F440982

General Info

Members Datasets Scaffolds Average Seq Length
425 271 850 285

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10060041|Ga0213876_100600412
Length 302
Sequence MTNKEEAQDQMASLKALKIRISSVKSTQKITKAMKMVAAAKLRRAQTAAEAARPYAERMENVVQSIVAKVTIGPESPKLLAGTGSDQCHMLIVCTSDRGLAGGFNSNIVRAARRKAEALIAEGKTVYFYLVGRKGRAVIGRLYPKQILHQHDTSAIKQVSFADAQEIAKDVIDRYLTDGIDVVHLFYARFRSALVQEPVDQQIIPVPRAEAEAAQTSLAAVEYEPDQDEILADLLPRNVAVQIFRALLENAASEQGSRMTAMDNATRNAGDMINRLTIEYNRTRQAAITKELIEIISGAEAL

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
241 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
242 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
250 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
251 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
253 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
254 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
255 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
256 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
257 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
258 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
259 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
260 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
261 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
262 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
263 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
264 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
265 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
266 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
267 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
268 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
269 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
270 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
271 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 0.24
Isolates 4.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.94
Nodule 0
Rhizoplane 2.12
Rhizosphere 80.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10060041 3300021384 Bacteria 2006
2 JGI24739J22299_10047538 3300001989 Bacteria 1399
3 Ga0055534_1015648 3300003784 Bacteria 1384
4 Ga0055530_10000005 3300003791 Bacteria 206625
5 Ga0070658_10000001 3300005327 Bacteria 856789
6 Ga0070658_10007416 3300005327 Bacteria 8857
7 Ga0070677_10007729 3300005333 Bacteria 3600
8 Ga0070680_100000084 3300005336 Bacteria 51930
9 Ga0068868_100000752 3300005338 Bacteria 21953
10 Ga0070660_100000322 3300005339 Bacteria 31658
11 Ga0070660_100000862 3300005339 Bacteria 20203
12 Ga0070660_100165155 3300005339 Bacteria 1786
13 Ga0070689_100216221 3300005340 Bacteria 1570
14 Ga0070661_100061799 3300005344 Bacteria 2749
15 Ga0070669_100184829 3300005353 Bacteria 1633
16 Ga0070675_100010738 3300005354 Bacteria 7163
17 Ga0070671_100002907 3300005355 Bacteria 13329
18 Ga0070673_100178456 3300005364 Bacteria 1817
19 Ga0070688_100090440 3300005365 Bacteria 1999
20 Ga0070659_100000032 3300005366 Bacteria 120241
21 Ga0070659_100180661 3300005366 Bacteria 1731
22 Ga0070710_10057420 3300005437 Bacteria 2206
23 Ga0070681_10000001 3300005458 Bacteria 946857
24 Ga0070681_10203875 3300005458 Bacteria 1895
25 Ga0070679_100000577 3300005530 Bacteria 31104
26 Ga0070679_100006819 3300005530 Bacteria 10652
27 Ga0070684_100495247 3300005535 Bacteria 1132
28 Ga0068853_100000183 3300005539 Bacteria 44130
29 Ga0068853_100054057 3300005539 Bacteria 3460
30 Ga0070686_100000490 3300005544 Bacteria 23906
31 Ga0070665_100000443 3300005548 Bacteria 60385
32 Ga0070665_100000477 3300005548 Bacteria 57691
33 Ga0070665_100009398 3300005548 Bacteria 9894
34 Ga0070665_100144123 3300005548 Bacteria 2386
35 Ga0070665_100206787 3300005548 Bacteria 1964
36 Ga0070665_100273581 3300005548 Bacteria 1691
37 Ga0070665_100340933 3300005548 Bacteria 1503
38 Ga0068855_100081458 3300005563 Bacteria 3751
39 Ga0068854_100023901 3300005578 Bacteria 4178
40 Ga0068854_100063083 3300005578 Bacteria 2689
41 Ga0068856_100192641 3300005614 Bacteria 2052
42 Ga0068852_100363198 3300005616 Bacteria 1416
43 Ga0068863_100080147 3300005841 Bacteria 3092
44 Ga0068858_100263500 3300005842 Bacteria 1639
