0070689_100249622 3300005340 Bacteria 1464
31 Ga0070691_10061319 3300005341 Bacteria 1809
32 Ga0070692_10017627 3300005345 Bacteria 3418
33 Ga0070668_100184773 3300005347 Bacteria 1704
34 Ga0070669_100023179 3300005353 Bacteria 4444
35 Ga0070669_100112975 3300005353 Bacteria 2063
36 Ga0070675_100100869 3300005354 Bacteria 2431
37 Ga0070671_100058774 3300005355 Bacteria 3200
38 Ga0070674_100265724 3300005356 Bacteria 1354
39 Ga0070688_100010877 3300005365 Bacteria 5035
40 Ga0070688_100036813 3300005365 Bacteria 2978
41 Ga0070659_100007010 3300005366 Bacteria 8162
42 Ga0070659_100047189 3300005366 Bacteria 3378
43 Ga0070659_100096445 3300005366 Bacteria 2376
44 Ga0070667_100112366 3300005367 Bacteria 2363
45 Ga0070667_100314657 3300005367 Bacteria 1412
46 Ga0070714_100005537 3300005435 Bacteria 9645
47 Ga0070701_10026091 3300005438 Bacteria 2845
48 Ga0070705_100046848 3300005440 Bacteria 2495
49 Ga0070700_100037977 3300005441 Bacteria 2932
50 Ga0070694_100057933 3300005444 Bacteria 2634
51 Ga0070708_100001118 3300005445 Bacteria 20513
52 Ga0070662_100025456 3300005457 Bacteria 4086
53 Ga0070681_10017437 3300005458 Bacteria 7177
54 Ga0070681_10039713 3300005458 Bacteria 4716
55 Ga0070681_10098758 3300005458 Bacteria 2866
56 Ga0070685_10046081 3300005466 Bacteria 2502
57 Ga0070699_100006149 3300005518 Bacteria 10491
58 Ga0070679_100042533 3300005530 Bacteria 4525
59 Ga0070679_100057833 3300005530 Bacteria 3864
60 Ga0070679_100174833 3300005530 Bacteria 2120
61 Ga0070697_100108848 3300005536 Bacteria 2307
62 Ga0068853_100001448 3300005539 Bacteria 17189
63 Ga0068853_100025053 3300005539 Bacteria 5006
64 Ga0070686_100003301 3300005544 Bacteria 8832
65 Ga0070695_100008118 3300005545 Bacteria 6221
66 Ga0070695_100015879 3300005545 Bacteria 4551
67 Ga0070695_100118586 3300005545 Unclassified 1807
68 Ga0070696_100014043 3300005546 Bacteria 5377
69 Ga0070696_100021055 3300005546 Bacteria 4419
70 Ga0070696_100161040 3300005546 Bacteria 1653
71 Ga0070693_100003449 3300005547 Bacteria 7375
72 Ga0070693_100078350 3300005547 Bacteria 1963
73 Ga0070665_100017919 3300005548 Bacteria 7111
74 Ga0070665_100255663 3300005548 Bacteria 1753
75 Ga0070665_100266006 3300005548 Bacteria 1716
76 Ga0070704_100043304 3300005549 Bacteria 3120
77 Ga0068855_100011904 3300005563 Bacteria 10518
78 Ga0068855_100021208 3300005563 Bacteria 7789
79 Ga0068855_100023725 3300005563 Bacteria 7348
80 Ga0068855_100034249 3300005563 Bacteria 6059
81 Ga0068855_100038411 3300005563 Bacteria 5688
82 Ga0068855_100510347 3300005563 Bacteria 1305
83 Ga0068854_100089822 3300005578 Bacteria 2284
84 Ga0068856_100292406 3300005614 Bacteria 1646
85 Ga0068852_100003473 3300005616 Bacteria 11018
86 Ga0068859_100022131 3300005617 Bacteria 6374
87 Ga0068859_100049154 3300005617 Bacteria 4236
88 Ga0068859_100053263 3300005617 Bacteria 4069
89 Ga0068864_100087558 3300005618 Bacteria 2742
90 Ga0068858_100020736 3300005842 Bacteria 6140
91 Ga0068860_100102312 3300005843 Bacteria 2734
92 Ga0068862_100083794 3300005844 Bacteria 2769
93 Ga0068862_100203675 3300005844 Bacteria 1785
94 Ga0075364_10063908 3300006051 Bacteria 2416
95 Ga0070715_10089851 3300006163 Bacteria 1411
96 Ga0075367_10037072 3300006178 Bacteria 2831
97 Ga0075369_10005142 3300006186 Bacteria 4873
98 Ga0075366_10007525 3300006195 Bacteria 6021
99 Ga0068871_100019229 3300006358 Bacteria 5213
100 Ga0068865_100251988 3300006881 Bacteria 1394
101 Ga0075436_100077387 3300006914 Bacteria 2304
102 Ga0097620_100022131 3300006931 Bacteria 6374
103 Ga0097620_100049152 3300006931 Bacteria 4236
104 Ga0097620_100053256 3300006931 Bacteria 4069
105 Ga0099826_10000151 3300006948 Bacteria 29495
106 Ga0099826_10013914 3300006948 Bacteria 6078
107 Ga0105240_10132339 3300009093 Bacteria 2990
