F441017

General Info

Members Datasets Scaffolds Average Seq Length
425 283 850 140

Family's Representative Sequence

Representative Sequence 3300042439|Ga0439464_0193636|Ga0439464_0193636_152_613
Length 153
Sequence LGAPNDNPPHRKEVAVKKIALLLLAGATLLSADVAAEETAAPVAKISKIFGRELPNVPGKSMRAVLVEYGPDAASPSHRHPPSAFIYATVLEGEIRSKVNDDPEHVYKAGETWTEVPGDHHQVSANASATKPARLLAIFVVDTTEQEILIPDK

Samples

Sample ID Description Type Environment
1 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
150 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
151 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
243 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
251 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
252 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
253 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
254 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
262 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
263 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
264 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
265 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
266 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
267 2643221688 Rhizobium sp. Root482 Isolate Unclassified
268 2738541300 Massilia sp. GV016 Isolate Unclassified
269 2738543018 Massilia sp. GV045 Isolate Unclassified
270 2738543030 Massilia sp. GV097 Isolate Unclassified
271 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
272 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
273 2844163670 Ensifer sp. 1H6 Isolate Unclassified
274 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
275 2909042592 Labrys sp. LIt4 Isolate Nodule
276 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
277 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
278 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
279 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
280 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
281 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
282 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
283 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.88
Metatranscriptomes 0.47
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 2.12
Rhizoplane 5.65
Rhizosphere 66.59
Stem 0
Stem Tuber 0
Unclassified 4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439464_0193636 3300042439 Bacteria 647
2 JGI25152J39213_1000015 3300002773 Bacteria 120605
3 JGI25150J39212_1000007 3300002774 Bacteria 253635
4 JGI25159J45721_1022239 3300002987 Bacteria 1176
5 JGI25151J46595_10000013 3300003187 Bacteria 253635
6 JGI25151J46595_10000222 3300003187 Bacteria 67214
7 JGI25165J46597_1007068 3300003214 Bacteria 1908
8 JGI25153J46596_10002333 3300003215 Bacteria 11005
9 rootL2_10022068 3300003322 Bacteria 32667
10 rootH1_10327512 3300003323 Bacteria 1015
11 JGI25160J50197_1015198 3300003354 Bacteria 2538
12 Ga0055524_1000731 3300003775 Bacteria 22525
13 Ga0055540_1013877 3300003792 Bacteria 2435
14 Ga0055531_10058634 3300003794 Bacteria 956
15 Ga0065165_1023144 3300005262 Bacteria 2113
16 Ga0065712_10107249 3300005290 Bacteria 1899
17 Ga0065712_10136743 3300005290 Bacteria 1490
18 Ga0065715_10238027 3300005293 Bacteria 1128
19 Ga0070683_100283328 3300005329 Bacteria 1576
20 Ga0070683_100438269 3300005329 Bacteria 1247
21 Ga0070683_100840355 3300005329 Unclassified 880
22 Ga0070690_100054297 3300005330 Bacteria 2565
23 Ga0070666_10634582 3300005335 Unclassified 781
24 Ga0070682_100544323 3300005337 Bacteria 907
25 Ga0068868_100210314 3300005338 Bacteria 1625
26 Ga0070660_100763933 3300005339 Unclassified 812
27 Ga0070675_100406240 3300005354 Bacteria 1216
28 Ga0070675_101477044 3300005354 Bacteria 627
29 Ga0070675_101903446 3300005354 Unclassified 549
30 Ga0070673_100009311 3300005364 Bacteria 6590
31 Ga0070673_100864100 3300005364 Bacteria 837
