F440978

General Info

Members Datasets Scaffolds Average Seq Length
425 233 412 95

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_12541148|Ga0163163_125411481
Length 107
Sequence LSAGKNRQQEFEMSVDAATVKRIGRLARIRVEANEVAKYQGEINAILGFVEQLGEVNVDGVEPMTSVTPMQLRRREDKVTDGGYPERIVKNAPLSEDNFFMVPKVIE

Samples

Sample ID Description Type Environment
1 2643221580 Devosia sp. Root635 Isolate Unclassified
2 2643221591 Devosia sp. Root685 Isolate Unclassified
3 2643221629 Devosia sp. Root105 Isolate Unclassified
4 2643221662 Devosia sp. Root413D1 Isolate Unclassified
5 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
6 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
7 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
8 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
9 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
10 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
231 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
232 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
233 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 0
Isolates 3.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 3.53
Rhizosphere 85.65
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020635 3300001989 Bacteria 2353
2 JGI24737J22298_10002724 3300001990 Bacteria 6249
3 JGI24735J21928_10011544 3300002067 Bacteria 2798
4 rootH1_10149556 3300003323 Bacteria 2877
5 Ga0065712_10660189 3300005290 Bacteria 563
6 Ga0070658_10035782 3300005327 Bacteria 4000
7 Ga0070658_10044563 3300005327 Bacteria 3585
8 Ga0070683_100139530 3300005329 Bacteria 2296
9 Ga0070670_100303788 3300005331 Bacteria 1396
10 Ga0070682_100194737 3300005337 Bacteria 1426
11 Ga0068868_100222230 3300005338 Bacteria 1582
12 Ga0070660_100080807 3300005339 Bacteria 2551
13 Ga0070660_100564718 3300005339 Bacteria 950
14 Ga0070660_100842881 3300005339 Bacteria 772
15 Ga0070661_100005122 3300005344 Bacteria 9034
16 Ga0070661_100037209 3300005344 Bacteria 3539
17 Ga0070661_100113157 3300005344 Bacteria 2028
18 Ga0070661_100165008 3300005344 Bacteria 1679
19 Ga0070661_100683780 3300005344 Bacteria 835
20 Ga0070675_100378795 3300005354 Bacteria 1259
21 Ga0070675_101143534 3300005354 Bacteria 716
22 Ga0070674_100459470 3300005356 Unclassified 1052
23 Ga0070674_101201491 3300005356 Bacteria 673
24 Ga0070673_100050706 3300005364 Bacteria 3246
25 Ga0070673_100724067 3300005364 Bacteria 915
26 Ga0070659_100028553 3300005366 Bacteria 4309
27 Ga0070659_100031601 3300005366 Bacteria 4102
28 Ga0070713_100221905 3300005436 Bacteria 1715
29 Ga0070700_100727018 3300005441 Bacteria 792
30 Ga0070694_100279955 3300005444 Bacteria 1271
31 Ga0070663_100364591 3300005455 Bacteria 1173
32 Ga0070663_100398258 3300005455 Bacteria 1125
33 Ga0070663_100600177 3300005455 Bacteria 926
34 Ga0070663_101213526 3300005455 Bacteria 663
35 Ga0070662_100118677 3300005457 Bacteria 2025
36 Ga0070662_101065222 3300005457 Bacteria 693
37 Ga0068867_100196155 3300005459 Bacteria 1614
38 Ga0068867_101199925 3300005459 Bacteria 697
39 Ga0070679_100364095 3300005530 Bacteria 1393
40 Ga0068853_100001361 3300005539 Bacteria 17623
41 Ga0068853_100478550 3300005539 Bacteria 1174
42 Ga0068853_100624838 3300005539 Bacteria 1024
43 Ga0070695_100837726 3300005545 Bacteria 739
44 Ga0070693_100912521 3300005547 Bacteria 659
45 Ga0070693_101256268 3300005547 Bacteria 571
46 Ga0070693_101336446 3300005547 Bacteria 555
47 Ga0070665_100005843 3300005548 Bacteria 12623
48 Ga0070665_100333325 3300005548 Bacteria 1522
49 Ga0070665_100490833 3300005548 Bacteria 1239
50 Ga0070704_100483019 3300005549 Bacteria 1072
51 Ga0068855_100036343 3300005563 Bacteria 5863
52 Ga0068855_100061477 3300005563 Bacteria 4388
53 Ga0068855_100546721 3300005563 Bacteria 1254
54 Ga0068855_100644104 3300005563 Bacteria 1139
55 Ga0070664_100234163 3300005564 Bacteria 1647
56 Ga0070664_100525222 3300005564 Bacteria 1093
57 Ga0068857_100114017 3300005577 Bacteria 2430
58 Ga0068857_100316874 3300005577 Bacteria 1440
59 Ga0068857_100696410 3300005577 Bacteria 965
60 Ga0068857_100891223 3300005577 Bacteria 853
61 Ga0068854_100035435 3300005578 Bacteria 3492
62 Ga0068854_100400316 3300005578 Bacteria 1136
63 Ga0068854_101146125 3300005578 Bacteria 695
64 Ga0068856_100043727 3300005614 Bacteria 4406
65 Ga0068856_100218875 3300005614 Bacteria 1919
66 Ga0068856_100374439 3300005614 Bacteria 1443
67 Ga0068856_100466897 3300005614 Bacteria 1283
68 Ga0068856_100536978 3300005614 Bacteria 1191
69 Ga0068852_100002584 3300005616 Bacteria 12497
70 Ga0068852_100014256 3300005616 Bacteria 6110
71 Ga0068852_100073745 3300005616 Bacteria 3003
72 Ga0068852_100727796 3300005616 Bacteria 1003
73 Ga0068852_101737981 3300005616 Bacteria 646
74 Ga0068851_10023798 3300005834 Bacteria 2995
75 Ga0068851_10072012 3300005834 Bacteria 1790
76 Ga0068851_10655403 3300005834 Bacteria 643
77 Ga0068862_100591768 3300005844 Bacteria 1064
78 Ga0081539_10004809 3300005985 Bacteria 14508
79 Ga0070717_10261179 3300006028 Bacteria 1532
80 Ga0075365_10095246 3300006038 Bacteria 2033
81 Ga0075365_10322937 3300006038 Bacteria 1087
82 Ga0075365_11083525 3300006038 Bacteria 564
83 Ga0075368_10029042 3300006042 Bacteria 2138
84 Ga0075363_100150393 3300006048 Bacteria 1314
85 Ga0075363_100223918 3300006048 Bacteria 1078
86 Ga0075363_100371666 3300006048 Bacteria 837
87 Ga0075362_10002800 3300006177 Bacteria 5947
88 Ga0075367_10102923 3300006178 Bacteria 1747
89 Ga0075366_10007995 3300006195 Bacteria 5858
90 Ga0075370_10010892 3300006353 Bacteria 4766
91 Ga0075370_10134017 3300006353 Bacteria 1446
92 Ga0068871_100505642 3300006358 Bacteria 1090
93 Ga0068871_100536066 3300006358 Bacteria 1059
94 Ga0075428_100109734 3300006844 Bacteria 3006
95 Ga0075431_100342723 3300006847 Bacteria 1504
96 Ga0068865_100146572 3300006881 Bacteria 1786