108 Ga0105240_10143063 3300009093 Bacteria 2857
109 Ga0105243_10004159 3300009148 Bacteria 11483
110 Ga0105241_10039814 3300009174 Bacteria 3546
111 Ga0105241_10180972 3300009174 Bacteria 1749
112 Ga0105241_10319618 3300009174 Bacteria 1338
113 Ga0105242_10001707 3300009176 Bacteria 17362
114 Ga0105242_10345207 3300009176 Bacteria 1373
115 Ga0105248_10026262 3300009177 Bacteria 6479
116 Ga0105248_10458251 3300009177 Bacteria 1437
117 Ga0105237_10026442 3300009545 Bacteria 5931
118 Ga0105238_10011353 3300009551 Bacteria 8964
119 Ga0105238_10031242 3300009551 Bacteria 5421
120 Ga0105238_10070966 3300009551 Bacteria 3481
121 Ga0105238_10128947 3300009551 Bacteria 2508
122 Ga0105238_10140188 3300009551 Bacteria 2395
123 Ga0105238_10391211 3300009551 Bacteria 1382
124 Ga0105249_10140098 3300009553 Bacteria 2318
125 Ga0105239_10369706 3300010375 Bacteria 1620
126 Ga0157373_10009153 3300013100 Bacteria 7322
127 Ga0157373_10011956 3300013100 Bacteria 6377
128 Ga0157371_10000005 3300013102 Bacteria 416456
129 Ga0157371_10153852 3300013102 Bacteria 1641
130 Ga0157371_10374551 3300013102 Bacteria 1039
131 Ga0157370_10000036 3300013104 Bacteria 136933
132 Ga0157370_10004885 3300013104 Bacteria 15203
133 Ga0157370_10022596 3300013104 Bacteria 6258
134 Ga0157369_10022879 3300013105 Bacteria 6969
135 Ga0163162_10002947 3300013306 Bacteria 16240
136 Ga0157372_10005926 3300013307 Bacteria 12999
137 Ga0157372_10033474 3300013307 Bacteria 5645
138 Ga0157372_10072920 3300013307 Bacteria 3869
139 Ga0157372_10426170 3300013307 Bacteria 1546
140 Ga0157375_10432217 3300013308 Bacteria 1482
141 Ga0157375_10448557 3300013308 Bacteria 1456
142 Ga0163163_10057637 3300014325 Bacteria 3841
143 Ga0157380_10085832 3300014326 Bacteria 2585
144 Ga0157380_10163514 3300014326 Bacteria 1937
145 Ga0157380_10341825 3300014326 Bacteria 1396
146 Ga0182008_10029356 3300014497 Bacteria 2779
147 Ga0157379_10280687 3300014968 Bacteria 1516
148 Ga0207666_1000470 3300025271 Bacteria 5150
149 Ga0209025_1001534 3300025294 Bacteria 29500
150 Ga0207697_10007633 3300025315 Bacteria 4801
151 Ga0207688_10007968 3300025901 Bacteria 5762
152 Ga0207647_10047166 3300025904 Bacteria 2681
153 Ga0207643_10048757 3300025908 Bacteria 2399
154 Ga0207705_10029416 3300025909 Bacteria 3916
155 Ga0207705_10072405 3300025909 Bacteria 2500
156 Ga0207654_10140962 3300025911 Bacteria 1537
157 Ga0207654_10256283 3300025911 Bacteria 1174
158 Ga0207707_10001961 3300025912 Bacteria 18703
159 Ga0207707_10194749 3300025912 Bacteria 1768
160 Ga0207695_10006194 3300025913 Bacteria 15592
161 Ga0207695_10310201 3300025913 Bacteria 1468
162 Ga0207671_10050776 3300025914 Bacteria 3071
163 Ga0207660_10032662 3300025917 Bacteria 3594
164 Ga0207662_10004464 3300025918 Bacteria 7364
165 Ga0207657_10025984 3300025919 Bacteria 5390
166 Ga0207694_10042271 3300025924 Bacteria 3515
167 Ga0207694_10080720 3300025924 Bacteria 2553
168 Ga0207694_10209195 3300025924 Bacteria 1589
169 Ga0207694_10448355 3300025924 Bacteria 1077
170 Ga0207659_10121210 3300025926 Bacteria 2004
171 Ga0207664_10004401 3300025929 Bacteria 9540
172 Ga0207664_10316218 3300025929 Bacteria 1377
173 Ga0207644_10047856 3300025931 Bacteria 3054
174 Ga0207690_10008986 3300025932 Bacteria 5930
175 Ga0207690_10042130 3300025932 Bacteria 2996
176 Ga0207706_10022066 3300025933 Bacteria 5714
177 Ga0207686_10001711 3300025934 Bacteria 12224
178 Ga0207686_10035284 3300025934 Bacteria 3000
179 Ga0207709_10015968 3300025935 Bacteria 4167
180 Ga0207670_10001222 3300025936 Bacteria 13573
181 Ga0207669_10302943 3300025937 Bacteria 1215
182 Ga0207704_10031170 3300025938 Bacteria 3000
183 Ga0207665_10107640 3300025939 Bacteria 1955
184 Ga0207665_10140899 3300025939 Bacteria 1719
185 Ga0207691_10126781 3300025940 Bacteria 2258