32 Ga0070688_100683092 3300005365 Bacteria 793
33 Ga0070667_100323351 3300005367 Bacteria 1392
34 Ga0070667_100362009 3300005367 Bacteria 1315
35 Ga0070667_100769577 3300005367 Bacteria 893
36 Ga0070709_10053274 3300005434 Bacteria 2547
37 Ga0070713_100687007 3300005436 Bacteria 977
38 Ga0070708_100676950 3300005445 Bacteria 971
39 Ga0070663_100147043 3300005455 Unclassified 1804
40 Ga0070678_100247318 3300005456 Bacteria 1494
41 Ga0070681_10022992 3300005458 Bacteria 6266
42 Ga0070681_11559200 3300005458 Bacteria 585
43 Ga0070679_100053082 3300005530 Bacteria 4035
44 Ga0070684_100260957 3300005535 Bacteria 1585
45 Ga0070697_101133317 3300005536 Bacteria 696
46 Ga0068853_101926666 3300005539 Bacteria 573
47 Ga0070686_100579235 3300005544 Unclassified 881
48 Ga0070695_101366826 3300005545 Bacteria 587
49 Ga0070665_100020754 3300005548 Bacteria 6602
50 Ga0070665_100060665 3300005548 Unclassified 3791
51 Ga0070665_100217796 3300005548 Bacteria 1910
52 Ga0070665_100470185 3300005548 Bacteria 1268
53 Ga0070704_101024191 3300005549 Bacteria 747
54 Ga0070664_100337342 3300005564 Bacteria 1368
55 Ga0068854_100974798 3300005578 Bacteria 749
56 Ga0068852_100107981 3300005616 Bacteria 2526
57 Ga0068858_100376943 3300005842 Bacteria 1361
58 Ga0081455_10021222 3300005937 Bacteria 6096
59 Ga0081455_10024145 3300005937 Bacteria 5639
60 Ga0081455_10024289 3300005937 Bacteria 5617
61 Ga0081540_1083620 3300005983 Bacteria 1427
62 Ga0081539_10000801 3300005985 Bacteria 61178
63 Ga0081539_10494859 3300005985 Bacteria 506
64 Ga0075365_10122866 3300006038 Bacteria 1792
65 Ga0075365_10299096 3300006038 Bacteria 1132
66 Ga0075368_10289108 3300006042 Bacteria 705
67 Ga0075363_100451150 3300006048 Bacteria 760
68 Ga0075363_100684868 3300006048 Bacteria 618
69 Ga0075364_10002776 3300006051 Bacteria 9838
70 Ga0075364_10112001 3300006051 Bacteria 1822
71 Ga0070716_100160891 3300006173 Bacteria 1454
72 Ga0070712_100062638 3300006175 Bacteria 2631
73 Ga0075367_10011109 3300006178 Bacteria 4750
74 Ga0075367_10035362 3300006178 Bacteria 2891
75 Ga0075366_10148976 3300006195 Bacteria 1417
76 Ga0097621_100133032 3300006237 Bacteria 2119
77 Ga0068871_100431948 3300006358 Bacteria 1178
78 Ga0075428_100403011 3300006844 Bacteria 1466
79 Ga0075431_100465984 3300006847 Bacteria 1258
80 Ga0075434_100183399 3300006871 Bacteria 2114
81 Ga0105245_11764339 3300009098 Bacteria 671
82 Ga0114129_11737450 3300009147 Bacteria 760
83 Ga0105242_10162327 3300009176 Bacteria 1957
84 Ga0105248_10059052 3300009177 Bacteria 4308
85 Ga0105248_10685444 3300009177 Bacteria 1156
86 Ga0105237_10003330 3300009545 Bacteria 19134
87 Ga0105239_10074515 3300010375 Bacteria 3732
88 Ga0105239_10100733 3300010375 Bacteria 3195
89 Ga0105239_10537484 3300010375 Bacteria 1331
90 Ga0105239_11303078 3300010375 Bacteria 838
91 Ga0105239_12438806 3300010375 Bacteria 609
92 Ga0157373_10003852 3300013100 Bacteria 11337
93 Ga0157370_10001402 3300013104 Bacteria 29902
94 Ga0157370_11062314 3300013104 Bacteria 732
95 Ga0157369_10015259 3300013105 Bacteria 8668
96 Ga0157369_10325599 3300013105 Bacteria 1597
97 Ga0171463_1002 3300013249 Bacteria 1274851
98 Ga0157374_10186967 3300013296 Bacteria 2025
99 Ga0157378_13286340 3300013297 Bacteria 502
100 Ga0157372_10049286 3300013307 Bacteria 4683
101 Ga0157375_10016687 3300013308 Bacteria 6605
102 Ga0157375_13069341 3300013308 Bacteria 557
103 Ga0163163_10007907 3300014325 Bacteria 9401
104 Ga0182008_10050790 3300014497 Bacteria 2058
105 Ga0157377_11489111 3300014745 Bacteria 537
106 Ga0157379_12061418 3300014968 Bacteria 565
107 Ga0182007_10012038 3300015262 Bacteria 3342
108 Ga0183363_1014 3300015690 Bacteria 78669
109 Ga0163161_10852093 3300017792 Bacteria 769
110 Ga0213872_10000242 3300021361 Bacteria 48194
111 Ga0209437_113018 3300025233 Bacteria 1198
112 Ga0207425_1000032 3300025245 Bacteria 253689
113 Ga0209677_100174 3300025253 Bacteria 55175