97 Ga0105240_10018209 3300009093 Bacteria 9442
98 Ga0105240_10226968 3300009093 Bacteria 2172
99 Ga0105240_10487516 3300009093 Bacteria 1373
100 Ga0105240_10637212 3300009093 Bacteria 1170
101 Ga0105240_11249350 3300009093 Bacteria 785
102 Ga0105245_12572257 3300009098 Bacteria 562
103 Ga0114129_10418006 3300009147 Bacteria 1764
104 Ga0114129_13118014 3300009147 Bacteria 541
105 Ga0105241_10025491 3300009174 Bacteria 4394
106 Ga0105241_10369766 3300009174 Bacteria 1250
107 Ga0105241_10373539 3300009174 Bacteria 1244
108 Ga0105248_12676552 3300009177 Bacteria 569
109 Ga0105237_10307816 3300009545 Bacteria 1587
110 Ga0105238_10007784 3300009551 Bacteria 10718
111 Ga0105238_10028969 3300009551 Bacteria 5641
112 Ga0105238_10067801 3300009551 Bacteria 3568
113 Ga0105238_11968112 3300009551 Bacteria 618
114 Ga0099796_10130638 3300010159 Bacteria 973
115 Ga0105239_10063115 3300010375 Bacteria 4067
116 Ga0105239_10089462 3300010375 Bacteria 3395
117 Ga0105239_10259297 3300010375 Bacteria 1953
118 Ga0105239_13020334 3300010375 Bacteria 548
119 Ga0105246_10192954 3300011119 Bacteria 1578
120 Ga0157373_10305432 3300013100 Bacteria 1130
121 Ga0157371_10004729 3300013102 Bacteria 11760
122 Ga0157370_10020275 3300013104 Bacteria 6640
123 Ga0157370_10041820 3300013104 Bacteria 4418
124 Ga0157370_10553119 3300013104 Bacteria 1055
125 Ga0157370_10972708 3300013104 Bacteria 769
126 Ga0157369_10021628 3300013105 Bacteria 7193
127 Ga0157369_10090815 3300013105 Bacteria 3261
128 Ga0157369_10735881 3300013105 Bacteria 1015
129 Ga0157374_10279841 3300013296 Bacteria 1647
130 Ga0157374_10640711 3300013296 Bacteria 1074
131 Ga0157378_11101347 3300013297 Bacteria 831
132 Ga0157378_12130961 3300013297 Bacteria 611
133 Ga0163162_10286561 3300013306 Bacteria 1779
134 Ga0157372_10019075 3300013307 Bacteria 7383
135 Ga0157372_10222500 3300013307 Bacteria 2188
136 Ga0157372_10515888 3300013307 Bacteria 1393
137 Ga0157372_13018641 3300013307 Bacteria 538
138 Ga0157375_10799189 3300013308 Bacteria 1092
139 Ga0163163_12541148 3300014325 Bacteria 570
140 Ga0182005_1086793 3300015265 Bacteria 867
141 Ga0209025_1179689 3300025294 Bacteria 545
142 Ga0207656_10018797 3300025321 Bacteria 2725
143 Ga0207656_10042576 3300025321 Bacteria 1933
144 Ga0207647_10008767 3300025904 Bacteria 7221
145 Ga0207647_10040939 3300025904 Bacteria 2916
146 Ga0207647_10207006 3300025904 Bacteria 1134
147 Ga0207647_10407453 3300025904 Bacteria 765
148 Ga0207645_10056303 3300025907 Bacteria 2510
149 Ga0207705_10243809 3300025909 Bacteria 1369
150 Ga0207654_10431775 3300025911 Bacteria 921
151 Ga0207695_10112632 3300025913 Bacteria 2698
152 Ga0207695_10722709 3300025913 Bacteria 876
153 Ga0207695_10861012 3300025913 Bacteria 786
154 Ga0207671_10229774 3300025914 Bacteria 1455
155 Ga0207693_10922285 3300025915 Bacteria 669
156 Ga0207657_10010037 3300025919 Bacteria 9472
157 Ga0207657_10201826 3300025919 Bacteria 1599
158 Ga0207657_10497272 3300025919 Bacteria 955
159 Ga0207649_10158742 3300025920 Bacteria 1565
160 Ga0207649_10169804 3300025920 Bacteria 1518
161 Ga0207649_10821059 3300025920 Bacteria 726
162 Ga0207649_10830983 3300025920 Bacteria 722
163 Ga0207694_10012796 3300025924 Bacteria 6320
164 Ga0207694_10133203 3300025924 Bacteria 1993
165 Ga0207694_10142100 3300025924 Bacteria 1931
166 Ga0207659_10541900 3300025926 Bacteria 988
167 Ga0207687_10906246 3300025927 Bacteria 754
168 Ga0207700_10035659 3300025928 Bacteria 3585
169 Ga0207700_10693480 3300025928 Bacteria 909
170 Ga0207690_10246458 3300025932 Bacteria 1378
171 Ga0207690_11102099 3300025932 Bacteria 662
172 Ga0207690_11402297 3300025932 Bacteria 584
173 Ga0207706_10098993 3300025933 Bacteria 2565
174 Ga0207706_10317608 3300025933 Bacteria 1356
175 Ga0207669_11028574 3300025937 Bacteria 693
176 Ga0207679_10376988 3300025945 Bacteria 1243
177 Ga0207679_10445307 3300025945 Bacteria 1148
178 Ga0207667_10067524 3300025949 Bacteria 3724
179 Ga0207667_10103393 3300025949 Bacteria 2938
180 Ga0207667_10104089 3300025949 Bacteria 2927
181 Ga0207667_10121062 3300025949 Bacteria 2696
182 Ga0207667_10194477 3300025949 Bacteria 2081
183 Ga0207667_10472678 3300025949 Bacteria 1273
184 Ga0207667_10875258 3300025949 Bacteria 891
185 Ga0207651_10913097 3300025960 Bacteria 782
186 Ga0207651_11128890 3300025960 Bacteria 703
187 Ga0207640_10099611 3300025981 Bacteria 2034
188 Ga0207640_10145543 3300025981 Bacteria 1733
189 Ga0207640_10157930 3300025981 Bacteria 1674
190 Ga0207640_10596885 3300025981 Bacteria 934
191 Ga0207658_11512010 3300025986 Bacteria 614
192 Ga0207677_11642843 3300026023 Bacteria 595
193 Ga0207639_10027816 3300026041 Bacteria 4122
194 Ga0207639_10152841 3300026041 Bacteria 1935
195 Ga0207639_10745813 3300026041 Bacteria 910
196 Ga0207639_10852933 3300026041 Bacteria 850
197 Ga0207678_10041815 3300026067 Bacteria 3973
198 Ga0207678_10109274 3300026067 Bacteria 2359
199 Ga0207678_10327353 3300026067 Bacteria 1319
200 Ga0207678_11079744 3300026067 Bacteria 711
201 Ga0207702_10111185 3300026078 Bacteria 2436
202 Ga0207702_10169125 3300026078 Bacteria 2002
203 Ga0207702_10348682 3300026078 Bacteria 1416
204 Ga0207702_10523207 3300026078 Bacteria 1158
205 Ga0207702_10940930 3300026078 Bacteria 857
206 Ga0207648_10250301 3300026089 Bacteria 1579
207 Ga0207674_10012932 3300026116 Bacteria 9307
208 Ga0207674_10046700 3300026116 Bacteria 4444
209 Ga0207674_10250085 3300026116 Bacteria 1720
210 Ga0207674_10393326 3300026116 Bacteria 1340
211 Ga0207674_10451080 3300026116 Bacteria 1243
212 Ga0207698_10035924 3300026142 Bacteria 3630
213 Ga0207698_10083221 3300026142 Bacteria 2589
214 Ga0207698_11060825 3300026142 Bacteria 822
215 Ga0207698_11302281 3300026142 Bacteria 741
216 Ga0209813_10030911 3300027866 Bacteria 1577
217 Ga0209974_10092964 3300027876 Bacteria 1047