186 Ga0207711_10020188 3300025941 Bacteria 5552
187 Ga0207711_10395731 3300025941 Bacteria 1283
188 Ga0207711_10426324 3300025941 Bacteria 1234
189 Ga0207689_10062957 3300025942 Bacteria 3051
190 Ga0207667_10002722 3300025949 Bacteria 21860
191 Ga0207667_10048579 3300025949 Bacteria 4486
192 Ga0207667_10093865 3300025949 Bacteria 3098
193 Ga0207651_10482962 3300025960 Bacteria 1068
194 Ga0207668_10027350 3300025972 Bacteria 3714
195 Ga0207668_10184813 3300025972 Bacteria 1647
196 Ga0207640_10231781 3300025981 Bacteria 1421
197 Ga0207703_10017404 3300026035 Bacteria 5610
198 Ga0207639_10051519 3300026041 Bacteria 3131
199 Ga0207678_10078195 3300026067 Bacteria 2833
200 Ga0207708_10007477 3300026075 Bacteria 8073
201 Ga0207708_10158095 3300026075 Bacteria 1788
202 Ga0207641_10260067 3300026088 Bacteria 1625
203 Ga0207641_10340579 3300026088 Bacteria 1427
204 Ga0207648_10039373 3300026089 Bacteria 4157
205 Ga0207648_10069755 3300026089 Bacteria 3063
206 Ga0207648_10070778 3300026089 Bacteria 3040
207 Ga0207648_10071560 3300026089 Bacteria 3022
208 Ga0207676_10090222 3300026095 Bacteria 2514
209 Ga0207674_10050948 3300026116 Bacteria 4226
210 Ga0207675_100012197 3300026118 Bacteria 8027
211 Ga0207698_10041248 3300026142 Bacteria 3437
212 Ga0207698_10379949 3300026142 Bacteria 1343
213 Ga0209371_1000003 3300027312 Bacteria 1122971
214 Ga0209371_1004373 3300027312 Bacteria 6201
215 Ga0209282_1000339 3300027666 Bacteria 23222
216 Ga0209282_1063740 3300027666 Bacteria 2041
217 Ga0209998_10004879 3300027717 Bacteria 2822
218 Ga0209813_10010997 3300027866 Bacteria 2355
219 Ga0268266_10013966 3300028379 Bacteria 6915
220 Ga0268266_10250542 3300028379 Bacteria 1638
221 Ga0268264_10139537 3300028381 Bacteria 2160
222 Ga0268256_1000004 3300030500 Bacteria 1122967
223 Ga0268256_1011505 3300030500 Bacteria 2793
224 Ga0307408_100336797 3300031548 Bacteria 1276
225 Ga0373930_0001930 3300034816 Bacteria 3168
226 Ga0373948_0000115 3300034817 Bacteria 8332
227 Ga0373958_0001190 3300034819 Bacteria 3464
228 Ga0373938_0000629 3300034957 Bacteria 5674
229 Ga0373929_0000302 3300035085 Bacteria 9176
230 Ga0373929_0002524 3300035085 Bacteria 3360
231 Ga0373940_0000801 3300035088 Bacteria 5193
232 Ga0373949_0030580 3300035090 Bacteria 1281
233 Ga0373951_0001192 3300035091 Bacteria 6872
234 Ga0373952_0000447 3300035092 Bacteria 7176
235 Ga0373932_0000029 3300035112 Bacteria 39605
236 Ga0373960_0000009 3300035121 Bacteria 26216
237 Ga0373955_0038076 3300035172 Bacteria 2561
238 Ga0373942_0000542 3300035207 Bacteria 10621
239 Ga0373962_0000847 3300035242 Bacteria 6991
240 Ga0373931_0008393 3300035691 Bacteria 4897
241 Ga0373931_0013223 3300035691 Bacteria 4016
242 Ga0373935_0316819 3300035692 Bacteria 1106
243 Ga0373927_0135174 3300035695 Bacteria 1611
244 Ga0373933_0027439 3300035724 Bacteria 3279
245 Ga0373947_0106413 3300035725 Bacteria 1768
246 Ga0373937_0216199 3300036401 Bacteria 1804
247 Ga0395900_0036687 3300037418 Bacteria 5054
248 Ga0395898_0295711 3300037466 Bacteria 1545
249 Ga0395905_0025002 3300037471 Bacteria 5633
250 Ga0395901_0016736 3300038443 Bacteria 7471
251 Ga0400483_066394 3300039062 Bacteria 4762
252 Ga0400483_141004 3300039062 Unclassified 1217
253 Ga0400483_243011 3300039062 Bacteria 5204
254 Ga0439465_0031033 3300041413 Bacteria 1702
255 Ga0466961_0055329 3300044693 Bacteria 2530
256 Ga0466957_0059008 3300044842 Bacteria 2351
257 Ga0466957_0299216 3300044842 Bacteria 1081
258 Ga0451576_0051527 3300045051 Bacteria 4315
259 Ga0466967_0267640 3300045976 Bacteria 1637
260 Ga0495592_0063435 3300046454 Bacteria 2710
261 Ga0495664_0164936 3300046477 Bacteria 1344
262 Ga0495652_0132836 3300046529 Bacteria 1968
263 Ga0495654_0000514 3300046530 Bacteria 31446