114 Ga0209129_1000056 3300025258 Bacteria 253689
115 Ga0209233_1000217 3300025261 Bacteria 106187
116 Ga0209673_1005311 3300025273 Bacteria 6526
117 Ga0209130_1001392 3300025284 Bacteria 16228
118 Ga0209025_1000090 3300025294 Bacteria 253689
119 Ga0209025_1000452 3300025294 Bacteria 80291
120 Ga0209025_1032575 3300025294 Bacteria 2431
121 Ga0209025_1162472 3300025294 Bacteria 600
122 Ga0209564_1075289 3300025295 Bacteria 682
123 Ga0209758_1000084 3300025297 Bacteria 256346
124 Ga0209758_1001728 3300025297 Bacteria 24333
125 Ga0209050_1002767 3300025298 Bacteria 14080
126 Ga0209256_1000073 3300025299 Bacteria 237553
127 Ga0207426_1000356 3300025302 Bacteria 83393
128 Ga0209257_1000574 3300025304 Bacteria 61789
129 Ga0209257_1001269 3300025304 Bacteria 30981
130 Ga0207697_10005185 3300025315 Bacteria 6082
131 Ga0207655_1100733 3300025728 Bacteria 995
132 Ga0207680_10091446 3300025903 Bacteria 1936
133 Ga0207705_10730683 3300025909 Unclassified 769
134 Ga0207707_10100757 3300025912 Unclassified 2524
135 Ga0207707_10545498 3300025912 Bacteria 985
136 Ga0207671_10000175 3300025914 Bacteria 98920
137 Ga0207693_10688147 3300025915 Bacteria 793
138 Ga0207660_10072197 3300025917 Bacteria 2513
139 Ga0207657_10538857 3300025919 Unclassified 913
140 Ga0207649_10014995 3300025920 Bacteria 4351
141 Ga0207659_10062781 3300025926 Bacteria 2682
142 Ga0207690_10779310 3300025932 Bacteria 789
143 Ga0207709_10489018 3300025935 Bacteria 958
144 Ga0207670_10709693 3300025936 Unclassified 833
145 Ga0207711_10025335 3300025941 Bacteria 4977
146 Ga0207651_10278651 3300025960 Bacteria 1381
147 Ga0207651_11209320 3300025960 Bacteria 678
148 Ga0207651_11475791 3300025960 Bacteria 612
149 Ga0207640_10138118 3300025981 Bacteria 1772
150 Ga0207677_10704421 3300026023 Bacteria 896
151 Ga0207677_11779047 3300026023 Bacteria 572
152 Ga0207703_10069325 3300026035 Bacteria 2908
153 Ga0207702_10057712 3300026078 Bacteria 3301
154 Ga0207702_10626927 3300026078 Bacteria 1056
155 Ga0207641_10248093 3300026088 Bacteria 1662
156 Ga0207683_10041453 3300026121 Bacteria 4020
157 Ga0207698_10007770 3300026142 Bacteria 6736
158 Ga0209813_10110880 3300027866 Bacteria 945
159 Ga0268266_10017233 3300028379 Bacteria 6169
160 Ga0268266_10300048 3300028379 Bacteria 1498
161 Ga0268264_10384304 3300028381 Bacteria 1345
162 Ga0265338_10000092 3300028800 Bacteria 168538
163 Ga0307511_10040334 3300030521 Bacteria 3968
164 Ga0265340_10221889 3300031247 Bacteria 847
165 Ga0307408_101678684 3300031548 Bacteria 605
166 Ga0307516_10006643 3300031730 Bacteria 13521
167 Ga0307411_10430241 3300032005 Bacteria 1099
168 Ga0307510_10016774 3300033180 Bacteria 8640
169 Ga0373936_0056585 3300035113 Bacteria 1594
170 Ga0373939_0077702 3300035114 Bacteria 1096
171 Ga0373945_0080824 3300035116 Bacteria 1245
172 Ga0373946_0336397 3300035171 Bacteria 752
173 Ga0373924_0091935 3300035410 Bacteria 1299
174 Ga0373935_0031342 3300035692 Bacteria 3299
175 Ga0373935_0145871 3300035692 Bacteria 1602
176 Ga0373927_0087278 3300035695 Bacteria 2025
177 Ga0373927_0518686 3300035695 Bacteria 788
178 Ga0373933_0116719 3300035724 Bacteria 1669
179 Ga0373947_0118772 3300035725 Bacteria 1678
180 Ga0373937_1442866 3300036401 Bacteria 636
181 Ga0373925_0060734 3300037068 Bacteria 2838
182 Ga0395900_0025226 3300037418 Bacteria 6086
183 Ga0395900_0330360 3300037418 Unclassified 1503
184 Ga0395900_0384050 3300037418 Bacteria 1372
185 Ga0395898_0287629 3300037466 Bacteria 1568
186 Ga0395898_0376735 3300037466 Bacteria 1353
187 Ga0395898_0790331 3300037466 Bacteria 890
188 Ga0395905_0014354 3300037471 Bacteria 7569
189 Ga0395905_0069349 3300037471 Bacteria 3302
190 Ga0395905_0099647 3300037471 Bacteria 2729
191 Ga0395905_0214703 3300037471 Bacteria 1802
192 Ga0395901_0095866 3300038443 Bacteria 3109
193 Ga0395901_1067498 3300038443 Bacteria 780
194 Ga0436361_0568983 3300039447 Bacteria 33450