218 Ga0268266_10015825 3300028379 Bacteria 6459
219 Ga0268266_10152113 3300028379 Bacteria 2087
220 Ga0268266_10187772 3300028379 Bacteria 1886
221 Ga0268265_10923251 3300028380 Bacteria 858
222 Ga0268264_12580701 3300028381 Bacteria 513
223 Ga0265324_10092744 3300029957 Bacteria 1027
224 Ga0265330_10014045 3300031235 Bacteria 3719
225 Ga0265332_10105974 3300031238 Bacteria 1185
226 Ga0265325_10007054 3300031241 Bacteria 6771
227 Ga0265329_10017889 3300031242 Bacteria 2432
228 Ga0265339_10002073 3300031249 Bacteria 14689
229 Ga0265316_10111233 3300031344 Bacteria 2074
230 Ga0265313_10002516 3300031595 Bacteria 15759
231 Ga0265314_10031996 3300031711 Bacteria 3876
232 Ga0307413_10975865 3300031824 Bacteria 725
233 Ga0307413_11803541 3300031824 Bacteria 548
234 Ga0307406_10612878 3300031901 Bacteria 899
235 Ga0307406_10798100 3300031901 Bacteria 796
236 Ga0307412_10811714 3300031911 Bacteria 813
237 Ga0307412_11139803 3300031911 Bacteria 696
238 Ga0307416_100444379 3300032002 Bacteria 1348
239 Ga0307414_10306248 3300032004 Bacteria 1346
240 Ga0307414_10976316 3300032004 Bacteria 779
241 Ga0307414_11025250 3300032004 Bacteria 760
242 Ga0316583_10212307 3300032133 Bacteria 671
243 Ga0373934_0069578 3300035086 Bacteria 1407
244 Ga0373949_0184777 3300035090 Bacteria 619
245 Ga0373952_0225149 3300035092 Bacteria 559
246 Ga0373941_0032567 3300035115 Bacteria 1561
247 Ga0373953_0536765 3300035117 Bacteria 520
248 Ga0373954_0357954 3300035118 Bacteria 721
249 Ga0373956_0088501 3300035119 Bacteria 1427
250 Ga0373960_0022880 3300035121 Bacteria 1679
251 Ga0373924_0149108 3300035410 Bacteria 1023
252 Ga0373931_0065679 3300035691 Bacteria 1967
253 Ga0373931_0363132 3300035691 Bacteria 909
254 Ga0373935_0969882 3300035692 Bacteria 631
255 Ga0373935_1449491 3300035692 Bacteria 514
256 Ga0373933_0734417 3300035724 Bacteria 649
257 Ga0373925_0693207 3300037068 Bacteria 840
258 Ga0395899_0153226 3300037312 Bacteria 1632
259 Ga0395899_0192714 3300037312 Bacteria 1425
260 Ga0395900_0069929 3300037418 Bacteria 3608
261 Ga0395900_0484087 3300037418 Bacteria 1189
262 Ga0395900_1514257 3300037418 Bacteria 583
263 Ga0395898_0152230 3300037466 Bacteria 2212
264 Ga0395898_0156151 3300037466 Bacteria 2182
265 Ga0395898_0299684 3300037466 Bacteria 1534
266 Ga0395905_0011565 3300037471 Bacteria 8526
267 Ga0395901_0310733 3300038443 Bacteria 1632
268 Ga0395901_0681265 3300038443 Bacteria 1028
269 Ga0395901_1035856 3300038443 Bacteria 794
270 Ga0436360_0365885 3300039438 Bacteria 1208
271 Ga0439466_0284114 3300041411 Bacteria 501
272 Ga0439465_0177354 3300041413 Bacteria 770
273 Ga0439465_0226991 3300041413 Bacteria 686
274 Ga0439465_0252195 3300041413 Bacteria 653
275 Ga0451793_1189447 3300041452 Bacteria 972
276 Ga0451797_0270653 3300041453 Bacteria 698
277 Ga0451797_0645602 3300041453 Bacteria 611
278 Ga0451800_0709892 3300041459 Unclassified 592
279 Ga0451800_1519639 3300041459 Bacteria 715
280 Ga0451802_1295978 3300041460 Bacteria 571
281 Ga0451807_2431911 3300041486 Bacteria 597
282 Ga0451851_0708563 3300041507 Bacteria 641
283 Ga0439442_092063 3300042002 Bacteria 653
284 Ga0439445_0085266 3300042004 Bacteria 886
285 Ga0439445_0147433 3300042004 Bacteria 684
286 Ga0439432_041128 3300042006 Bacteria 1465
287 Ga0439434_0055737 3300042435 Bacteria 1231
288 Ga0495592_0357350 3300046454 Bacteria 935
289 Ga0495592_0476946 3300046454 Bacteria 778
290 Ga0495580_0995492 3300046472 Bacteria 535
291 Ga0495608_0353138 3300046511 Bacteria 905
292 Ga0495628_1160294 3300046516 Bacteria 525
293 Ga0495652_0227303 3300046529 Bacteria 1398
294 Ga0495587_0535916 3300046536 Bacteria 646
295 Ga0495667_0148481 3300046559 Bacteria 1510
296 Ga0495625_0766021 3300046660 Bacteria 564
297 Ga0495657_0706193 3300046675 Bacteria 579
298 Ga0495613_0940217 3300046689 Bacteria 558
299 Ga0495604_0458742 3300047317 Bacteria 832
300 Ga0495675_0203883 3300047444 Bacteria 1203
301 Ga0495686_0500268 3300047472 Bacteria 640
302 Ga0496104_0001487 3300048907 Bacteria 20235
303 Ga0496105_0012075 3300048908 Bacteria 6839
304 Ga0496106_0198256 3300048909 Bacteria 1597
305 Ga0496109_1853211 3300048912 Bacteria 536
306 Ga0496110_0334262 3300048913 Bacteria 1380
307 Ga0496112_1405676 3300048915 Bacteria 612
308 Ga0496113_0542277 3300048916 Bacteria 933
309 Ga0496115_0143147 3300048918 Bacteria 1972
310 Ga0496117_0437703 3300048920 Bacteria 650
311 Ga0496118_0109367 3300048921 Bacteria 1840
312 Ga0496121_0220249 3300048924 Bacteria 1337
313 Ga0496124_0140521 3300048927 Bacteria 1906
314 Ga0496124_0694887 3300048927 Bacteria 646
315 Ga0496125_0000600 3300048928 Bacteria 61362
316 Ga0501031_0431806 3300049568 Bacteria 851
317 Ga0501032_0660458 3300049569 Bacteria 664
318 Ga0501032_0746920 3300049569 Bacteria 619
319 Ga0501033_0028728 3300049570 Bacteria 4178
320 Ga0501033_0369575 3300049570 Bacteria 1003
321 Ga0501034_0003057 3300049571 Bacteria 19317
322 Ga0501034_0030710 3300049571 Bacteria 5461
323 Ga0501034_0050009 3300049571 Bacteria 4217
324 Ga0501034_0071799 3300049571 Bacteria 3470
325 Ga0501034_0109265 3300049571 Bacteria 2756
326 Ga0501034_0127082 3300049571 Bacteria 2534
327 Ga0501034_0157945 3300049571 Bacteria 2240
328 Ga0501034_0277947 3300049571 Bacteria 1614
329 Ga0501034_0455124 3300049571 Bacteria 1197
330 Ga0501034_0505031 3300049571 Bacteria 1122
331 Ga0501034_0625846 3300049571 Bacteria 980
332 Ga0501034_0712363 3300049571 Bacteria 901
333 Ga0501034_0746801 3300049571 Bacteria 874
334 Ga0501034_0881187 3300049571 Bacteria 784
335 Ga0501034_1312317 3300049571 Bacteria 600
336 Ga0501036_0070182 3300049572 Bacteria 2962
337 Ga0501036_0564061 3300049572 Bacteria 946
338 Ga0501036_0805051 3300049572 Bacteria 774
339 Ga0501036_0908022 3300049572 Bacteria 723
340 Ga0501037_0027745 3300049573 Bacteria 4184