264 Ga0495587_0020953 3300046536 Bacteria 4033
265 Ga0495645_0253855 3300046543 Bacteria 1168
266 Ga0495667_0118335 3300046559 Bacteria 1711
267 Ga0495588_0001539 3300046674 Bacteria 9865
268 Ga0495599_0067139 3300046678 Bacteria 2240
269 Ga0495623_0013643 3300046679 Bacteria 5267
270 Ga0495681_0003093 3300047470 Bacteria 11666
271 Ga0496100_0086557 3300048903 Bacteria 2129
272 Ga0496101_0003018 3300048904 Bacteria 10374
273 Ga0496102_0434469 3300048905 Bacteria 1232
274 Ga0496104_0000445 3300048907 Bacteria 35921
275 Ga0496104_0002378 3300048907 Bacteria 16215
276 Ga0496104_0221723 3300048907 Bacteria 1803
277 Ga0496105_0016659 3300048908 Bacteria 5870
278 Ga0496105_0032528 3300048908 Bacteria 4281
279 Ga0496106_0006066 3300048909 Bacteria 8944
280 Ga0496106_0127014 3300048909 Unclassified 1997
281 Ga0496107_0003174 3300048910 Bacteria 10928
282 Ga0496107_0169502 3300048910 Bacteria 1620
283 Ga0496108_0013993 3300048911 Bacteria 6545
284 Ga0496109_0032844 3300048912 Bacteria 4668
285 Ga0496109_0426679 3300048912 Bacteria 1252
286 Ga0496110_0005381 3300048913 Bacteria 10031
287 Ga0496110_0043672 3300048913 Bacteria 3914
288 Ga0496112_0022649 3300048915 Bacteria 5990
289 Ga0496115_0172332 3300048918 Bacteria 1789
290 Ga0496116_0000097 3300048919 Bacteria 200658
291 Ga0496116_0033739 3300048919 Bacteria 3626
292 Ga0496117_0000030 3300048920 Bacteria 389141
293 Ga0496118_0017164 3300048921 Bacteria 6602
294 Ga0496118_0067930 3300048921 Bacteria 2591
295 Ga0496118_0149705 3300048921 Bacteria 1463
296 Ga0496118_0193903 3300048921 Bacteria 1212
297 Ga0496119_0021911 3300048922 Bacteria 4595
298 Ga0496119_0031278 3300048922 Bacteria 3573
299 Ga0496119_0078479 3300048922 Bacteria 1909
300 Ga0496120_0000148 3300048923 Bacteria 116605
301 Ga0496120_0013111 3300048923 Bacteria 5602
302 Ga0496120_0113415 3300048923 Bacteria 1412
303 Ga0496121_0000003 3300048924 Bacteria 1191431
304 Ga0496121_0166133 3300048924 Bacteria 1608
305 Ga0496122_0000050 3300048925 Bacteria 267874
306 Ga0496122_0013587 3300048925 Bacteria 7952
307 Ga0496122_0110978 3300048925 Bacteria 1800
308 Ga0496123_0000023 3300048926 Bacteria 346894
309 Ga0496123_0159853 3300048926 Bacteria 1202
310 Ga0496124_0000413 3300048927 Bacteria 76781
311 Ga0496124_0069636 3300048927 Bacteria 2920
312 Ga0496125_0000345 3300048928 Bacteria 88357
313 Ga0496125_0027099 3300048928 Bacteria 5202
314 Ga0496126_0000119 3300048929 Bacteria 184211
315 Ga0496126_0105432 3300048929 Bacteria 2461
316 Ga0496126_0130884 3300048929 Bacteria 2168
317 Ga0501031_0028491 3300049568 Bacteria 3641
318 Ga0501036_0046547 3300049572 Bacteria 3674
319 Ga0501037_0135849 3300049573 Bacteria 1761
320 Ga0501038_0044018 3300049574 Bacteria 3880
321 Ga0501043_0072315 3300049579 Bacteria 2709
322 Ga0501070_0003681 3300049586 Bacteria 13246
323 Ga0501073_0006610 3300049589 Bacteria 8631
324 Ga0501073_0033251 3300049589 Bacteria 3672
325 Ga0501074_0038484 3300049590 Bacteria 3466
326 Ga0501075_0170486 3300049591 Bacteria 1661
327 Ga0501076_0015991 3300049592 Bacteria 5680
328 Ga0501076_0171152 3300049592 Bacteria 1770
329 Ga0501077_0012946 3300049593 Bacteria 5225
330 Ga0501079_0142882 3300049741 Bacteria 1864
331 Ga0501080_0037162 3300049742 Bacteria 4546
332 Ga0501081_0007361 3300049743 Bacteria 7146
333 Ga0501044_0055315 3300049823 Bacteria 4076
334 Ga0501044_0177425 3300049823 Bacteria 2099
335 Ga0501044_0445131 3300049823 Bacteria 1203
336 Ga0501045_0216684 3300049824 Bacteria 1426
337 nmdc:mga00v17_11176_c2 3300050491 Bacteria 3252
338 nmdc:mga0yw44_162281_c1 3300050492 Bacteria 1464
339 nmdc:mga06z11_129312_c1 3300050494 Bacteria 1417
340 nmdc:mga06z11_61015_c1 3300050494 Bacteria 1965
341 nmdc:mga04h51_15902_c1 3300050495 Bacteria 2176
342 nmdc:mga0rr50_117593_c1 3300050513 Bacteria 2111