195 Ga0436361_0614381 3300039447 Bacteria 648
196 Ga0436363_0064903 3300039450 Bacteria 1847
197 Ga0436363_0137525 3300039450 Bacteria 746
198 Ga0436362_0674988 3300039453 Bacteria 1584
199 Ga0439465_0080788 3300041413 Bacteria 1102
200 Ga0439465_0182193 3300041413 Bacteria 760
201 Ga0450890_078801 3300042127 Bacteria 535
202 Ga0450907_005876 3300042146 Bacteria 2060
203 Ga0450909_042915 3300042185 Bacteria 698
204 Ga0439464_0109203 3300042439 Bacteria 846
205 Ga0466967_1159397 3300045976 Bacteria 770
206 Ga0495603_0547556 3300046455 Bacteria 663
207 Ga0495590_0061831 3300046457 Bacteria 1311
208 Ga0495629_0012362 3300046459 Bacteria 6181
209 Ga0495629_0337948 3300046459 Bacteria 1028
210 Ga0495653_0618823 3300046463 Bacteria 664
211 Ga0495580_0073867 3300046472 Bacteria 2380
212 Ga0495582_0025724 3300046473 Bacteria 3224
213 Ga0495582_0590238 3300046473 Bacteria 643
214 Ga0495639_0081187 3300046475 Bacteria 1510
215 Ga0495662_0093625 3300046476 Bacteria 1467
216 Ga0495664_0035342 3300046477 Bacteria 2942
217 Ga0495585_0104636 3300046492 Bacteria 1510
218 Ga0495583_0012879 3300046506 Bacteria 4701
219 Ga0495583_0178046 3300046506 Bacteria 871
220 Ga0495610_0051114 3300046512 Bacteria 2013
221 Ga0495610_0230244 3300046512 Bacteria 744
222 Ga0495616_0082586 3300046513 Bacteria 1534
223 Ga0495618_0128332 3300046514 Bacteria 1623
224 Ga0495620_0024225 3300046515 Bacteria 2890
225 Ga0495630_0147777 3300046517 Bacteria 1788
226 Ga0495631_0350323 3300046518 Bacteria 628
227 Ga0495637_0127095 3300046520 Bacteria 976
228 Ga0495665_0025971 3300046531 Bacteria 3145
229 Ga0495665_0338164 3300046531 Bacteria 767
230 Ga0495668_0060886 3300046616 Bacteria 2082
231 Ga0495611_0047621 3300046648 Bacteria 1925
232 Ga0495611_0519024 3300046648 Bacteria 540
233 Ga0495625_0049539 3300046660 Bacteria 3019
234 Ga0495625_0050415 3300046660 Bacteria 2987
235 Ga0495625_0050719 3300046660 Bacteria 2977
236 Ga0495635_0048338 3300046663 Bacteria 2933
237 Ga0495635_0304298 3300046663 Bacteria 1069
238 Ga0495646_0171340 3300046680 Bacteria 1196
239 Ga0495647_0027557 3300046681 Bacteria 2088
240 Ga0495658_0004930 3300046683 Bacteria 6548
241 Ga0495613_0030275 3300046689 Bacteria 4021
242 Ga0495600_0090301 3300046809 Bacteria 1998
243 Ga0495660_0011141 3300046810 Bacteria 5222
244 Ga0495581_0271534 3300047315 Bacteria 991
245 Ga0495674_0017824 3300047319 Bacteria 6610
246 Ga0495674_0256507 3300047319 Bacteria 1438
247 Ga0495683_0048797 3300047323 Bacteria 2122
248 Ga0495687_002186 3300047443 Bacteria 16274
249 Ga0495681_0002809 3300047470 Bacteria 12313
250 Ga0495684_0038286 3300047471 Bacteria 3678
251 Ga0496100_0002867 3300048903 Bacteria 8835
252 Ga0496100_0186343 3300048903 Bacteria 1504
253 Ga0496100_0457666 3300048903 Bacteria 979
254 Ga0496101_0010036 3300048904 Bacteria 6239
255 Ga0496101_0127821 3300048904 Bacteria 1927
256 Ga0496102_0186934 3300048905 Bacteria 1952
257 Ga0496102_1103324 3300048905 Unclassified 713
258 Ga0496103_0034915 3300048906 Bacteria 3076
259 Ga0496104_0078541 3300048907 Bacteria 3145
260 Ga0496107_0167001 3300048910 Bacteria 1632
261 Ga0496109_0494960 3300048912 Bacteria 1154
262 Ga0496109_0594237 3300048912 Bacteria 1043
263 Ga0496110_0319557 3300048913 Bacteria 1414
264 Ga0496111_0000571 3300048914 Bacteria 19245
265 Ga0496111_0395063 3300048914 Bacteria 1022
266 Ga0496112_0082187 3300048915 Bacteria 3186
267 Ga0496112_0263437 3300048915 Bacteria 1673
268 Ga0496112_0303162 3300048915 Bacteria 1543
269 Ga0496112_0752623 3300048915 Bacteria 900
270 Ga0496113_0123498 3300048916 Bacteria 2026
271 Ga0496114_0098995 3300048917 Bacteria 2487
272 Ga0496115_0091924 3300048918 Unclassified 2480
273 Ga0496115_0333376 3300048918 Bacteria 1239
274 Ga0496116_0024516 3300048919 Bacteria 4458
275 Ga0496116_0025239 3300048919 Bacteria 4372
276 Ga0496116_0066445 3300048919 Bacteria 2307