341 Ga0501037_0245811 3300049573 Bacteria 1253
342 Ga0501037_0343592 3300049573 Bacteria 1030
343 Ga0501037_0629315 3300049573 Bacteria 719
344 Ga0501038_0045781 3300049574 Bacteria 3796
345 Ga0501038_0214920 3300049574 Bacteria 1537
346 Ga0501038_0297979 3300049574 Bacteria 1266
347 Ga0501038_1050212 3300049574 Bacteria 597
348 Ga0501038_1107743 3300049574 Bacteria 578
349 Ga0501039_0081052 3300049575 Bacteria 2526
350 Ga0501039_0518693 3300049575 Bacteria 936
351 Ga0501041_0396364 3300049577 Bacteria 874
352 Ga0501043_0408635 3300049579 Bacteria 1025
353 Ga0501043_0472675 3300049579 Bacteria 939
354 Ga0501043_0557235 3300049579 Bacteria 851
355 Ga0501043_0571109 3300049579 Bacteria 838
356 Ga0501043_1067402 3300049579 Bacteria 572
357 Ga0501043_1198509 3300049579 Unclassified 533
358 Ga0501046_0031168 3300049580 Bacteria 4325
359 Ga0501046_0771245 3300049580 Bacteria 675
360 Ga0501047_0084594 3300049581 Bacteria 3048
361 Ga0501047_0095998 3300049581 Bacteria 2843
362 Ga0501047_0140584 3300049581 Bacteria 2293
363 Ga0501047_0669979 3300049581 Bacteria 856
364 Ga0501048_0327779 3300049582 Bacteria 1091
365 Ga0501068_0186452 3300049584 Bacteria 1313
366 Ga0501068_0823814 3300049584 Bacteria 609
367 Ga0501070_0098203 3300049586 Bacteria 2422
368 Ga0501070_0507852 3300049586 Bacteria 968
369 Ga0501070_1481150 3300049586 Bacteria 514
370 Ga0501071_0190135 3300049587 Bacteria 1540
371 Ga0501073_0085262 3300049589 Bacteria 2198
372 Ga0501073_0202042 3300049589 Bacteria 1374
373 Ga0501073_1038368 3300049589 Bacteria 564
374 Ga0501073_1146912 3300049589 Bacteria 534
375 Ga0501074_0363518 3300049590 Bacteria 1027
376 Ga0501074_0854127 3300049590 Bacteria 641
377 Ga0501075_1264225 3300049591 Bacteria 560
378 Ga0501076_0322104 3300049592 Bacteria 1268
379 Ga0501080_0403988 3300049742 Bacteria 1229
380 Ga0501080_1208399 3300049742 Bacteria 650
381 Ga0501080_1861856 3300049742 Bacteria 504
382 Ga0501035_0218399 3300049822 Bacteria 1628
383 Ga0501035_0407548 3300049822 Bacteria 1130
384 Ga0501035_0618261 3300049822 Bacteria 881
385 Ga0501044_0040406 3300049823 Bacteria 4861
386 Ga0501044_0349223 3300049823 Bacteria 1399
387 Ga0501044_0518065 3300049823 Bacteria 1092
388 Ga0501044_0762794 3300049823 Bacteria 849
389 Ga0501044_0765793 3300049823 Bacteria 846
390 nmdc:mga03683_2282_c1 3300050489 Bacteria 5923
391 nmdc:mga03n38_107620_c1 3300050490 Bacteria 1353
392 nmdc:mga03n38_255395_c1 3300050490 Bacteria 927
393 nmdc:mga0yw44_24211_c1 3300050492 Bacteria 3432
394 nmdc:mga0yw44_476671_c1 3300050492 Bacteria 846
395 nmdc:mga0k408_57890_c1 3300050493 Bacteria 2251
396 nmdc:mga06z11_8511_c1 3300050494 Bacteria 4284
397 nmdc:mga04h51_36848_c1 3300050495 Bacteria 1576
398 nmdc:mga07m45_10439_c1 3300050496 Bacteria 4851
399 nmdc:mga07m45_26534_c1 3300050496 Bacteria 3185
400 nmdc:mga05p37_184464_c1 3300050507 Bacteria 2537
401 nmdc:mga0qj67_927134_c1 3300050509 Bacteria 685
402 nmdc:mga06r32_1557922_c1 3300050510 Bacteria 600
403 Ga0495601_0127459 3300053077 Bacteria 1656
404 Ga0495612_0254454 3300053078 Unclassified 782
405 Ga0495655_0189213 3300053083 Bacteria 668
406 Ga0500595_013139 3300053119 Bacteria 3178
407 Ga0500618_013461 3300053125 Bacteria 2111
408 Ga0500642_0437952 3300053130 Bacteria 563
409 Ga0500616_0013814 3300053153 Bacteria 4664
410 Ga0501084_0620003 3300054114 Bacteria 914
411 Ga0501082_0215429 3300060353 Bacteria 1671
412 Ga0530510_0395757 3300061734 Bacteria 1041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031901 Ga0307406_10612878 Ga0307406_106128782 87
2 3300041413 Ga0439465_0226991 Ga0439465_0226991_354_641 87
3 3300046454 Ga0495592_0357350 Ga0495592_0357350_493_780 87
4 3300046516 Ga0495628_1160294 Ga0495628_1160294_228_515 87
5 3300013296 Ga0157374_10279841 Ga0157374_102798412 88
6 iso_pu_bacteria 2643221580 2643910714 91
7 iso_pu_bacteria 2643221591 2643963395 91
8 iso_pu_bacteria 2643221629 2644166063 91
9 iso_pu_bacteria 2643221662 2644346931 91
10 iso_pu_bacteria 2837678835 2837679973 91
11 iso_pu_bacteria 2848297114 2848299372 91
12 iso_pu_bacteria 2894817345 2894818379 91
13 iso_pu_bacteria 2896184354 2896186736 91
14 iso_pu_bacteria 2939669807 2939671115 91
15 iso_pu_bacteria 2995392953 2995392959 91
16 iso_pu_bacteria 8045864390 8045865231 91
17 iso_pu_bacteria 8054563764 8054566573 91
18 iso_pu_bacteria 8056875544 8056879514 91
19 3300025909 Ga0207705_10243809 Ga0207705_102438092 93
20 3300001989 JGI24739J22299_10020635 JGI24739J22299_100206353 95
21 3300001990 JGI24737J22298_10002724 JGI24737J22298_100027242 95
22 3300002067 JGI24735J21928_10011544 JGI24735J21928_100115443 95
23 3300003323 rootH1_10149556 rootH1_101495562 95
24 3300005290 Ga0065712_10660189 Ga0065712_106601892 95
25 3300005327 Ga0070658_10035782 Ga0070658_100357825 95
26 3300005327 Ga0070658_10044563 Ga0070658_100445635 95
27 3300005329 Ga0070683_100139530 Ga0070683_1001395302 95
28 3300005331 Ga0070670_100303788 Ga0070670_1003037882 95
29 3300005337 Ga0070682_100194737 Ga0070682_1001947372 95
30 3300005338 Ga0068868_100222230 Ga0068868_1002222302 95
31 3300005339 Ga0070660_100080807 Ga0070660_1000808072 95
32 3300005339 Ga0070660_100564718 Ga0070660_1005647182 95
33 3300005339 Ga0070660_100842881 Ga0070660_1008428812 95
34 3300005344 Ga0070661_100005122 Ga0070661_10000512210 95
35 3300005344 Ga0070661_100037209 Ga0070661_1000372094 95
36 3300005344 Ga0070661_100113157 Ga0070661_1001131572 95
37 3300005344 Ga0070661_100165008 Ga0070661_1001650083 95
38 3300005344 Ga0070661_100683780 Ga0070661_1006837802 95
39 3300005354 Ga0070675_100378795 Ga0070675_1003787952 95
40 3300005354 Ga0070675_101143534 Ga0070675_1011435341 95
41 3300005356 Ga0070674_100459470 Ga0070674_1004594702 95
42 3300005356 Ga0070674_101201491 Ga0070674_1012014912 95
43 3300005364 Ga0070673_100050706 Ga0070673_1000507064 95