343 nmdc:mga08x19_258433_c1 3300050514 Bacteria 1203
344 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
345 nmdc:mga0a205_50746_c2 3300050515 Bacteria 3076
346 nmdc:mga0sz30_10806_c1 3300050516 Bacteria 3507
347 nmdc:mga0sz30_74_c1 3300050516 Bacteria 15880
348 Ga0495601_0004922 3300053077 Bacteria 7752
349 Ga0495601_0021956 3300053077 Bacteria 3915
350 Ga0495595_0014510 3300053084 Bacteria 3345
351 Ga0495619_0017414 3300053085 Bacteria 4548
352 Ga0495619_0060321 3300053085 Bacteria 2521
353 Ga0500566_0115156 3300053094 Bacteria 1456
354 Ga0500556_0000068 3300053104 Bacteria 103123
355 Ga0500560_065781 3300053107 Bacteria 1188
356 Ga0500562_020113 3300053108 Bacteria 1733
357 Ga0500572_002520 3300053111 Bacteria 4378
358 Ga0500559_0004465 3300053136 Bacteria 6636
359 Ga0500561_0000425 3300053137 Bacteria 6929
360 Ga0500624_000609 3300053157 Bacteria 9780
361 Ga0500627_0141755 3300053158 Bacteria 1085
362 Ga0500634_0024388 3300053161 Bacteria 3289
363 Ga0500636_0000005 3300053177 Bacteria 197561
364 Ga0500636_0003442 3300053177 Bacteria 8907
365 Ga0501084_0005828 3300054114 Bacteria 10140
366 Ga0501082_0006510 3300060353 Bacteria 10128
367 Ga0501082_0016310 3300060353 Bacteria 6395
368 Ga0466962_0273171 3300061719 Bacteria 833
369 2513591253 2513237087 Bacteria 5817514
370 2537876822 2537561587 Bacteria 5425293
371 2554244510 2554235003 Bacteria 5877155
372 2559297647 2558860242 Bacteria 5568029
373 2599606597 2599185210 Bacteria 5624189
374 2601612441 2600255279 Bacteria 5605316
375 2601748982 2600255308 Bacteria 5611129
376 2643858101 2643221568 Bacteria 5187270
377 2643917525 2643221582 Bacteria 5804683
378 2644241901 2643221643 Bacteria 5749658
379 2644522699 2643221693 Bacteria 5513853
380 2738944520 2738541317 Bacteria 5340176
381 2808989157 2808606387 Bacteria 5697198
382 2819557695 2818991439 Bacteria 6907412
383 2838679921 2838675328 Bacteria 4909118
384 2838717718 2838714209 Bacteria 5525906
385 2838724492 2838719591 Bacteria 5523910
386 2838729566 2838724970 Bacteria 4908691
387 2840880617 2840878972 Bacteria 5483153
388 2841850004 2841846520 Bacteria 5345850
389 2841861208 2841859092 Bacteria 5436171
390 2842128476 2842124991 Bacteria 5346824
391 2842134603 2842130223 Bacteria 4909145
392 2842156565 2842152218 Bacteria 4908957
393 2842173963 2842170452 Bacteria 5525737
394 2842180186 2842175837 Bacteria 4908771
395 2842192185 2842187318 Bacteria 5524014
396 2842216535 2842211629 Bacteria 5523832
397 2842229221 2842224351 Bacteria 5524473
398 2842518525 2842515876 Bacteria 5436280
399 2842695721 2842694124 Bacteria 4063419
400 2842701244 2842698319 Bacteria 5190321
401 2899793114 2899792073 Bacteria 4926588
402 2899849683 2899845264 Bacteria 5672268
403 2913309140 2913308742 Bacteria 5350706
404 2919117999 2919114240 Bacteria 5700270
405 2919169925 2919166419 Bacteria 4952238
406 2926757766 2926754445 Bacteria 5964435
407 2926764609 2926760298 Bacteria 5505990
408 2929141389 2929138655 Bacteria 5810547
409 2933010381 2933006813 Bacteria 4912075
410 2933014151 2933011516 Bacteria 5439334
411 2933597250 2933594066 Bacteria 5594265
412 2978972377 2978969890 Bacteria 5400756
413 2979090282 2979089926 Bacteria 5670289
414 2979095811 2979095461 Bacteria 5669583
415 2979102735 2979100975 Bacteria 5423623
416 2984509377 2984509177 Bacteria 5274802
417 2984519924 2984518228 Bacteria 5277463
418 2984537709 2984537506 Bacteria 5277481
419 2984590625 2984587000 Bacteria 5263363
420 2984604454 2984601300 Bacteria 5455244
421 650844090 650716007 Bacteria 5573770
422 8002287116 8002285264 Bacteria 6717907
423 8003573280 8003570095 Bacteria 5747666
424 8019622412 8019619141 Bacteria 9218857
425 8054463482 8054460903 Bacteria 4872905
426 Ga0105249_10000711