277 Ga0496117_0004844 3300048920 Bacteria 14549
278 Ga0496117_0028743 3300048920 Bacteria 4300
279 Ga0496117_0030381 3300048920 Bacteria 4148
280 Ga0496117_0336458 3300048920 Bacteria 785
281 Ga0496118_0004743 3300048921 Bacteria 15912
282 Ga0496118_0005397 3300048921 Bacteria 14549
283 Ga0496118_0016998 3300048921 Bacteria 6643
284 Ga0496118_0177478 3300048921 Unclassified 1292
285 Ga0496119_0024286 3300048922 Bacteria 4268
286 Ga0496119_0231457 3300048922 Bacteria 940
287 Ga0496120_0026293 3300048923 Bacteria 3595
288 Ga0496121_0000033 3300048924 Bacteria 377542
289 Ga0496121_0000253 3300048924 Bacteria 113655
290 Ga0496122_0003038 3300048925 Bacteria 22709
291 Ga0496122_0038076 3300048925 Bacteria 3859
292 Ga0496122_0053648 3300048925 Bacteria 3037
293 Ga0496122_0091924 3300048925 Bacteria 2064
294 Ga0496123_0005153 3300048926 Bacteria 13303
295 Ga0496123_0014912 3300048926 Bacteria 6407
296 Ga0496123_0099465 3300048926 Bacteria 1697
297 Ga0496123_0130681 3300048926 Bacteria 1392
298 Ga0496124_0000184 3300048927 Bacteria 123894
299 Ga0496124_0008468 3300048927 Bacteria 10750
300 Ga0496124_0009394 3300048927 Bacteria 10075
301 Ga0496124_0019561 3300048927 Bacteria 6294
302 Ga0496124_0088213 3300048927 Bacteria 2536
303 Ga0496125_0000152 3300048928 Bacteria 153295
304 Ga0496125_0000388 3300048928 Bacteria 81963
305 Ga0496125_0036609 3300048928 Bacteria 4281
306 Ga0496125_0050986 3300048928 Bacteria 3418
307 Ga0496126_0068799 3300048929 Bacteria 3160
308 Ga0496126_0079312 3300048929 Bacteria 2906
309 Ga0496126_0289955 3300048929 Bacteria 1353
310 Ga0495682_0050423 3300049460 Bacteria 1515
311 Ga0501031_0381125 3300049568 Bacteria 912
312 Ga0501032_0535971 3300049569 Bacteria 747
313 Ga0501032_0572787 3300049569 Bacteria 719
314 Ga0501034_0178024 3300049571 Bacteria 2092
315 Ga0501036_0134972 3300049572 Bacteria 2083
316 Ga0501038_0158120 3300049574 Bacteria 1844
317 Ga0501038_0258612 3300049574 Bacteria 1377
318 Ga0501039_0170350 3300049575 Bacteria 1712
319 Ga0501039_0400045 3300049575 Bacteria 1079
320 Ga0501040_0197112 3300049576 Bacteria 1429
321 Ga0501040_0544619 3300049576 Bacteria 837
322 Ga0501041_0109165 3300049577 Bacteria 1716
323 Ga0501041_0155605 3300049577 Bacteria 1428
324 Ga0501041_0312037 3300049577 Bacteria 991
325 Ga0501042_0069653 3300049578 Bacteria 2516
326 Ga0501042_0089743 3300049578 Bacteria 2205
327 Ga0501043_0076546 3300049579 Bacteria 2629
328 Ga0501043_0552819 3300049579 Bacteria 855
329 Ga0501046_0106975 3300049580 Bacteria 2140
330 Ga0501046_0246911 3300049580 Bacteria 1315
331 Ga0501046_0442542 3300049580 Bacteria 935
332 Ga0501047_0174260 3300049581 Bacteria 2019
333 Ga0501048_0191722 3300049582 Bacteria 1448
334 Ga0501048_0412669 3300049582 Bacteria 966
335 Ga0501068_0114622 3300049584 Bacteria 1678
336 Ga0501068_0212511 3300049584 Bacteria 1229
337 Ga0501068_0531780 3300049584 Bacteria 764
338 Ga0501070_0044440 3300049586 Bacteria 3696
339 Ga0501070_1004169 3300049586 Bacteria 647
340 Ga0501071_0102750 3300049587 Bacteria 2108
341 Ga0501071_0338754 3300049587 Bacteria 1143
342 Ga0501071_0493053 3300049587 Bacteria 939
343 Ga0501072_0162498 3300049588 Bacteria 1781
344 Ga0501073_0008998 3300049589 Bacteria 7374
345 Ga0501074_0211908 3300049590 Bacteria 1380
346 Ga0501074_0299174 3300049590 Bacteria 1143
347 Ga0501075_0085898 3300049591 Bacteria 2384
348 Ga0501075_0110359 3300049591 Bacteria 2091
349 Ga0501075_0194474 3300049591 Bacteria 1547
350 Ga0501076_0093414 3300049592 Bacteria 2421
351 Ga0501076_0158164 3300049592 Bacteria 1845
352 Ga0501076_0295179 3300049592 Bacteria 1328
353 Ga0501076_0839114 3300049592 Bacteria 758
354 Ga0501077_0007355 3300049593 Bacteria 6790
355 Ga0501077_0031872 3300049593 Bacteria 3353
356 Ga0501077_0222839 3300049593 Bacteria 1199
357 Ga0501077_0384406 3300049593 Bacteria 897
358 Ga0501079_0093216 3300049741 Bacteria 2333