44 3300005364 Ga0070673_100724067 Ga0070673_1007240672 95
45 3300005366 Ga0070659_100028553 Ga0070659_1000285536 95
46 3300005366 Ga0070659_100031601 Ga0070659_1000316015 95
47 3300005436 Ga0070713_100221905 Ga0070713_1002219052 95
48 3300005441 Ga0070700_100727018 Ga0070700_1007270181 95
49 3300005444 Ga0070694_100279955 Ga0070694_1002799553 95
50 3300005455 Ga0070663_100364591 Ga0070663_1003645912 95
51 3300005455 Ga0070663_100398258 Ga0070663_1003982582 95
52 3300005455 Ga0070663_100600177 Ga0070663_1006001773 95
53 3300005455 Ga0070663_101213526 Ga0070663_1012135262 95
54 3300005457 Ga0070662_100118677 Ga0070662_1001186772 95
55 3300005457 Ga0070662_101065222 Ga0070662_1010652221 95
56 3300005459 Ga0068867_100196155 Ga0068867_1001961553 95
57 3300005459 Ga0068867_101199925 Ga0068867_1011999252 95
58 3300005530 Ga0070679_100364095 Ga0070679_1003640953 95
59 3300005539 Ga0068853_100001361 Ga0068853_1000013612 95
60 3300005539 Ga0068853_100478550 Ga0068853_1004785502 95
61 3300005539 Ga0068853_100624838 Ga0068853_1006248381 95
62 3300005545 Ga0070695_100837726 Ga0070695_1008377263 95
63 3300005547 Ga0070693_100912521 Ga0070693_1009125211 95
64 3300005547 Ga0070693_101256268 Ga0070693_1012562682 95
65 3300005547 Ga0070693_101336446 Ga0070693_1013364461 95
66 3300005548 Ga0070665_100005843 Ga0070665_10000584310 95
67 3300005548 Ga0070665_100333325 Ga0070665_1003333252 95
68 3300005548 Ga0070665_100490833 Ga0070665_1004908332 95
69 3300005549 Ga0070704_100483019 Ga0070704_1004830192 95
70 3300005563 Ga0068855_100036343 Ga0068855_1000363435 95
71 3300005563 Ga0068855_100061477 Ga0068855_1000614774 95
72 3300005563 Ga0068855_100546721 Ga0068855_1005467212 95
73 3300005563 Ga0068855_100644104 Ga0068855_1006441042 95
74 3300005564 Ga0070664_100234163 Ga0070664_1002341632 95
75 3300005564 Ga0070664_100525222 Ga0070664_1005252222 95
76 3300005577 Ga0068857_100114017 Ga0068857_1001140174 95
77 3300005577 Ga0068857_100316874 Ga0068857_1003168742 95
78 3300005577 Ga0068857_100696410 Ga0068857_1006964102 95
79 3300005577 Ga0068857_100891223 Ga0068857_1008912232 95
80 3300005578 Ga0068854_100035435 Ga0068854_1000354352 95
81 3300005578 Ga0068854_100400316 Ga0068854_1004003162 95
82 3300005578 Ga0068854_101146125 Ga0068854_1011461251 95
83 3300005614 Ga0068856_100043727 Ga0068856_1000437276 95
84 3300005614 Ga0068856_100218875 Ga0068856_1002188753 95
85 3300005614 Ga0068856_100374439 Ga0068856_1003744391 95
86 3300005614 Ga0068856_100466897 Ga0068856_1004668972 95
87 3300005614 Ga0068856_100536978 Ga0068856_1005369782 95
88 3300005616 Ga0068852_100002584 Ga0068852_1000025844 95
89 3300005616 Ga0068852_100014256 Ga0068852_1000142563 95
90 3300005616 Ga0068852_100073745 Ga0068852_1000737452 95
91 3300005616 Ga0068852_100727796 Ga0068852_1007277962 95
92 3300005616 Ga0068852_101737981 Ga0068852_1017379811 95
93 3300005834 Ga0068851_10023798 Ga0068851_100237983 95
94 3300005834 Ga0068851_10072012 Ga0068851_100720124 95
95 3300005834 Ga0068851_10655403 Ga0068851_106554031 95
96 3300005844 Ga0068862_100591768 Ga0068862_1005917682 95
97 3300005985 Ga0081539_10004809 Ga0081539_1000480911 95
98 3300006028 Ga0070717_10261179 Ga0070717_102611792 95
99 3300006038 Ga0075365_10095246 Ga0075365_100952464 95
100 3300006038 Ga0075365_10322937 Ga0075365_103229371 95
101 3300006038 Ga0075365_11083525 Ga0075365_110835251 95
102 3300006042 Ga0075368_10029042 Ga0075368_100290422 95
103 3300006048 Ga0075363_100150393 Ga0075363_1001503932 95
104 3300006048 Ga0075363_100223918 Ga0075363_1002239182 95
105 3300006048 Ga0075363_100371666 Ga0075363_1003716662 95
106 3300006177 Ga0075362_10002800 Ga0075362_100028006 95
107 3300006178 Ga0075367_10102923 Ga0075367_101029234 95
108 3300006195 Ga0075366_10007995 Ga0075366_100079955 95
109 3300006353 Ga0075370_10010892 Ga0075370_100108924 95
110 3300006353 Ga0075370_10134017 Ga0075370_101340172 95
111 3300006358 Ga0068871_100505642 Ga0068871_1005056422 95
112 3300006358 Ga0068871_100536066 Ga0068871_1005360662 95
113 3300006844 Ga0075428_100109734 Ga0075428_1001097343 95
114 3300006847 Ga0075431_100342723 Ga0075431_1003427233 95
115 3300006881 Ga0068865_100146572 Ga0068865_1001465722 95
116 3300009093 Ga0105240_10018209 Ga0105240_1001820912 95
117 3300009093 Ga0105240_10226968 Ga0105240_102269683 95
118 3300009093 Ga0105240_10487516 Ga0105240_104875162 95
119 3300009093 Ga0105240_10637212 Ga0105240_106372122 95
120 3300009093 Ga0105240_11249350 Ga0105240_112493502 95
121 3300009098 Ga0105245_12572257 Ga0105245_125722571 95
122 3300009147 Ga0114129_10418006 Ga0114129_104180062 95
123 3300009147 Ga0114129_13118014 Ga0114129_131180142 95
124 3300009174 Ga0105241_10025491 Ga0105241_100254912 95
125 3300009174 Ga0105241_10369766 Ga0105241_103697663 95
126 3300009174 Ga0105241_10373539 Ga0105241_103735392 95
127 3300009177 Ga0105248_12676552 Ga0105248_126765522 95
128 3300009545 Ga0105237_10307816 Ga0105237_103078162 95
129 3300009551 Ga0105238_10007784 Ga0105238_100077849 95
130 3300009551 Ga0105238_10028969 Ga0105238_100289696 95
131 3300009551 Ga0105238_10067801 Ga0105238_100678012 95
132 3300009551 Ga0105238_11968112 Ga0105238_119681121 95
133 3300010159 Ga0099796_10130638 Ga0099796_101306381 95
134 3300010375 Ga0105239_10063115 Ga0105239_100631154 95
135 3300010375 Ga0105239_10089462 Ga0105239_100894623 95
136 3300010375 Ga0105239_10259297 Ga0105239_102592972 95
137 3300010375 Ga0105239_13020334 Ga0105239_130203342 95
138 3300011119 Ga0105246_10192954 Ga0105246_101929542 95
139 3300013100 Ga0157373_10305432 Ga0157373_103054322 95
140 3300013102 Ga0157371_10004729 Ga0157371_1000472911 95
141 3300013104 Ga0157370_10020275 Ga0157370_100202755 95
142 3300013104 Ga0157370_10041820 Ga0157370_100418206 95
143 3300013104 Ga0157370_10553119 Ga0157370_105531193 95