45 Ga0081540_1008698 3300005983 Bacteria 7065
46 Ga0081540_1016698 3300005983 Bacteria 4578
47 Ga0075365_10011698 3300006038 Bacteria 5172
48 Ga0075362_10093977 3300006177 Bacteria 1395
49 Ga0075367_10113182 3300006178 Bacteria 1667
50 Ga0075434_100151229 3300006871 Bacteria 2341
51 Ga0075435_100286947 3300007076 Bacteria 1406
52 Ga0105240_10272413 3300009093 Bacteria 1948
53 Ga0105240_10319941 3300009093 Bacteria 1769
54 Ga0105245_10356504 3300009098 Bacteria 1451
55 Ga0114129_10203220 3300009147 Bacteria 2682
56 Ga0114129_10615663 3300009147 Bacteria 1405
57 Ga0105243_10378491 3300009148 Bacteria 1308
58 Ga0105241_10201929 3300009174 Bacteria 1661
59 Ga0105248_10000005 3300009177 Bacteria 673111
60 Ga0105237_10029201 3300009545 Bacteria 5609
61 Ga0105239_10190992 3300010375 Bacteria 2292
62 Ga0105239_10336174 3300010375 Bacteria 1704
63 Ga0157369_10023927 3300013105 Bacteria 6799
64 Ga0157369_10105249 3300013105 Bacteria 3004
65 Ga0157369_10370857 3300013105 Bacteria 1486
66 Ga0157369_10535423 3300013105 Bacteria 1211
67 Ga0157380_10103744 3300014326 Bacteria 2373
68 Ga0206356_11086493 3300020070 Bacteria 1713
69 Ga0213872_10119343 3300021361 Bacteria 1166
70 Ga0213874_10053750 3300021377 Bacteria 1243
71 Ga0213876_10000332 3300021384 Bacteria 41214
72 Ga0213876_10049954 3300021384 Bacteria 2210
73 Ga0209148_1002869 3300025254 Bacteria 5287
74 Ga0209455_1016297 3300025272 Bacteria 1600
75 Ga0209675_1000245 3300025291 Bacteria 53738
76 Ga0209676_1003576 3300025292 Bacteria 9387
77 Ga0209676_1007169 3300025292 Bacteria 5316
78 Ga0209676_1042269 3300025292 Bacteria 1267
79 Ga0209025_1034619 3300025294 Bacteria 2301
80 Ga0209758_1000013 3300025297 Bacteria 873003
81 Ga0209758_1055121 3300025297 Bacteria 1353
82 Ga0209257_1000113 3300025304 Bacteria 233523
83 Ga0209257_1015227 3300025304 Bacteria 3221
84 Ga0207682_10008405 3300025893 Bacteria 4084
85 Ga0207692_10045895 3300025898 Bacteria 2188
86 Ga0207705_10000002 3300025909 Bacteria 2046852
87 Ga0207705_10029768 3300025909 Bacteria 3892
88 Ga0207707_10000001 3300025912 Bacteria 1212482
89 Ga0207707_10278959 3300025912 Bacteria 1448
90 Ga0207695_10030846 3300025913 Bacteria 5897
91 Ga0207695_10137621 3300025913 Bacteria 2394
92 Ga0207671_10054197 3300025914 Bacteria 2972
93 Ga0207693_10041897 3300025915 Bacteria 3604
94 Ga0207660_10003756 3300025917 Bacteria 9887
95 Ga0207657_10000601 3300025919 Bacteria 38257
96 Ga0207657_10028192 3300025919 Bacteria 5128
97 Ga0207657_10080109 3300025919 Bacteria 2746
98 Ga0207652_10000879 3300025921 Bacteria 28409
99 Ga0207652_10019823 3300025921 Bacteria 5537
100 Ga0207681_10192510 3300025923 Bacteria 1561
101 Ga0207650_10033872 3300025925 Bacteria 3703
102 Ga0207659_10377620 3300025926 Bacteria 1181
103 Ga0207664_10156366 3300025929 Bacteria 1941
104 Ga0207664_10531517 3300025929 Bacteria 1054
105 Ga0207644_10007442 3300025931 Bacteria 7139
106 Ga0207690_10000001 3300025932 Bacteria 807539
107 Ga0207690_10030308 3300025932 Bacteria 3449
108 Ga0207706_10176640 3300025933 Bacteria 1876
109 Ga0207670_10097191 3300025936 Bacteria 2096
110 Ga0207669_10122311 3300025937 Bacteria 1770
111 Ga0207691_10057569 3300025940 Bacteria 3537
112 Ga0207711_10000002 3300025941 Bacteria 1228676
113 Ga0207689_10271080 3300025942 Bacteria 1405
114 Ga0207661_10284568 3300025944 Bacteria 1478
115 Ga0207667_10086557 3300025949 Bacteria 3243
116 Ga0207651_10112787 3300025960 Bacteria 2044
117 Ga0207640_10048981 3300025981 Bacteria 2734
118 Ga0207677_10004348 3300026023 Bacteria 7591
119 Ga0207703_10274698 3300026035 Bacteria 1528
120 Ga0207639_10000220 3300026041 Bacteria 42726
121 Ga0207639_10089891 3300026041 Bacteria 2455
122 Ga0207708_10392740 3300026075 Bacteria 1146
123 Ga0207702_10166764 3300026078 Bacteria 2016
124 Ga0207641_10017586 3300026088 Bacteria 5853
125 Ga0207674_10078392 3300026116 Bacteria 3309
126 Ga0207698_10673143 3300026142 Bacteria 1027
127 Ga0209813_10001732 3300027866 Bacteria 4916
128 Ga0268266_10000083 3300028379 Bacteria 202393
129 Ga0268266_10000459 3300028379 Bacteria 59218
130 Ga0268266_10001187 3300028379 Bacteria 32144