359 Ga0501079_0273900 3300049741 Bacteria 1319
360 Ga0501080_0039712 3300049742 Bacteria 4392
361 Ga0501080_0321446 3300049742 Bacteria 1401
362 Ga0501081_0011890 3300049743 Bacteria 5702
363 Ga0501081_0088846 3300049743 Bacteria 2171
364 Ga0501081_0151162 3300049743 Bacteria 1668
365 Ga0501083_0228210 3300049744 Bacteria 1213
366 Ga0501035_0367104 3300049822 Bacteria 1202
367 Ga0501044_0191358 3300049823 Bacteria 2008
368 Ga0501045_0126448 3300049824 Bacteria 1899
369 Ga0501045_0213463 3300049824 Unclassified 1437
370 Ga0501045_0350188 3300049824 Bacteria 1099
371 Ga0501045_0622590 3300049824 Bacteria 798
372 nmdc:mga06z11_220739_c1 3300050494 Bacteria 1108
373 nmdc:mga06z11_2794_c1 3300050494 Bacteria 6690
374 nmdc:mga04h51_40058_c1 3300050495 Bacteria 1525
375 nmdc:mga0qj67_1060602_c1 3300050509 Unclassified 634
376 nmdc:mga0a205_930737_c1 3300050515 Bacteria 716
377 Ga0495619_0059373 3300053085 Bacteria 2541
378 Ga0495619_0423120 3300053085 Bacteria 919
379 Ga0500643_000023 3300053087 Bacteria 273090
380 Ga0500583_0037249 3300053092 Bacteria 2184
381 Ga0500650_0497966 3300053098 Bacteria 518
382 Ga0500557_030806 3300053105 Bacteria 1623
383 Ga0500569_059166 3300053109 Bacteria 1178
384 Ga0500572_014021 3300053111 Bacteria 1995
385 Ga0500618_000130 3300053125 Bacteria 62583
386 Ga0500618_008429 3300053125 Bacteria 2875
387 Ga0500618_008780 3300053125 Bacteria 2794
388 Ga0500618_010274 3300053125 Bacteria 2517
389 Ga0500620_082899 3300053155 Bacteria 1112
390 Ga0500636_0001541 3300053177 Bacteria 12553
391 Ga0501084_0115439 3300054114 Bacteria 2257
392 Ga0501084_0174678 3300054114 Bacteria 1813
393 Ga0587073_0217655 3300059492 Bacteria 582
394 Ga0587085_076190 3300059506 Bacteria 666
395 Ga0501082_0007315 3300060353 Bacteria 9528
396 Ga0501082_0037258 3300060353 Bacteria 4191
397 Ga0501082_0123774 3300060353 Bacteria 2242
398 Ga0530510_0109687 3300061734 Bacteria 2021
399 Ga0530510_0191958 3300061734 Bacteria 1516
400 Ga0530510_0278383 3300061734 Bacteria 1249
401 Ga0530510_0850485 3300061734 Bacteria 697
402 2509076380 2508501114 Bacteria 7082538
403 2513595268 2513237088 Bacteria 6927906
404 2585404948 2582581867 Bacteria 7184437
405 2585538095 2585427528 Bacteria 6842387
406 2585836043 2585427593 Bacteria 7141551
407 2599336156 2599185156 Bacteria 5403036
408 2644492777 2643221688 Bacteria 5260751
409 2738845381 2738541300 Bacteria 6675882
410 2739276434 2738543018 Bacteria 6718814
411 2739345478 2738543030 Bacteria 6719714
412 2792638042 2791355094 Bacteria 7011481
413 2842927415 2842922631 Bacteria 5824079
414 2844168017 2844163670 Bacteria 7266046
415 2857352082 2857349434 Bacteria 7926032
416 2909046041 2909042592 Bacteria 6499737
417 2929143544 2929138655 Bacteria 5810547
418 2987639266 2987636660 Bacteria 8088555
419 3004204490 3004203850 Bacteria 7307914
420 650741427 650716007 Bacteria 5573770
421 650741921 650716007 Bacteria 5573770
422 8005307526 8005301065 Bacteria 6614431
423 8005683440 8005682033 Bacteria 6726518
424 8005688813 8005688590 Bacteria 6610080
425 8054465561 8054460903 Bacteria 4872905
426 Ga0439464_0193636
427 JGI25152J39213_1000015
428 JGI25150J39212_1000007
429 JGI25159J45721_1022239
430 JGI25151J46595_10000013
431 JGI25151J46595_10000222
432 JGI25165J46597_1007068
433 JGI25153J46596_10002333
434 rootL2_10022068
435 rootH1_10327512
436 JGI25160J50197_1015198
437 Ga0055524_1000731
438 Ga0055540_1013877
439 Ga0055531_10058634
440 Ga0065165_1023144
441 Ga0065712_10107249
442 Ga0065712_10136743
443 Ga0065715_10238027
444 Ga0070683_100283328
445 Ga0070683_100438269
446 Ga0070683_100840355
447 Ga0070690_100054297
448 Ga0070666_10634582
449 Ga0070682_100544323
450 Ga0068868_100210314
451 Ga0070660_100763933
452 Ga0070675_100406240
453 Ga0070675_101477044
454 Ga0070675_101903446
455 Ga0070673_100009311
456 Ga0070673_100864100
457 Ga0070688_100683092