144 3300013104 Ga0157370_10972708 Ga0157370_109727082 95
145 3300013105 Ga0157369_10021628 Ga0157369_100216285 95
146 3300013105 Ga0157369_10090815 Ga0157369_100908152 95
147 3300013105 Ga0157369_10735881 Ga0157369_107358812 95
148 3300013296 Ga0157374_10640711 Ga0157374_106407112 95
149 3300013297 Ga0157378_11101347 Ga0157378_111013472 95
150 3300013297 Ga0157378_12130961 Ga0157378_121309611 95
151 3300013306 Ga0163162_10286561 Ga0163162_102865612 95
152 3300013307 Ga0157372_10019075 Ga0157372_100190754 95
153 3300013307 Ga0157372_10222500 Ga0157372_102225004 95
154 3300013307 Ga0157372_10515888 Ga0157372_105158882 95
155 3300013307 Ga0157372_13018641 Ga0157372_130186411 95
156 3300013308 Ga0157375_10799189 Ga0157375_107991892 95
157 3300014325 Ga0163163_12541148 Ga0163163_125411481 95
158 3300015265 Ga0182005_1086793 Ga0182005_10867932 95
159 3300025294 Ga0209025_1179689 Ga0209025_11796892 95
160 3300025321 Ga0207656_10018797 Ga0207656_100187973 95
161 3300025321 Ga0207656_10042576 Ga0207656_100425761 95
162 3300025904 Ga0207647_10008767 Ga0207647_100087675 95
163 3300025904 Ga0207647_10040939 Ga0207647_100409394 95
164 3300025904 Ga0207647_10207006 Ga0207647_102070062 95
165 3300025904 Ga0207647_10407453 Ga0207647_104074532 95
166 3300025907 Ga0207645_10056303 Ga0207645_100563032 95
167 3300025911 Ga0207654_10431775 Ga0207654_104317752 95
168 3300025913 Ga0207695_10112632 Ga0207695_101126322 95
169 3300025913 Ga0207695_10722709 Ga0207695_107227092 95
170 3300025913 Ga0207695_10861012 Ga0207695_108610122 95
171 3300025914 Ga0207671_10229774 Ga0207671_102297742 95
172 3300025915 Ga0207693_10922285 Ga0207693_109222851 95
173 3300025919 Ga0207657_10010037 Ga0207657_100100373 95
174 3300025919 Ga0207657_10201826 Ga0207657_102018263 95
175 3300025919 Ga0207657_10497272 Ga0207657_104972722 95
176 3300025920 Ga0207649_10158742 Ga0207649_101587422 95
177 3300025920 Ga0207649_10169804 Ga0207649_101698042 95
178 3300025920 Ga0207649_10821059 Ga0207649_108210591 95
179 3300025920 Ga0207649_10830983 Ga0207649_108309832 95
180 3300025924 Ga0207694_10012796 Ga0207694_100127967 95
181 3300025924 Ga0207694_10133203 Ga0207694_101332033 95
182 3300025924 Ga0207694_10142100 Ga0207694_101421002 95
183 3300025926 Ga0207659_10541900 Ga0207659_105419002 95
184 3300025927 Ga0207687_10906246 Ga0207687_109062462 95
185 3300025928 Ga0207700_10035659 Ga0207700_100356595 95
186 3300025928 Ga0207700_10693480 Ga0207700_106934802 95
187 3300025932 Ga0207690_10246458 Ga0207690_102464583 95
188 3300025932 Ga0207690_11102099 Ga0207690_111020992 95
189 3300025932 Ga0207690_11402297 Ga0207690_114022972 95
190 3300025933 Ga0207706_10098993 Ga0207706_100989933 95
191 3300025933 Ga0207706_10317608 Ga0207706_103176082 95
192 3300025937 Ga0207669_11028574 Ga0207669_110285742 95
193 3300025945 Ga0207679_10376988 Ga0207679_103769882 95
194 3300025945 Ga0207679_10445307 Ga0207679_104453072 95
195 3300025949 Ga0207667_10067524 Ga0207667_100675243 95
196 3300025949 Ga0207667_10103393 Ga0207667_101033932 95
197 3300025949 Ga0207667_10104089 Ga0207667_101040893 95
198 3300025949 Ga0207667_10121062 Ga0207667_101210623 95
199 3300025949 Ga0207667_10194477 Ga0207667_101944772 95
200 3300025949 Ga0207667_10472678 Ga0207667_104726782 95
201 3300025949 Ga0207667_10875258 Ga0207667_108752582 95
202 3300025960 Ga0207651_10913097 Ga0207651_109130972 95
203 3300025960 Ga0207651_11128890 Ga0207651_111288902 95
204 3300025981 Ga0207640_10099611 Ga0207640_100996112 95
205 3300025981 Ga0207640_10145543 Ga0207640_101455432 95
206 3300025981 Ga0207640_10157930 Ga0207640_101579302 95
207 3300025981 Ga0207640_10596885 Ga0207640_105968852 95
208 3300025986 Ga0207658_11512010 Ga0207658_115120102 95
209 3300026023 Ga0207677_11642843 Ga0207677_116428432 95
210 3300026041 Ga0207639_10027816 Ga0207639_100278162 95
211 3300026041 Ga0207639_10152841 Ga0207639_101528411 95
212 3300026041 Ga0207639_10745813 Ga0207639_107458132 95
213 3300026041 Ga0207639_10852933 Ga0207639_108529331 95
214 3300026067 Ga0207678_10041815 Ga0207678_100418156 95
215 3300026067 Ga0207678_10109274 Ga0207678_101092743 95
216 3300026067 Ga0207678_10327353 Ga0207678_103273532 95
217 3300026067 Ga0207678_11079744 Ga0207678_110797442 95
218 3300026078 Ga0207702_10111185 Ga0207702_101111852 95
219 3300026078 Ga0207702_10169125 Ga0207702_101691252 95
220 3300026078 Ga0207702_10348682 Ga0207702_103486822 95
221 3300026078 Ga0207702_10523207 Ga0207702_105232073 95
222 3300026078 Ga0207702_10940930 Ga0207702_109409302 95
223 3300026089 Ga0207648_10250301 Ga0207648_102503013 95
224 3300026116 Ga0207674_10012932 Ga0207674_100129328 95
225 3300026116 Ga0207674_10046700 Ga0207674_100467003 95
226 3300026116 Ga0207674_10250085 Ga0207674_102500852 95
227 3300026116 Ga0207674_10393326 Ga0207674_103933262 95
228 3300026116 Ga0207674_10451080 Ga0207674_104510802 95
229 3300026142 Ga0207698_10035924 Ga0207698_100359244 95
230 3300026142 Ga0207698_10083221 Ga0207698_100832214 95
231 3300026142 Ga0207698_11060825 Ga0207698_110608252 95
232 3300026142 Ga0207698_11302281 Ga0207698_113022812 95
233 3300027866 Ga0209813_10030911 Ga0209813_100309113 95
234 3300027876 Ga0209974_10092964 Ga0209974_100929642 95
235 3300028379 Ga0268266_10015825 Ga0268266_100158256 95
236 3300028379 Ga0268266_10152113 Ga0268266_101521133 95
237 3300028379 Ga0268266_10187772 Ga0268266_101877723 95
238 3300028380 Ga0268265_10923251 Ga0268265_109232513 95
239 3300028381 Ga0268264_12580701 Ga0268264_125807012 95
240 3300029957 Ga0265324_10092744 Ga0265324_100927442 95
241 3300031235 Ga0265330_10014045 Ga0265330_100140454 95
242 3300031238 Ga0265332_10105974 Ga0265332_101059742 95
243 3300031241 Ga0265325_10007054 Ga0265325_100070547 95
244 3300031242 Ga0265329_10017889 Ga0265329_100178894 95