131 Ga0268266_10343331 3300028379 Bacteria 1402
132 Ga0268264_10041584 3300028381 Bacteria 3803
133 Ga0265334_10012457 3300028573 Bacteria 3573
134 Ga0265338_10000005 3300028800 Bacteria 571137
135 Ga0265338_10011364 3300028800 Bacteria 10292
136 Ga0265338_10073228 3300028800 Bacteria 2921
137 Ga0265338_10168640 3300028800 Bacteria 1682
138 Ga0265332_10047253 3300031238 Bacteria 1852
139 Ga0265332_10050728 3300031238 Bacteria 1783
140 Ga0265320_10009024 3300031240 Bacteria 6046
141 Ga0265325_10000005 3300031241 Bacteria 321343
142 Ga0265325_10035353 3300031241 Bacteria 2654
143 Ga0265325_10137479 3300031241 Bacteria 1165
144 Ga0265339_10005179 3300031249 Bacteria 8739
145 Ga0265331_10008312 3300031250 Bacteria 5910
146 Ga0265331_10025003 3300031250 Bacteria 3016
147 Ga0307408_100060621 3300031548 Bacteria 2758
148 Ga0265313_10008815 3300031595 Bacteria 6644
149 Ga0265313_10011930 3300031595 Bacteria 5362
150 Ga0265313_10015787 3300031595 Bacteria 4374
151 Ga0307508_10098941 3300031616 Bacteria 2510
152 Ga0265314_10021624 3300031711 Bacteria 4941
153 Ga0265314_10025347 3300031711 Bacteria 4475
154 Ga0265314_10151363 3300031711 Bacteria 1422
155 Ga0307405_10134236 3300031731 Bacteria 1715
156 Ga0307405_10207248 3300031731 Bacteria 1428
157 Ga0307413_10003276 3300031824 Bacteria 6790
158 Ga0307410_10225403 3300031852 Bacteria 1444
159 Ga0307406_10112523 3300031901 Bacteria 1877
160 Ga0307406_10200723 3300031901 Bacteria 1468
161 Ga0307406_10221839 3300031901 Bacteria 1405
162 Ga0307412_10000755 3300031911 Bacteria 18765
163 Ga0307412_10050039 3300031911 Bacteria 2756
164 Ga0307412_10094963 3300031911 Bacteria 2095
165 Ga0307412_10255729 3300031911 Bacteria 1362
166 Ga0307409_100419514 3300031995 Bacteria 1283
167 Ga0307416_100205935 3300032002 Bacteria 1871
168 Ga0307414_10001853 3300032004 Bacteria 10942
169 Ga0307414_10010139 3300032004 Bacteria 5450
170 Ga0307414_10016781 3300032004 Bacteria 4463
171 Ga0307414_10022063 3300032004 Bacteria 4008
172 Ga0307414_10042519 3300032004 Bacteria 3088
173 Ga0307415_100120909 3300032126 Bacteria 1963
174 Ga0307510_10150103 3300033180 Bacteria 1952
175 Ga0373944_0000663 3300035089 Bacteria 8205
176 Ga0373923_0014862 3300035111 Bacteria 2931
177 Ga0373923_0114556 3300035111 Bacteria 1200
178 Ga0373945_0045902 3300035116 Bacteria 1592
179 Ga0373954_0023519 3300035118 Bacteria 2802
180 Ga0373956_0009289 3300035119 Bacteria 3996
181 Ga0373956_0068858 3300035119 Bacteria 1612
182 Ga0373943_0000717 3300035170 Bacteria 14508
183 Ga0373943_0169793 3300035170 Bacteria 1193
184 Ga0373955_0004793 3300035172 Bacteria 6024
185 Ga0373955_0049973 3300035172 Bacteria 2272
186 Ga0373955_0058797 3300035172 Bacteria 2116
187 Ga0373955_0098999 3300035172 Bacteria 1671
188 Ga0373924_0047420 3300035410 Bacteria 1772
189 Ga0373935_0090320 3300035692 Bacteria 2004
190 Ga0373935_0136238 3300035692 Bacteria 1654
191 Ga0373933_0003096 3300035724 Bacteria 9274
192 Ga0373933_0021124 3300035724 Bacteria 3695
193 Ga0373933_0294669 3300035724 Bacteria 1050
194 Ga0373947_0001210 3300035725 Bacteria 15877
195 Ga0373947_0062054 3300035725 Bacteria 2273
196 Ga0373947_0169601 3300035725 Bacteria 1415
197 Ga0373937_0120796 3300036401 Bacteria 2441
198 Ga0373937_0214256 3300036401 Bacteria 1812
199 Ga0373925_0012311 3300037068 Bacteria 6191
200 Ga0373925_0074041 3300037068 Bacteria 2579
201 Ga0373925_0391571 3300037068 Bacteria 1132
202 Ga0395899_0115406 3300037312 Bacteria 1927
203 Ga0395899_0201008 3300037312 Bacteria 1389
204 Ga0395900_0179640 3300037418 Bacteria 2151
205 Ga0395900_0425708 3300037418 Bacteria 1287
206 Ga0395898_0067087 3300037466 Bacteria 3474
207 Ga0395898_0167961 3300037466 Bacteria 2097
208 Ga0395905_0125225 3300037471 Bacteria 2416
209 Ga0395905_0443752 3300037471 Bacteria 1195
210 Ga0436364_0973593 3300037853 Bacteria 1458
211 Ga0436365_0010969 3300039437 Bacteria 175809
212 Ga0436365_1453675 3300039437 Bacteria 1711
213 Ga0436365_1505188 3300039437 Bacteria 1881
214 Ga0436360_0118418 3300039438 Bacteria 2910
215 Ga0436363_0372048 3300039450 Bacteria 1298
216 Ga0466968_0051095 3300044735 Bacteria 1766
217 Ga0466957_0266784 3300044842 Bacteria 1142