458 Ga0070667_100323351
459 Ga0070667_100362009
460 Ga0070667_100769577
461 Ga0070709_10053274
462 Ga0070713_100687007
463 Ga0070708_100676950
464 Ga0070663_100147043
465 Ga0070678_100247318
466 Ga0070681_10022992
467 Ga0070681_11559200
468 Ga0070679_100053082
469 Ga0070684_100260957
470 Ga0070697_101133317
471 Ga0068853_101926666
472 Ga0070686_100579235
473 Ga0070695_101366826
474 Ga0070665_100020754
475 Ga0070665_100060665
476 Ga0070665_100217796
477 Ga0070665_100470185
478 Ga0070704_101024191
479 Ga0070664_100337342
480 Ga0068854_100974798
481 Ga0068852_100107981
482 Ga0068858_100376943
483 Ga0081455_10021222
484 Ga0081455_10024145
485 Ga0081455_10024289
486 Ga0081540_1083620
487 Ga0081539_10000801
488 Ga0081539_10494859
489 Ga0075365_10122866
490 Ga0075365_10299096
491 Ga0075368_10289108
492 Ga0075363_100451150
493 Ga0075363_100684868
494 Ga0075364_10002776
495 Ga0075364_10112001
496 Ga0070716_100160891
497 Ga0070712_100062638
498 Ga0075367_10011109
499 Ga0075367_10035362
500 Ga0075366_10148976
501 Ga0097621_100133032
502 Ga0068871_100431948
503 Ga0075428_100403011
504 Ga0075431_100465984
505 Ga0075434_100183399
506 Ga0105245_11764339
507 Ga0114129_11737450
508 Ga0105242_10162327
509 Ga0105248_10059052
510 Ga0105248_10685444
511 Ga0105237_10003330
512 Ga0105239_10074515
513 Ga0105239_10100733
514 Ga0105239_10537484
515 Ga0105239_11303078
516 Ga0105239_12438806
517 Ga0157373_10003852
518 Ga0157370_10001402
519 Ga0157370_11062314
520 Ga0157369_10015259
521 Ga0157369_10325599
522 Ga0171463_1002
523 Ga0157374_10186967
524 Ga0157378_13286340
525 Ga0157372_10049286
526 Ga0157375_10016687
527 Ga0157375_13069341
528 Ga0163163_10007907
529 Ga0182008_10050790
530 Ga0157377_11489111
531 Ga0157379_12061418
532 Ga0182007_10012038
533 Ga0183363_1014
534 Ga0163161_10852093
535 Ga0213872_10000242
536 Ga0209437_113018
537 Ga0207425_1000032
538 Ga0209677_100174
539 Ga0209129_1000056
540 Ga0209233_1000217
541 Ga0209673_1005311
542 Ga0209130_1001392
543 Ga0209025_1000090
544 Ga0209025_1000452
545 Ga0209025_1032575
546 Ga0209025_1162472
547 Ga0209564_1075289
548 Ga0209758_1000084
549 Ga0209758_1001728
550 Ga0209050_1002767
551 Ga0209256_1000073
552 Ga0207426_1000356
553 Ga0209257_1000574
554 Ga0209257_1001269
555 Ga0207697_10005185
556 Ga0207655_1100733
557 Ga0207680_10091446
558 Ga0207705_10730683
559 Ga0207707_10100757
560 Ga0207707_10545498
561 Ga0207671_10000175
562 Ga0207693_10688147
563 Ga0207660_10072197
564 Ga0207657_10538857
565 Ga0207649_10014995
566 Ga0207659_10062781
567 Ga0207690_10779310
568 Ga0207709_10489018
569 Ga0207670_10709693
570 Ga0207711_10025335
571 Ga0207651_10278651
572 Ga0207651_11209320
573 Ga0207651_11475791
574 Ga0207640_10138118
575 Ga0207677_10704421
576 Ga0207677_11779047
577 Ga0207703_10069325
578 Ga0207702_10057712
579 Ga0207702_10626927
580 Ga0207641_10248093
581 Ga0207683_10041453
582 Ga0207698_10007770
583 Ga0209813_10110880
584 Ga0268266_10017233
585 Ga0268266_10300048
586 Ga0268264_10384304
587 Ga0265338_10000092
588 Ga0307511_10040334
589 Ga0265340_10221889
590 Ga0307408_101678684
591 Ga0307516_10006643
592 Ga0307411_10430241
593 Ga0307510_10016774
594 Ga0373936_0056585
595 Ga0373939_0077702
596 Ga0373945_0080824
597 Ga0373946_0336397
598 Ga0373924_0091935
599 Ga0373935_0031342
600 Ga0373935_0145871
601 Ga0373927_0087278
602 Ga0373927_0518686
603 Ga0373933_0116719
604 Ga0373947_0118772
605 Ga0373937_1442866
606 Ga0373925_0060734
607 Ga0395900_0025226
608 Ga0395900_0330360
609 Ga0395900_0384050
610 Ga0395898_0287629
611 Ga0395898_0376735
612 Ga0395898_0790331
613 Ga0395905_0014354
614 Ga0395905_0069349
615 Ga0395905_0099647
616 Ga0395905_0214703
617 Ga0395901_0095866
618 Ga0395901_1067498
619 Ga0436361_0568983
620 Ga0436361_0614381
621 Ga0436363_0064903
622 Ga0436363_0137525
623 Ga0436362_0674988
624 Ga0439465_0080788
625 Ga0439465_0182193
626 Ga0450890_078801