245 3300031249 Ga0265339_10002073 Ga0265339_100020739 95
246 3300031344 Ga0265316_10111233 Ga0265316_101112332 95
247 3300031595 Ga0265313_10002516 Ga0265313_100025164 95
248 3300031711 Ga0265314_10031996 Ga0265314_100319962 95
249 3300031824 Ga0307413_10975865 Ga0307413_109758652 95
250 3300031824 Ga0307413_11803541 Ga0307413_118035411 95
251 3300031901 Ga0307406_10798100 Ga0307406_107981002 95
252 3300031911 Ga0307412_10811714 Ga0307412_108117141 95
253 3300031911 Ga0307412_11139803 Ga0307412_111398032 95
254 3300032002 Ga0307416_100444379 Ga0307416_1004443791 95
255 3300032004 Ga0307414_10306248 Ga0307414_103062482 95
256 3300032004 Ga0307414_10976316 Ga0307414_109763161 95
257 3300032004 Ga0307414_11025250 Ga0307414_110252502 95
258 3300032133 Ga0316583_10212307 Ga0316583_102123072 95
259 3300035086 Ga0373934_0069578 Ga0373934_0069578_390_677 95
260 3300035090 Ga0373949_0184777 Ga0373949_0184777_66_353 95
261 3300035092 Ga0373952_0225149 Ga0373952_0225149_115_402 95
262 3300035115 Ga0373941_0032567 Ga0373941_0032567_515_802 95
263 3300035117 Ga0373953_0536765 Ga0373953_0536765_146_433 95
264 3300035118 Ga0373954_0357954 Ga0373954_0357954_173_460 95
265 3300035119 Ga0373956_0088501 Ga0373956_0088501_149_436 95
266 3300035121 Ga0373960_0022880 Ga0373960_0022880_681_968 95
267 3300035410 Ga0373924_0149108 Ga0373924_0149108_564_851 95
268 3300035691 Ga0373931_0065679 Ga0373931_0065679_887_1174 95
269 3300035691 Ga0373931_0363132 Ga0373931_0363132_68_355 95
270 3300035692 Ga0373935_0969882 Ga0373935_0969882_149_436 95
271 3300035692 Ga0373935_1449491 Ga0373935_1449491_28_315 95
272 3300035724 Ga0373933_0734417 Ga0373933_0734417_39_326 95
273 3300037068 Ga0373925_0693207 Ga0373925_0693207_251_538 95
274 3300037312 Ga0395899_0153226 Ga0395899_0153226_759_1046 95
275 3300037312 Ga0395899_0192714 Ga0395899_0192714_687_974 95
276 3300037418 Ga0395900_0069929 Ga0395900_0069929_3015_3302 95
277 3300037418 Ga0395900_0484087 Ga0395900_0484087_449_736 95
278 3300037418 Ga0395900_1514257 Ga0395900_1514257_166_453 95
279 3300037466 Ga0395898_0152230 Ga0395898_0152230_1739_2026 95
280 3300037466 Ga0395898_0156151 Ga0395898_0156151_1469_1756 95
281 3300037466 Ga0395898_0299684 Ga0395898_0299684_873_1160 95
282 3300037471 Ga0395905_0011565 Ga0395905_0011565_3228_3515 95
283 3300038443 Ga0395901_0310733 Ga0395901_0310733_587_874 95
284 3300038443 Ga0395901_0681265 Ga0395901_0681265_725_1012 95
285 3300038443 Ga0395901_1035856 Ga0395901_1035856_321_608 95
286 3300039438 Ga0436360_0365885 Ga0436360_0365885_662_949 95
287 3300041411 Ga0439466_0284114 Ga0439466_0284114_10_297 95
288 3300041413 Ga0439465_0177354 Ga0439465_0177354_180_467 95
289 3300041413 Ga0439465_0252195 Ga0439465_0252195_168_455 95
290 3300041452 Ga0451793_1189447 Ga0451793_1189447_548_835 95
291 3300041453 Ga0451797_0270653 Ga0451797_0270653_331_618 95
292 3300041453 Ga0451797_0645602 Ga0451797_0645602_271_558 95
293 3300041459 Ga0451800_0709892 Ga0451800_0709892_145_432 95
294 3300041459 Ga0451800_1519639 Ga0451800_1519639_169_456 95
295 3300041460 Ga0451802_1295978 Ga0451802_1295978_139_426 95
296 3300041486 Ga0451807_2431911 Ga0451807_2431911_265_552 95
297 3300041507 Ga0451851_0708563 Ga0451851_0708563_258_545 95
298 3300042002 Ga0439442_092063 Ga0439442_092063_199_486 95
299 3300042004 Ga0439445_0085266 Ga0439445_0085266_424_711 95
300 3300042004 Ga0439445_0147433 Ga0439445_0147433_42_329 95
301 3300042006 Ga0439432_041128 Ga0439432_041128_32_319 95
302 3300042435 Ga0439434_0055737 Ga0439434_0055737_373_660 95
303 3300046454 Ga0495592_0476946 Ga0495592_0476946_72_359 95
304 3300046472 Ga0495580_0995492 Ga0495580_0995492_79_366 95
305 3300046511 Ga0495608_0353138 Ga0495608_0353138_538_825 95
306 3300046529 Ga0495652_0227303 Ga0495652_0227303_941_1228 95
307 3300046536 Ga0495587_0535916 Ga0495587_0535916_333_620 95
308 3300046559 Ga0495667_0148481 Ga0495667_0148481_251_538 95
309 3300046660 Ga0495625_0766021 Ga0495625_0766021_233_520 95
310 3300046675 Ga0495657_0706193 Ga0495657_0706193_163_450 95
311 3300046689 Ga0495613_0940217 Ga0495613_0940217_42_329 95
312 3300047317 Ga0495604_0458742 Ga0495604_0458742_61_348 95
313 3300047444 Ga0495675_0203883 Ga0495675_0203883_174_461 95
314 3300047472 Ga0495686_0500268 Ga0495686_0500268_324_611 95
315 3300048907 Ga0496104_0001487 Ga0496104_0001487_12627_12914 95
316 3300048908 Ga0496105_0012075 Ga0496105_0012075_732_1019 95
317 3300048909 Ga0496106_0198256 Ga0496106_0198256_931_1218 95
318 3300048912 Ga0496109_1853211 Ga0496109_1853211_85_372 95
319 3300048913 Ga0496110_0334262 Ga0496110_0334262_538_825 95
320 3300048915 Ga0496112_1405676 Ga0496112_1405676_251_538 95
321 3300048916 Ga0496113_0542277 Ga0496113_0542277_35_322 95
322 3300048918 Ga0496115_0143147 Ga0496115_0143147_723_1010 95
323 3300048920 Ga0496117_0437703 Ga0496117_0437703_75_362 95
324 3300048921 Ga0496118_0109367 Ga0496118_0109367_389_676 95
325 3300048924 Ga0496121_0220249 Ga0496121_0220249_828_1115 95
326 3300048927 Ga0496124_0140521 Ga0496124_0140521_429_716 95
327 3300048927 Ga0496124_0694887 Ga0496124_0694887_20_307 95
328 3300048928 Ga0496125_0000600 Ga0496125_0000600_2955_3281 95
329 3300049568 Ga0501031_0431806 Ga0501031_0431806_548_835 95
330 3300049569 Ga0501032_0660458 Ga0501032_0660458_357_644 95
331 3300049569 Ga0501032_0746920 Ga0501032_0746920_17_304 95
332 3300049570 Ga0501033_0028728 Ga0501033_0028728_679_966 95
333 3300049570 Ga0501033_0369575 Ga0501033_0369575_281_568 95
334 3300049571 Ga0501034_0003057 Ga0501034_0003057_2504_2791 95
335 3300049571 Ga0501034_0030710 Ga0501034_0030710_549_836 95
336 3300049571 Ga0501034_0050009 Ga0501034_0050009_1326_1613 95
337 3300049571 Ga0501034_0071799 Ga0501034_0071799_1710_1997 95
338 3300049571 Ga0501034_0109265 Ga0501034_0109265_2280_2567 95