218 Ga0466959_0123566 3300045049 Bacteria 1838
219 Ga0451576_0103373 3300045051 Bacteria 2963
220 Ga0451576_0130328 3300045051 Bacteria 2621
221 Ga0451576_0240272 3300045051 Bacteria 1892
222 Ga0466958_0031237 3300045836 Bacteria 3165
223 Ga0466958_0165932 3300045836 Bacteria 1397
224 Ga0466967_0219787 3300045976 Bacteria 1805
225 Ga0495592_0012028 3300046454 Bacteria 6559
226 Ga0495592_0033389 3300046454 Bacteria 3881
227 Ga0495603_0060015 3300046455 Bacteria 2247
228 Ga0495629_0002506 3300046459 Bacteria 14099
229 Ga0495651_0005603 3300046462 Bacteria 9570
230 Ga0495653_0065711 3300046463 Bacteria 2729
231 Ga0495653_0249839 3300046463 Bacteria 1177
232 Ga0495605_0055670 3300046474 Bacteria 1910
233 Ga0495639_0061953 3300046475 Bacteria 1716
234 Ga0495662_0001748 3300046476 Bacteria 10854
235 Ga0495662_0027901 3300046476 Bacteria 2727
236 Ga0495662_0107818 3300046476 Bacteria 1364
237 Ga0495664_0003702 3300046477 Bacteria 8339
238 Ga0495664_0102715 3300046477 Bacteria 1723
239 Ga0495664_0201552 3300046477 Bacteria 1206
240 Ga0495584_0046166 3300046491 Bacteria 2197
241 Ga0495585_0048038 3300046492 Bacteria 2374
242 Ga0495594_0259004 3300046499 Bacteria 991
243 Ga0495608_0004975 3300046511 Bacteria 9510
244 Ga0495608_0292005 3300046511 Bacteria 1010
245 Ga0495616_0000017 3300046513 Bacteria 167324
246 Ga0495618_0006095 3300046514 Bacteria 7313
247 Ga0495618_0008522 3300046514 Bacteria 6199
248 Ga0495628_0060808 3300046516 Bacteria 2963
249 Ga0495628_0211544 3300046516 Bacteria 1458
250 Ga0495630_0163700 3300046517 Bacteria 1693
251 Ga0495630_0190354 3300046517 Bacteria 1565
252 Ga0495666_0059238 3300046526 Bacteria 1831
253 Ga0495666_0072211 3300046526 Bacteria 1639
254 Ga0495642_0098367 3300046528 Bacteria 1243
255 Ga0495652_0007492 3300046529 Bacteria 10059
256 Ga0495652_0044599 3300046529 Bacteria 3817
257 Ga0495652_0221026 3300046529 Bacteria 1423
258 Ga0495654_0089447 3300046530 Bacteria 1431
259 Ga0495665_0064362 3300046531 Bacteria 1935
260 Ga0495665_0124960 3300046531 Bacteria 1347
261 Ga0495640_0001002 3300046533 Bacteria 21866
262 Ga0495640_0021200 3300046533 Bacteria 4772
263 Ga0495640_0085117 3300046533 Bacteria 2095
264 Ga0495640_0134992 3300046533 Bacteria 1594
265 Ga0495587_0006136 3300046536 Bacteria 7840
266 Ga0495587_0023338 3300046536 Bacteria 3801
267 Ga0495645_0012008 3300046543 Bacteria 6104
268 Ga0495645_0044812 3300046543 Bacteria 3226
269 Ga0495622_0010255 3300046557 Bacteria 4332
270 Ga0495622_0070766 3300046557 Bacteria 1610
271 Ga0495667_0000595 3300046559 Bacteria 23008
272 Ga0495656_0003266 3300046615 Bacteria 5471
273 Ga0495656_0046612 3300046615 Bacteria 1835
274 Ga0495668_0000004 3300046616 Bacteria 574236
275 Ga0495634_0070632 3300046642 Bacteria 2301
276 Ga0495625_0014924 3300046660 Bacteria 6177
277 Ga0495635_0000375 3300046663 Bacteria 28276
278 Ga0495635_0009867 3300046663 Bacteria 6672
279 Ga0495657_0016147 3300046675 Bacteria 5444
280 Ga0495599_0007301 3300046678 Bacteria 6694
281 Ga0495599_0042044 3300046678 Bacteria 2868
282 Ga0495623_0000847 3300046679 Bacteria 20690
283 Ga0495623_0083593 3300046679 Bacteria 1971
284 Ga0495646_0025588 3300046680 Bacteria 3712
285 Ga0495646_0040684 3300046680 Bacteria 2861
286 Ga0495646_0101554 3300046680 Bacteria 1648
287 Ga0495647_0008990 3300046681 Bacteria 3370
288 Ga0495658_0010718 3300046683 Bacteria 4590
289 Ga0495613_0103602 3300046689 Bacteria 2054
290 Ga0495624_0003125 3300046690 Bacteria 12373
291 Ga0495624_0072841 3300046690 Bacteria 2136
292 Ga0495624_0169886 3300046690 Bacteria 1330
293 Ga0495671_0006427 3300046692 Bacteria 6786
294 Ga0495649_0024218 3300046694 Bacteria 3386
295 Ga0495600_0000264 3300046809 Bacteria 28757
296 Ga0495600_0222642 3300046809 Bacteria 1206
297 Ga0495581_0007765 3300047315 Bacteria 6209
298 Ga0495604_0000130 3300047317 Bacteria 63418
299 Ga0495674_0003109 3300047319 Bacteria 16124
300 Ga0495676_0016319 3300047321 Bacteria 6596
301 Ga0495676_0105629 3300047321 Bacteria 2076
302 Ga0495680_0006651 3300047322 Bacteria 10703
303 Ga0495680_0021485 3300047322 Bacteria 5401
304 Ga0495675_0105045 3300047444 Bacteria 1765
305 Ga0495684_0121321 3300047471 Bacteria 1968