427 2214884086
428 ARcpr5oldR_c000046
429 ARSoilYngRDRAFT_c00078
430 ARSoilOldRDRAFT_c000019
431 ARCol0yngRDRAFT_1000004
432 JGI24737J22298_10018526
433 Ga0058692_1002395
434 Ga0065716_1001655
435 Ga0065704_10118997
436 Ga0065704_10130784
437 Ga0065712_10007326
438 Ga0065712_10098870
439 Ga0070658_10102674
440 Ga0070658_10202484
441 Ga0070658_10233107
442 Ga0070676_10114559
443 Ga0070683_100123684
444 Ga0070690_100258853
445 Ga0070670_100194763
446 Ga0070670_100205998
447 Ga0070677_10071015
448 Ga0070680_100013123
449 Ga0070682_100001130
450 Ga0070660_100070188
451 Ga0070660_100310306
452 Ga0070689_100001031
453 Ga0070689_100011793
454 Ga0070689_100017172
455 Ga0070689_100249622
456 Ga0070691_10061319
457 Ga0070692_10017627
458 Ga0070668_100184773
459 Ga0070669_100023179
460 Ga0070669_100112975
461 Ga0070675_100100869
462 Ga0070671_100058774
463 Ga0070674_100265724
464 Ga0070688_100010877
465 Ga0070688_100036813
466 Ga0070659_100007010
467 Ga0070659_100047189
468 Ga0070659_100096445
469 Ga0070667_100112366
470 Ga0070667_100314657
471 Ga0070714_100005537
472 Ga0070701_10026091
473 Ga0070705_100046848
474 Ga0070700_100037977
475 Ga0070694_100057933
476 Ga0070708_100001118
477 Ga0070662_100025456
478 Ga0070681_10017437
479 Ga0070681_10039713
480 Ga0070681_10098758
481 Ga0070685_10046081
482 Ga0070699_100006149
483 Ga0070679_100042533
484 Ga0070679_100057833
485 Ga0070679_100174833
486 Ga0070697_100108848
487 Ga0068853_100001448
488 Ga0068853_100025053
489 Ga0070686_100003301
490 Ga0070695_100008118
491 Ga0070695_100015879
492 Ga0070695_100118586
493 Ga0070696_100014043
494 Ga0070696_100021055
495 Ga0070696_100161040
496 Ga0070693_100003449
497 Ga0070693_100078350
498 Ga0070665_100017919
499 Ga0070665_100255663
500 Ga0070665_100266006
501 Ga0070704_100043304
502 Ga0068855_100011904
503 Ga0068855_100021208
504 Ga0068855_100023725
505 Ga0068855_100034249
506 Ga0068855_100038411
507 Ga0068855_100510347
508 Ga0068854_100089822
509 Ga0068856_100292406
510 Ga0068852_100003473
511 Ga0068859_100022131
512 Ga0068859_100049154
513 Ga0068859_100053263
514 Ga0068864_100087558
515 Ga0068858_100020736
516 Ga0068860_100102312
517 Ga0068862_100083794
518 Ga0068862_100203675
519 Ga0075364_10063908
520 Ga0070715_10089851
521 Ga0075367_10037072
522 Ga0075369_10005142
523 Ga0075366_10007525
524 Ga0068871_100019229
525 Ga0068865_100251988
526 Ga0075436_100077387
527 Ga0097620_100022131
528 Ga0097620_100049152
529 Ga0097620_100053256
530 Ga0099826_10000151
531 Ga0099826_10013914
532 Ga0105240_10132339
533 Ga0105240_10143063
534 Ga0105243_10004159
535 Ga0105241_10039814
536 Ga0105241_10180972
537 Ga0105241_10319618
538 Ga0105242_10001707
539 Ga0105242_10345207
540 Ga0105248_10026262
541 Ga0105248_10458251
542 Ga0105237_10026442
543 Ga0105238_10011353
544 Ga0105238_10031242
545 Ga0105238_10070966
546 Ga0105238_10128947
547 Ga0105238_10140188
548 Ga0105238_10391211
549 Ga0105249_10140098
550 Ga0105239_10369706
551 Ga0157373_10009153
552 Ga0157373_10011956
553 Ga0157371_10000005
554 Ga0157371_10153852
555 Ga0157371_10374551
556 Ga0157370_10000036
557 Ga0157370_10004885
558 Ga0157370_10022596
559 Ga0157369_10022879
560 Ga0163162_10002947
561 Ga0157372_10005926
562 Ga0157372_10033474
563 Ga0157372_10072920
564 Ga0157372_10426170
565 Ga0157375_10432217
566 Ga0157375_10448557
567 Ga0163163_10057637
568 Ga0157380_10085832
569 Ga0157380_10163514
570 Ga0157380_10341825
571 Ga0182008_10029356
572 Ga0157379_10280687
573 Ga0207666_1000470
574 Ga0209025_1001534
575 Ga0207697_10007633
576 Ga0207688_10007968
577 Ga0207647_10047166
578 Ga0207643_10048757
579 Ga0207705_10029416
580 Ga0207705_10072405
581 Ga0207654_10140962
582 Ga0207654_10256283
583 Ga0207707_10001961
584 Ga0207707_10194749
585 Ga0207695_10006194
586 Ga0207695_10310201