339 3300049571 Ga0501034_0127082 Ga0501034_0127082_34_321 95
340 3300049571 Ga0501034_0157945 Ga0501034_0157945_1306_1593 95
341 3300049571 Ga0501034_0277947 Ga0501034_0277947_418_705 95
342 3300049571 Ga0501034_0455124 Ga0501034_0455124_114_401 95
343 3300049571 Ga0501034_0505031 Ga0501034_0505031_52_339 95
344 3300049571 Ga0501034_0625846 Ga0501034_0625846_612_899 95
345 3300049571 Ga0501034_0712363 Ga0501034_0712363_104_391 95
346 3300049571 Ga0501034_0746801 Ga0501034_0746801_165_452 95
347 3300049571 Ga0501034_0881187 Ga0501034_0881187_129_416 95
348 3300049571 Ga0501034_1312317 Ga0501034_1312317_82_369 95
349 3300049572 Ga0501036_0070182 Ga0501036_0070182_1528_1815 95
350 3300049572 Ga0501036_0564061 Ga0501036_0564061_295_582 95
351 3300049572 Ga0501036_0805051 Ga0501036_0805051_474_761 95
352 3300049572 Ga0501036_0908022 Ga0501036_0908022_70_357 95
353 3300049573 Ga0501037_0027745 Ga0501037_0027745_1954_2241 95
354 3300049573 Ga0501037_0245811 Ga0501037_0245811_268_555 95
355 3300049573 Ga0501037_0343592 Ga0501037_0343592_437_724 95
356 3300049573 Ga0501037_0629315 Ga0501037_0629315_202_489 95
357 3300049574 Ga0501038_0045781 Ga0501038_0045781_2992_3279 95
358 3300049574 Ga0501038_0214920 Ga0501038_0214920_602_889 95
359 3300049574 Ga0501038_0297979 Ga0501038_0297979_817_1104 95
360 3300049574 Ga0501038_1050212 Ga0501038_1050212_173_460 95
361 3300049574 Ga0501038_1107743 Ga0501038_1107743_41_328 95
362 3300049575 Ga0501039_0081052 Ga0501039_0081052_549_836 95
363 3300049575 Ga0501039_0518693 Ga0501039_0518693_508_795 95
364 3300049577 Ga0501041_0396364 Ga0501041_0396364_502_789 95
365 3300049579 Ga0501043_0408635 Ga0501043_0408635_129_416 95
366 3300049579 Ga0501043_0472675 Ga0501043_0472675_423_710 95
367 3300049579 Ga0501043_0557235 Ga0501043_0557235_444_731 95
368 3300049579 Ga0501043_0571109 Ga0501043_0571109_525_812 95
369 3300049579 Ga0501043_1067402 Ga0501043_1067402_148_435 95
370 3300049579 Ga0501043_1198509 Ga0501043_1198509_186_473 95
371 3300049580 Ga0501046_0031168 Ga0501046_0031168_735_1022 95
372 3300049580 Ga0501046_0771245 Ga0501046_0771245_272_559 95
373 3300049581 Ga0501047_0084594 Ga0501047_0084594_2718_3005 95
374 3300049581 Ga0501047_0095998 Ga0501047_0095998_1181_1468 95
375 3300049581 Ga0501047_0140584 Ga0501047_0140584_1328_1690 95
376 3300049581 Ga0501047_0669979 Ga0501047_0669979_97_384 95
377 3300049582 Ga0501048_0327779 Ga0501048_0327779_760_1047 95
378 3300049584 Ga0501068_0186452 Ga0501068_0186452_129_416 95
379 3300049584 Ga0501068_0823814 Ga0501068_0823814_93_380 95
380 3300049586 Ga0501070_0098203 Ga0501070_0098203_529_816 95
381 3300049586 Ga0501070_0507852 Ga0501070_0507852_94_456 95
382 3300049586 Ga0501070_1481150 Ga0501070_1481150_121_408 95
383 3300049587 Ga0501071_0190135 Ga0501071_0190135_139_426 95
384 3300049589 Ga0501073_0085262 Ga0501073_0085262_1403_1690 95
385 3300049589 Ga0501073_0202042 Ga0501073_0202042_568_855 95
386 3300049589 Ga0501073_1038368 Ga0501073_1038368_107_469 95
387 3300049589 Ga0501073_1146912 Ga0501073_1146912_98_385 95
388 3300049590 Ga0501074_0363518 Ga0501074_0363518_683_970 95
389 3300049590 Ga0501074_0854127 Ga0501074_0854127_301_588 95
390 3300049591 Ga0501075_1264225 Ga0501075_1264225_218_505 95
391 3300049592 Ga0501076_0322104 Ga0501076_0322104_701_988 95
392 3300049742 Ga0501080_0403988 Ga0501080_0403988_212_574 95
393 3300049742 Ga0501080_1208399 Ga0501080_1208399_46_333 95
394 3300049742 Ga0501080_1861856 Ga0501080_1861856_127_414 95
395 3300049822 Ga0501035_0218399 Ga0501035_0218399_230_517 95
396 3300049822 Ga0501035_0407548 Ga0501035_0407548_554_841 95
397 3300049822 Ga0501035_0618261 Ga0501035_0618261_555_842 95
398 3300049823 Ga0501044_0040406 Ga0501044_0040406_3635_3922 95
399 3300049823 Ga0501044_0349223 Ga0501044_0349223_882_1169 95
400 3300049823 Ga0501044_0518065 Ga0501044_0518065_550_837 95
401 3300049823 Ga0501044_0762794 Ga0501044_0762794_352_639 95
402 3300049823 Ga0501044_0765793 Ga0501044_0765793_230_517 95
403 3300050489 nmdc:mga03683_2282_c1 nmdc:mga03683_2282_c1_2412_2699 95
404 3300050490 nmdc:mga03n38_107620_c1 nmdc:mga03n38_107620_c1_836_1123 95
405 3300050490 nmdc:mga03n38_255395_c1 nmdc:mga03n38_255395_c1_211_498 95
406 3300050492 nmdc:mga0yw44_24211_c1 nmdc:mga0yw44_24211_c1_220_507 95
407 3300050492 nmdc:mga0yw44_476671_c1 nmdc:mga0yw44_476671_c1_410_697 95
408 3300050493 nmdc:mga0k408_57890_c1 nmdc:mga0k408_57890_c1_814_1101 95
409 3300050494 nmdc:mga06z11_8511_c1 nmdc:mga06z11_8511_c1_3581_3868 95
410 3300050495 nmdc:mga04h51_36848_c1 nmdc:mga04h51_36848_c1_661_948 95
411 3300050496 nmdc:mga07m45_10439_c1 nmdc:mga07m45_10439_c1_1010_1297 95
412 3300050496 nmdc:mga07m45_26534_c1 nmdc:mga07m45_26534_c1_793_1080 95
413 3300050507 nmdc:mga05p37_184464_c1 nmdc:mga05p37_184464_c1_1374_1661 95
414 3300050509 nmdc:mga0qj67_927134_c1 nmdc:mga0qj67_927134_c1_20_307 95
415 3300050510 nmdc:mga06r32_1557922_c1 nmdc:mga06r32_1557922_c1_197_484 95
416 3300053077 Ga0495601_0127459 Ga0495601_0127459_1341_1628 95
417 3300053078 Ga0495612_0254454 Ga0495612_0254454_475_762 95
418 3300053083 Ga0495655_0189213 Ga0495655_0189213_287_574 95
419 3300053119 Ga0500595_013139 Ga0500595_013139_1074_1361 95
420 3300053125 Ga0500618_013461 Ga0500618_013461_146_499 95
421 3300053130 Ga0500642_0437952 Ga0500642_0437952_189_476 95
422 3300053153 Ga0500616_0013814 Ga0500616_0013814_1942_2229 95
423 3300054114 Ga0501084_0620003 Ga0501084_0620003_397_684 95
424 3300060353 Ga0501082_0215429 Ga0501082_0215429_1033_1320 95
425 3300061734 Ga0530510_0395757 Ga0530510_0395757_239_526 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02686

GatC

Glu-tRNAGln amidotransferase C subunit

31

102

0.9

Feature Viewer

pLDDT pTM Quality
81.28 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map