306 Ga0495684_0280825 3300047471 Bacteria 1201
307 Ga0495593_0056018 3300047673 Bacteria 2073
308 Ga0495602_0000910 3300048088 Bacteria 28607
309 Ga0496100_0129266 3300048903 Bacteria 1777
310 Ga0496107_0148081 3300048910 Bacteria 1736
311 Ga0496107_0228254 3300048910 Bacteria 1385
312 Ga0496110_0452894 3300048913 Bacteria 1169
313 Ga0496112_0004430 3300048915 Bacteria 11892
314 Ga0496114_0058870 3300048917 Bacteria 3208
315 Ga0496115_0006959 3300048918 Bacteria 8307
316 Ga0496115_0247085 3300048918 Bacteria 1470
317 Ga0496117_0009044 3300048920 Bacteria 9366
318 Ga0496117_0166979 3300048920 Bacteria 1282
319 Ga0496119_0040304 3300048922 Bacteria 2989
320 Ga0496119_0066579 3300048922 Bacteria 2128
321 Ga0496120_0042076 3300048923 Bacteria 2670
322 Ga0496120_0064252 3300048923 Bacteria 2038
323 Ga0496121_0106372 3300048924 Bacteria 2151
324 Ga0496122_0000306 3300048925 Bacteria 108166
325 Ga0496123_0001592 3300048926 Bacteria 30871
326 Ga0496124_0004042 3300048927 Bacteria 17417
327 Ga0496124_0112082 3300048927 Bacteria 2194
328 Ga0496125_0131456 3300048928 Bacteria 1761
329 Ga0496126_0302121 3300048929 Bacteria 1320
330 Ga0496126_0517442 3300048929 Bacteria 951
331 Ga0501032_0036007 3300049569 Bacteria 3380
332 Ga0501033_0156735 3300049570 Bacteria 1640
333 Ga0501033_0162665 3300049570 Bacteria 1606
334 Ga0501034_0101595 3300049571 Bacteria 2869
335 Ga0501034_0102424 3300049571 Bacteria 2856
336 Ga0501034_0171996 3300049571 Bacteria 2133
337 Ga0501034_0223173 3300049571 Bacteria 1836
338 Ga0501036_0052857 3300049572 Bacteria 3440
339 Ga0501036_0304442 3300049572 Bacteria 1333
340 Ga0501036_0413480 3300049572 Bacteria 1125
341 Ga0501037_0236144 3300049573 Bacteria 1282
342 Ga0501038_0049178 3300049574 Bacteria 3646
343 Ga0501038_0131080 3300049574 Bacteria 2058
344 Ga0501038_0206446 3300049574 Bacteria 1574
345 Ga0501039_0056777 3300049575 Bacteria 3033
346 Ga0501039_0274480 3300049575 Bacteria 1325
347 Ga0501043_0069682 3300049579 Bacteria 2762
348 Ga0501043_0189212 3300049579 Bacteria 1601
349 Ga0501046_0023011 3300049580 Bacteria 5130
350 Ga0501046_0121797 3300049580 Bacteria 1984
351 Ga0501047_0029027 3300049581 Bacteria 5335
352 Ga0501047_0180859 3300049581 Bacteria 1975
353 Ga0501047_0264199 3300049581 Bacteria 1568
354 Ga0501047_0407869 3300049581 Bacteria 1191
355 Ga0501047_0444294 3300049581 Bacteria 1126
356 Ga0501068_0043678 3300049584 Bacteria 2697
357 Ga0501069_0034249 3300049585 Bacteria 2797
358 Ga0501070_0078899 3300049586 Bacteria 2724
359 Ga0501071_0140465 3300049587 Bacteria 1798
360 Ga0501073_0079153 3300049589 Bacteria 2287
361 Ga0501080_0037772 3300049742 Bacteria 4509
362 Ga0501080_0151243 3300049742 Bacteria 2145
363 Ga0501035_0052796 3300049822 Bacteria 3636
364 Ga0501035_0196686 3300049822 Bacteria 1731
365 Ga0501044_0000398 3300049823 Bacteria 53733
366 Ga0501044_0002015 3300049823 Bacteria 23423
367 Ga0501044_0073055 3300049823 Bacteria 3486
368 Ga0501044_0214686 3300049823 Bacteria 1877
369 Ga0501045_0004946 3300049824 Bacteria 9234
370 nmdc:mga03683_49878_c1 3300050489 Bacteria 1744
371 nmdc:mga05p37_662093_c1 3300050507 Bacteria 1167
372 nmdc:mga08y16_386407_c1 3300050511 Bacteria 1434
373 nmdc:mga0n895_202561_c1 3300050512 Bacteria 2015
374 nmdc:mga0n895_43840_c1 3300050512 Bacteria 4361
375 nmdc:mga0rr50_120135_c1 3300050513 Bacteria 2090
376 nmdc:mga0a205_102201_c1 3300050515 Bacteria 2174
377 nmdc:mga0a205_190174_c1 3300050515 Bacteria 1945
378 Ga0495601_0008991 3300053077 Bacteria 5897
379 Ga0495601_0032115 3300053077 Bacteria 3266
380 Ga0495612_0000597 3300053078 Bacteria 14498
381 Ga0495612_0006632 3300053078 Bacteria 4748
382 Ga0495595_0003518 3300053084 Bacteria 6216
383 Ga0495595_0026891 3300053084 Bacteria 2559
384 Ga0495619_0001313 3300053085 Bacteria 16327
385 Ga0495619_0001707 3300053085 Bacteria 14549
386 Ga0495619_0029723 3300053085 Bacteria 3532
387 Ga0500643_001306 3300053087 Bacteria 14670
388 Ga0500646_0055016 3300053090 Bacteria 1157
389 Ga0500554_080115 3300053102 Bacteria 1074
390 Ga0500593_042997 3300053117 Bacteria 2017
391 Ga0500595_000260 3300053119 Bacteria 35035