587 Ga0207671_10050776
588 Ga0207660_10032662
589 Ga0207662_10004464
590 Ga0207657_10025984
591 Ga0207694_10042271
592 Ga0207694_10080720
593 Ga0207694_10209195
594 Ga0207694_10448355
595 Ga0207659_10121210
596 Ga0207664_10004401
597 Ga0207664_10316218
598 Ga0207644_10047856
599 Ga0207690_10008986
600 Ga0207690_10042130
601 Ga0207706_10022066
602 Ga0207686_10001711
603 Ga0207686_10035284
604 Ga0207709_10015968
605 Ga0207670_10001222
606 Ga0207669_10302943
607 Ga0207704_10031170
608 Ga0207665_10107640
609 Ga0207665_10140899
610 Ga0207691_10126781
611 Ga0207711_10020188
612 Ga0207711_10395731
613 Ga0207711_10426324
614 Ga0207689_10062957
615 Ga0207667_10002722
616 Ga0207667_10048579
617 Ga0207667_10093865
618 Ga0207651_10482962
619 Ga0207668_10027350
620 Ga0207668_10184813
621 Ga0207640_10231781
622 Ga0207703_10017404
623 Ga0207639_10051519
624 Ga0207678_10078195
625 Ga0207708_10007477
626 Ga0207708_10158095
627 Ga0207641_10260067
628 Ga0207641_10340579
629 Ga0207648_10039373
630 Ga0207648_10069755
631 Ga0207648_10070778
632 Ga0207648_10071560
633 Ga0207676_10090222
634 Ga0207674_10050948
635 Ga0207675_100012197
636 Ga0207698_10041248
637 Ga0207698_10379949
638 Ga0209371_1000003
639 Ga0209371_1004373
640 Ga0209282_1000339
641 Ga0209282_1063740
642 Ga0209998_10004879
643 Ga0209813_10010997
644 Ga0268266_10013966
645 Ga0268266_10250542
646 Ga0268264_10139537
647 Ga0268256_1000004
648 Ga0268256_1011505
649 Ga0307408_100336797
650 Ga0373930_0001930
651 Ga0373948_0000115
652 Ga0373958_0001190
653 Ga0373938_0000629
654 Ga0373929_0000302
655 Ga0373929_0002524
656 Ga0373940_0000801
657 Ga0373949_0030580
658 Ga0373951_0001192
659 Ga0373952_0000447
660 Ga0373932_0000029
661 Ga0373960_0000009
662 Ga0373955_0038076
663 Ga0373942_0000542
664 Ga0373962_0000847
665 Ga0373931_0008393
666 Ga0373931_0013223
667 Ga0373935_0316819
668 Ga0373927_0135174
669 Ga0373933_0027439
670 Ga0373947_0106413
671 Ga0373937_0216199
672 Ga0395900_0036687
673 Ga0395898_0295711
674 Ga0395905_0025002
675 Ga0395901_0016736
676 Ga0400483_066394
677 Ga0400483_141004
678 Ga0400483_243011
679 Ga0439465_0031033
680 Ga0466961_0055329
681 Ga0466957_0059008
682 Ga0466957_0299216
683 Ga0451576_0051527
684 Ga0466967_0267640
685 Ga0495592_0063435
686 Ga0495664_0164936
687 Ga0495652_0132836
688 Ga0495654_0000514
689 Ga0495587_0020953
690 Ga0495645_0253855
691 Ga0495667_0118335
692 Ga0495588_0001539
693 Ga0495599_0067139
694 Ga0495623_0013643
695 Ga0495681_0003093
696 Ga0496100_0086557
697 Ga0496101_0003018
698 Ga0496102_0434469
699 Ga0496104_0000445
700 Ga0496104_0002378
701 Ga0496104_0221723
702 Ga0496105_0016659
703 Ga0496105_0032528
704 Ga0496106_0006066
705 Ga0496106_0127014
706 Ga0496107_0003174
707 Ga0496107_0169502
708 Ga0496108_0013993
709 Ga0496109_0032844
710 Ga0496109_0426679
711 Ga0496110_0005381
712 Ga0496110_0043672
713 Ga0496112_0022649
714 Ga0496115_0172332
715 Ga0496116_0000097
716 Ga0496116_0033739
717 Ga0496117_0000030
718 Ga0496118_0017164
719 Ga0496118_0067930
720 Ga0496118_0149705
721 Ga0496118_0193903
722 Ga0496119_0021911
723 Ga0496119_0031278
724 Ga0496119_0078479
725 Ga0496120_0000148
726 Ga0496120_0013111
727 Ga0496120_0113415
728 Ga0496121_0000003
729 Ga0496121_0166133
730 Ga0496122_0000050
731 Ga0496122_0013587
732 Ga0496122_0110978
733 Ga0496123_0000023
734 Ga0496123_0159853
735 Ga0496124_0000413
736 Ga0496124_0069636
737 Ga0496125_0000345
738 Ga0496125_0027099
739 Ga0496126_0000119
740 Ga0496126_0105432
741 Ga0496126_0130884
742 Ga0501031_0028491
743 Ga0501036_0046547
744 Ga0501037_0135849
745 Ga0501038_0044018
746 Ga0501043_0072315
747 Ga0501070_0003681
748 Ga0501073_0006610
749 Ga0501073_0033251
750 Ga0501074_0038484
751 Ga0501075_0170486
752 Ga0501076_0015991
753 Ga0501076_0171152