392 Ga0500595_012016 3300053119 Bacteria 3360
393 Ga0500568_0000005 3300053139 Bacteria 614296
394 Ga0500568_0019395 3300053139 Bacteria 2956
395 Ga0500568_0029743 3300053139 Bacteria 2264
396 Ga0500573_0000012 3300053140 Bacteria 208486
397 Ga0500577_0049198 3300053142 Bacteria 1575
398 Ga0500604_0000124 3300053151 Bacteria 23474
399 Ga0500616_0011459 3300053153 Bacteria 5233
400 Ga0500616_0069753 3300053153 Bacteria 1796
401 Ga0500627_0012763 3300053158 Bacteria 3160
402 Ga0500627_0049999 3300053158 Bacteria 1820
403 Ga0500638_000558 3300053162 Bacteria 9441
404 Ga0500637_0012895 3300053178 Bacteria 4365
405 Ga0500587_002173 3300053739 Bacteria 2795
406 Ga0500661_006815 3300055283 Bacteria 2123
407 2600227345 2599185359 Bacteria 4772316
408 2643820470 2643221560 Bacteria 4801179
409 2643836289 2643221563 Bacteria 4726935
410 2644052766 2643221608 Bacteria 4724829
411 2738709415 2738541275 Bacteria 4830863
412 2738847840 2738541301 Bacteria 4834102
413 2738863569 2738541304 Bacteria 4833665
414 2739296087 2738543022 Bacteria 4835059
415 2739357765 2738543033 Bacteria 4833336
416 2819715874 2818991466 Bacteria 4748179
417 2852653901 2852653556 Bacteria 4050083
418 2852682702 2852680915 Bacteria 4100189
419 2879163360 2879163058 Bacteria 4223965
420 2919140178 2919138771 Bacteria 5281312
421 2928102553 2928100450 Bacteria 4837635
422 2928529918 2928526807 Bacteria 4760224
423 2928959361 2928959182 Bacteria 4725774
424 2928970664 2928968154 Bacteria 4633371
425 8001846926 8001845381 Bacteria 5804942
426 Ga0213876_10060041
427 JGI24739J22299_10047538
428 Ga0055534_1015648
429 Ga0055530_10000005
430 Ga0070658_10000001
431 Ga0070658_10007416
432 Ga0070677_10007729
433 Ga0070680_100000084
434 Ga0068868_100000752
435 Ga0070660_100000322
436 Ga0070660_100000862
437 Ga0070660_100165155
438 Ga0070689_100216221
439 Ga0070661_100061799
440 Ga0070669_100184829
441 Ga0070675_100010738
442 Ga0070671_100002907
443 Ga0070673_100178456
444 Ga0070688_100090440
445 Ga0070659_100000032
446 Ga0070659_100180661
447 Ga0070710_10057420
448 Ga0070681_10000001
449 Ga0070681_10203875
450 Ga0070679_100000577
451 Ga0070679_100006819
452 Ga0070684_100495247
453 Ga0068853_100000183
454 Ga0068853_100054057
455 Ga0070686_100000490
456 Ga0070665_100000443
457 Ga0070665_100000477
458 Ga0070665_100009398
459 Ga0070665_100144123
460 Ga0070665_100206787
461 Ga0070665_100273581
462 Ga0070665_100340933
463 Ga0068855_100081458
464 Ga0068854_100023901
465 Ga0068854_100063083
466 Ga0068856_100192641
467 Ga0068852_100363198
468 Ga0068863_100080147
469 Ga0068858_100263500
470 Ga0081540_1008698
471 Ga0081540_1016698
472 Ga0075365_10011698
473 Ga0075362_10093977
474 Ga0075367_10113182
475 Ga0075434_100151229
476 Ga0075435_100286947
477 Ga0105240_10272413
478 Ga0105240_10319941
479 Ga0105245_10356504
480 Ga0114129_10203220
481 Ga0114129_10615663
482 Ga0105243_10378491
483 Ga0105241_10201929
484 Ga0105248_10000005
485 Ga0105237_10029201
486 Ga0105239_10190992
487 Ga0105239_10336174
488 Ga0157369_10023927
489 Ga0157369_10105249
490 Ga0157369_10370857
491 Ga0157369_10535423
492 Ga0157380_10103744
493 Ga0206356_11086493
494 Ga0213872_10119343
495 Ga0213874_10053750
496 Ga0213876_10000332
497 Ga0213876_10049954
498 Ga0209148_1002869
499 Ga0209455_1016297
500 Ga0209675_1000245
501 Ga0209676_1003576
502 Ga0209676_1007169
503 Ga0209676_1042269
504 Ga0209025_1034619
505 Ga0209758_1000013
506 Ga0209758_1055121
507 Ga0209257_1000113
508 Ga0209257_1015227
509 Ga0207682_10008405
510 Ga0207692_10045895
511 Ga0207705_10000002
512 Ga0207705_10029768
513 Ga0207707_10000001
514 Ga0207707_10278959
515 Ga0207695_10030846
516 Ga0207695_10137621
517 Ga0207671_10054197
518 Ga0207693_10041897
519 Ga0207660_10003756
520 Ga0207657_10000601
521 Ga0207657_10028192
522 Ga0207657_10080109
523 Ga0207652_10000879
524 Ga0207652_10019823
525 Ga0207681_10192510
526 Ga0207650_10033872
527 Ga0207659_10377620
528 Ga0207664_10156366
529 Ga0207664_10531517
530 Ga0207644_10007442
531 Ga0207690_10000001
532 Ga0207690_10030308
533 Ga0207706_10176640
534 Ga0207670_10097191
535 Ga0207669_10122311
536 Ga0207691_10057569
537 Ga0207711_10000002
538 Ga0207689_10271080
539 Ga0207661_10284568
540 Ga0207667_10086557
541 Ga0207651_10112787
542 Ga0207640_10048981
543 Ga0207677_10004348
544 Ga0207703_10274698
545 Ga0207639_10000220
546 Ga0207639_10089891
547 Ga0207708_10392740
548 Ga0207702_10166764
549 Ga0207641_10017586
550 Ga0207674_10078392
551 Ga0207698_10673143
552 Ga0209813_10001732
553 Ga0268266_10000083
554 Ga0268266_10000459
555 Ga0268266_10001187
556 Ga0268266_10343331
557 Ga0268264_10041584
558 Ga0265334_10012457
559 Ga0265338_10000005
560 Ga0265338_10011364
561 Ga0265338_10073228
562 Ga0265338_10168640
563 Ga0265332_10047253
564 Ga0265332_10050728
565 Ga0265320_10009024
566 Ga0265325_10000005
567 Ga0265325_10035353
568 Ga0265325_10137479
569 Ga0265339_10005179
570 Ga0265331_10008312
571 Ga0265331_10025003
572 Ga0307408_100060621
573 Ga0265313_10008815
574 Ga0265313_10011930
575 Ga0265313_10015787
576 Ga0307508_10098941
577 Ga0265314_10021624
578 Ga0265314_10025347
579 Ga0265314_10151363
580 Ga0307405_10134236
581 Ga0307405_10207248
582 Ga0307413_10003276
583 Ga0307410_10225403
584 Ga0307406_10112523
585 Ga0307406_10200723
586 Ga0307406_10221839
587 Ga0307412_10000755
588 Ga0307412_10050039
589 Ga0307412_10094963
590 Ga0307412_10255729
591 Ga0307409_100419514
592 Ga0307416_100205935
593 Ga0307414_10001853
594 Ga0307414_10010139
595 Ga0307414_10016781
596 Ga0307414_10022063
597 Ga0307414_10042519
598 Ga0307415_100120909
599 Ga0307510_10150103
600 Ga0373944_0000663
601 Ga0373923_0014862
602 Ga0373923_0114556
603 Ga0373945_0045902
604 Ga0373954_0023519
605 Ga0373956_0009289
606 Ga0373956_0068858
607 Ga0373943_0000717
608 Ga0373943_0169793
609 Ga0373955_0004793
610 Ga0373955_0049973
611 Ga0373955_0058797
612 Ga0373955_0098999
613 Ga0373924_0047420
614 Ga0373935_0090320
615 Ga0373935_0136238
616 Ga0373933_0003096
617 Ga0373933_0021124
618 Ga0373933_0294669
619 Ga0373947_0001210
620 Ga0373947_0062054
621 Ga0373947_0169601
622 Ga0373937_0120796
623 Ga0373937_0214256
624 Ga0373925_0012311
625 Ga0373925_0074041
626 Ga0373925_0391571
627 Ga0395899_0115406
628 Ga0395899_0201008
629 Ga0395900_0179640
630 Ga0395900_0425708
631 Ga0395898_0067087
632 Ga0395898_0167961
633 Ga0395905_0125225
634 Ga0395905_0443752
635 Ga0436364_0973593
636 Ga0436365_0010969
637 Ga0436365_1453675
638 Ga0436365_1505188
639 Ga0436360_0118418
640 Ga0436363_0372048
641 Ga0466968_0051095
642 Ga0466957_0266784
643 Ga0466959_0123566
644 Ga0451576_0103373
645 Ga0451576_0130328
646 Ga0451576_0240272
647 Ga0466958_0031237
648 Ga0466958_0165932
649 Ga0466967_0219787
650 Ga0495592_0012028
651 Ga0495592_0033389
652 Ga0495603_0060015
653 Ga0495629_0002506
654 Ga0495651_0005603
655 Ga0495653_0065711
656 Ga0495653_0249839
657 Ga0495605_0055670
658 Ga0495639_0061953
659 Ga0495662_0001748
660 Ga0495662_0027901
661 Ga0495662_0107818
662 Ga0495664_0003702
663 Ga0495664_0102715
664 Ga0495664_0201552
665 Ga0495584_0046166
666 Ga0495585_0048038
667 Ga0495594_0259004
668 Ga0495608_0004975
669 Ga0495608_0292005
670 Ga0495616_0000017
671 Ga0495618_0006095
672 Ga0495618_0008522
673 Ga0495628_0060808
674 Ga0495628_0211544
675 Ga0495630_0163700
676 Ga0495630_0190354
677 Ga0495666_0059238
678 Ga0495666_0072211
679 Ga0495642_0098367
680 Ga0495652_0007492
681 Ga0495652_0044599
682 Ga0495652_0221026
683 Ga0495654_0089447
684 Ga0495665_0064362
685 Ga0495665_0124960
686 Ga0495640_0001002
687 Ga0495640_0021200
688 Ga0495640_0085117
689 Ga0495640_0134992
690 Ga0495587_0006136
691 Ga0495587_0023338
692 Ga0495645_0012008
693 Ga0495645_0044812
694 Ga0495622_0010255
695 Ga0495622_0070766
696 Ga0495667_0000595
697 Ga0495656_0003266
698 Ga0495656_0046612
699 Ga0495668_0000004
700 Ga0495634_0070632
701 Ga0495625_0014924
702 Ga0495635_0000375
703 Ga0495635_0009867
704 Ga0495657_0016147
705 Ga0495599_0007301
706 Ga0495599_0042044
707 Ga0495623_0000847
708 Ga0495623_0083593
709 Ga0495646_0025588
710 Ga0495646_0040684
711 Ga0495646_0101554
712 Ga0495647_0008990
713 Ga0495658_0010718
714 Ga0495613_0103602
715 Ga0495624_0003125
716 Ga0495624_0072841
717 Ga0495624_0169886
718 Ga0495671_0006427
719 Ga0495649_0024218
720 Ga0495600_0000264
721 Ga0495600_0222642
722 Ga0495581_0007765