754 Ga0501077_0012946
755 Ga0501079_0142882
756 Ga0501080_0037162
757 Ga0501081_0007361
758 Ga0501044_0055315
759 Ga0501044_0177425
760 Ga0501044_0445131
761 Ga0501045_0216684
762 nmdc:mga00v17_11176_c2
763 nmdc:mga0yw44_162281_c1
764 nmdc:mga06z11_129312_c1
765 nmdc:mga06z11_61015_c1
766 nmdc:mga04h51_15902_c1
767 nmdc:mga0rr50_117593_c1
768 nmdc:mga08x19_258433_c1
769 nmdc:mga08x19_6_c1
770 nmdc:mga0a205_50746_c2
771 nmdc:mga0sz30_10806_c1
772 nmdc:mga0sz30_74_c1
773 Ga0495601_0004922
774 Ga0495601_0021956
775 Ga0495595_0014510
776 Ga0495619_0017414
777 Ga0495619_0060321
778 Ga0500566_0115156
779 Ga0500556_0000068
780 Ga0500560_065781
781 Ga0500562_020113
782 Ga0500572_002520
783 Ga0500559_0004465
784 Ga0500561_0000425
785 Ga0500624_000609
786 Ga0500627_0141755
787 Ga0500634_0024388
788 Ga0500636_0000005
789 Ga0500636_0003442
790 Ga0501084_0005828
791 Ga0501082_0006510
792 Ga0501082_0016310
793 Ga0466962_0273171
794 2513591253
795 2537876822
796 2554244510
797 2559297647
798 2599606597
799 2601612441
800 2601748982
801 2643858101
802 2643917525
803 2644241901
804 2644522699
805 2738944520
806 2808989157
807 2819557695
808 2838679921
809 2838717718
810 2838724492
811 2838729566
812 2840880617
813 2841850004
814 2841861208
815 2842128476
816 2842134603
817 2842156565
818 2842173963
819 2842180186
820 2842192185
821 2842216535
822 2842229221
823 2842518525
824 2842695721
825 2842701244
826 2899793114
827 2899849683
828 2913309140
829 2919117999
830 2919169925
831 2926757766
832 2926764609
833 2929141389
834 2933010381
835 2933014151
836 2933597250
837 2978972377
838 2979090282
839 2979095811
840 2979102735
841 2984509377
842 2984519924
843 2984537709
844 2984590625
845 2984604454
846 650844090
847 8002287116
848 8003573280
849 8019622412
850 8054463482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

152

324

0.95

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

49

356

0.94

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

189

303

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v6q-assembly2.cif.gz_C crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with nadp and malonate 0.9354 4 326
5v6q-assembly2.cif.gz_C crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with nadp and malonate 0.9298 4 326
5v72-assembly2.cif.gz_B crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9288 5 320
7cvp-assembly1.cif.gz_B the crystal structure of human phgdh from biortus. 0.9261 98 301
5v72-assembly1.cif.gz_A crystal structure of nadph-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with citrate 0.9243 1 326
ID Description Score Start End Superfamily
5j23A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9792 105 288 3.40.50.720
af_Q7XRA3_150_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9762 144 285 3.40.50.720
af_K7KCB6_141_256_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 175 288 3.40.50.720
af_A0A0R0KIU5_101_193_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 197 288 3.40.50.720
af_K7L0E3_188_326_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9665 175 311 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A067HDC8-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9866 148 271 GO:0051287
AF-A0A434QRP6-F1-model_v4 2-hydroxyacid dehydrogenase 0.9837 125 272 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7J0FLL7-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase family protein 0.982 146 284 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A357G1I8-F1-model_v4 Hydroxyacid dehydrogenase 0.9807 144 285 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A258Z869-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding domain-containing protein 0.9776 160 323 GO:0005829
GO:0016618
GO:0030267
GO:0051287

Map