723 Ga0495604_0000130
724 Ga0495674_0003109
725 Ga0495676_0016319
726 Ga0495676_0105629
727 Ga0495680_0006651
728 Ga0495680_0021485
729 Ga0495675_0105045
730 Ga0495684_0121321
731 Ga0495684_0280825
732 Ga0495593_0056018
733 Ga0495602_0000910
734 Ga0496100_0129266
735 Ga0496107_0148081
736 Ga0496107_0228254
737 Ga0496110_0452894
738 Ga0496112_0004430
739 Ga0496114_0058870
740 Ga0496115_0006959
741 Ga0496115_0247085
742 Ga0496117_0009044
743 Ga0496117_0166979
744 Ga0496119_0040304
745 Ga0496119_0066579
746 Ga0496120_0042076
747 Ga0496120_0064252
748 Ga0496121_0106372
749 Ga0496122_0000306
750 Ga0496123_0001592
751 Ga0496124_0004042
752 Ga0496124_0112082
753 Ga0496125_0131456
754 Ga0496126_0302121
755 Ga0496126_0517442
756 Ga0501032_0036007
757 Ga0501033_0156735
758 Ga0501033_0162665
759 Ga0501034_0101595
760 Ga0501034_0102424
761 Ga0501034_0171996
762 Ga0501034_0223173
763 Ga0501036_0052857
764 Ga0501036_0304442
765 Ga0501036_0413480
766 Ga0501037_0236144
767 Ga0501038_0049178
768 Ga0501038_0131080
769 Ga0501038_0206446
770 Ga0501039_0056777
771 Ga0501039_0274480
772 Ga0501043_0069682
773 Ga0501043_0189212
774 Ga0501046_0023011
775 Ga0501046_0121797
776 Ga0501047_0029027
777 Ga0501047_0180859
778 Ga0501047_0264199
779 Ga0501047_0407869
780 Ga0501047_0444294
781 Ga0501068_0043678
782 Ga0501069_0034249
783 Ga0501070_0078899
784 Ga0501071_0140465
785 Ga0501073_0079153
786 Ga0501080_0037772
787 Ga0501080_0151243
788 Ga0501035_0052796
789 Ga0501035_0196686
790 Ga0501044_0000398
791 Ga0501044_0002015
792 Ga0501044_0073055
793 Ga0501044_0214686
794 Ga0501045_0004946
795 nmdc:mga03683_49878_c1
796 nmdc:mga05p37_662093_c1
797 nmdc:mga08y16_386407_c1
798 nmdc:mga0n895_202561_c1
799 nmdc:mga0n895_43840_c1
800 nmdc:mga0rr50_120135_c1
801 nmdc:mga0a205_102201_c1
802 nmdc:mga0a205_190174_c1
803 Ga0495601_0008991
804 Ga0495601_0032115
805 Ga0495612_0000597
806 Ga0495612_0006632
807 Ga0495595_0003518
808 Ga0495595_0026891
809 Ga0495619_0001313
810 Ga0495619_0001707
811 Ga0495619_0029723
812 Ga0500643_001306
813 Ga0500646_0055016
814 Ga0500554_080115
815 Ga0500593_042997
816 Ga0500595_000260
817 Ga0500595_012016
818 Ga0500568_0000005
819 Ga0500568_0019395
820 Ga0500568_0029743
821 Ga0500573_0000012
822 Ga0500577_0049198
823 Ga0500604_0000124
824 Ga0500616_0011459
825 Ga0500616_0069753
826 Ga0500627_0012763
827 Ga0500627_0049999
828 Ga0500638_000558
829 Ga0500637_0012895
830 Ga0500587_002173
831 Ga0500661_006815
832 2600227345
833 2643820470
834 2643836289
835 2644052766
836 2738709415
837 2738847840
838 2738863569
839 2739296087
840 2739357765
841 2819715874
842 2852653901
843 2852682702
844 2879163360
845 2919140178
846 2928102553
847 2928529918
848 2928959361
849 2928970664
850 8001846926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

13

302

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8557 3 291
6foc-assembly1.cif.gz_G f1-atpase from mycobacterium smegmatis 0.8477 3 291
7tjt-assembly1.cif.gz_G yeast atp synthase f1 region state 1-3catalytic beta_tight open without exogenous atp 0.8452 2 289
6q45-assembly2.cif.gz_O f1-atpase from fusobacterium nucleatum 0.8417 2 291
6q45-assembly2.cif.gz_O f1-atpase from fusobacterium nucleatum 0.8391 2 291
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8645 75 197 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8627 28 248 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8521 78 175 3.40.1380.10
5dn6G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8503 28 248 3.40.1380.10
2xokG02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8443 28 249 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A4Q3BU51-F1-model_v4 ATP synthase F1 subunit gamma 0.8996 91 291 GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.8975 1 246 GO:0045261
GO:0046933
AF-A0A1D8UVG0-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.894 1 291 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A7X8K7C9-F1-model_v4 ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit) 0.891 1 286 GO:0005524
GO:0005886
GO:0042777
GO:0045261
GO:0046933
AF-A0A258XLR0-F1-model_v4 ATP synthase F1 subunit gamma 0.8907 1 246 GO:0045261
GO:0046933

Map