627 Ga0450907_005876
628 Ga0450909_042915
629 Ga0439464_0109203
630 Ga0466967_1159397
631 Ga0495603_0547556
632 Ga0495590_0061831
633 Ga0495629_0012362
634 Ga0495629_0337948
635 Ga0495653_0618823
636 Ga0495580_0073867
637 Ga0495582_0025724
638 Ga0495582_0590238
639 Ga0495639_0081187
640 Ga0495662_0093625
641 Ga0495664_0035342
642 Ga0495585_0104636
643 Ga0495583_0012879
644 Ga0495583_0178046
645 Ga0495610_0051114
646 Ga0495610_0230244
647 Ga0495616_0082586
648 Ga0495618_0128332
649 Ga0495620_0024225
650 Ga0495630_0147777
651 Ga0495631_0350323
652 Ga0495637_0127095
653 Ga0495665_0025971
654 Ga0495665_0338164
655 Ga0495668_0060886
656 Ga0495611_0047621
657 Ga0495611_0519024
658 Ga0495625_0049539
659 Ga0495625_0050415
660 Ga0495625_0050719
661 Ga0495635_0048338
662 Ga0495635_0304298
663 Ga0495646_0171340
664 Ga0495647_0027557
665 Ga0495658_0004930
666 Ga0495613_0030275
667 Ga0495600_0090301
668 Ga0495660_0011141
669 Ga0495581_0271534
670 Ga0495674_0017824
671 Ga0495674_0256507
672 Ga0495683_0048797
673 Ga0495687_002186
674 Ga0495681_0002809
675 Ga0495684_0038286
676 Ga0496100_0002867
677 Ga0496100_0186343
678 Ga0496100_0457666
679 Ga0496101_0010036
680 Ga0496101_0127821
681 Ga0496102_0186934
682 Ga0496102_1103324
683 Ga0496103_0034915
684 Ga0496104_0078541
685 Ga0496107_0167001
686 Ga0496109_0494960
687 Ga0496109_0594237
688 Ga0496110_0319557
689 Ga0496111_0000571
690 Ga0496111_0395063
691 Ga0496112_0082187
692 Ga0496112_0263437
693 Ga0496112_0303162
694 Ga0496112_0752623
695 Ga0496113_0123498
696 Ga0496114_0098995
697 Ga0496115_0091924
698 Ga0496115_0333376
699 Ga0496116_0024516
700 Ga0496116_0025239
701 Ga0496116_0066445
702 Ga0496117_0004844
703 Ga0496117_0028743
704 Ga0496117_0030381
705 Ga0496117_0336458
706 Ga0496118_0004743
707 Ga0496118_0005397
708 Ga0496118_0016998
709 Ga0496118_0177478
710 Ga0496119_0024286
711 Ga0496119_0231457
712 Ga0496120_0026293
713 Ga0496121_0000033
714 Ga0496121_0000253
715 Ga0496122_0003038
716 Ga0496122_0038076
717 Ga0496122_0053648
718 Ga0496122_0091924
719 Ga0496123_0005153
720 Ga0496123_0014912
721 Ga0496123_0099465
722 Ga0496123_0130681
723 Ga0496124_0000184
724 Ga0496124_0008468
725 Ga0496124_0009394
726 Ga0496124_0019561
727 Ga0496124_0088213
728 Ga0496125_0000152
729 Ga0496125_0000388
730 Ga0496125_0036609
731 Ga0496125_0050986
732 Ga0496126_0068799
733 Ga0496126_0079312
734 Ga0496126_0289955
735 Ga0495682_0050423
736 Ga0501031_0381125
737 Ga0501032_0535971
738 Ga0501032_0572787
739 Ga0501034_0178024
740 Ga0501036_0134972
741 Ga0501038_0158120
742 Ga0501038_0258612
743 Ga0501039_0170350
744 Ga0501039_0400045
745 Ga0501040_0197112
746 Ga0501040_0544619
747 Ga0501041_0109165
748 Ga0501041_0155605
749 Ga0501041_0312037
750 Ga0501042_0069653
751 Ga0501042_0089743
752 Ga0501043_0076546
753 Ga0501043_0552819
754 Ga0501046_0106975
755 Ga0501046_0246911
756 Ga0501046_0442542
757 Ga0501047_0174260
758 Ga0501048_0191722
759 Ga0501048_0412669
760 Ga0501068_0114622
761 Ga0501068_0212511
762 Ga0501068_0531780
763 Ga0501070_0044440
764 Ga0501070_1004169
765 Ga0501071_0102750
766 Ga0501071_0338754
767 Ga0501071_0493053
768 Ga0501072_0162498
769 Ga0501073_0008998
770 Ga0501074_0211908
771 Ga0501074_0299174
772 Ga0501075_0085898
773 Ga0501075_0110359
774 Ga0501075_0194474
775 Ga0501076_0093414
776 Ga0501076_0158164
777 Ga0501076_0295179
778 Ga0501076_0839114
779 Ga0501077_0007355
780 Ga0501077_0031872
781 Ga0501077_0222839
782 Ga0501077_0384406
783 Ga0501079_0093216
784 Ga0501079_0273900
785 Ga0501080_0039712
786 Ga0501080_0321446
787 Ga0501081_0011890
788 Ga0501081_0088846
789 Ga0501081_0151162
790 Ga0501083_0228210
791 Ga0501035_0367104
792 Ga0501044_0191358
793 Ga0501045_0126448
794 Ga0501045_0213463
795 Ga0501045_0350188
796 Ga0501045_0622590
797 nmdc:mga06z11_220739_c1
798 nmdc:mga06z11_2794_c1
799 nmdc:mga04h51_40058_c1
800 nmdc:mga0qj67_1060602_c1
801 nmdc:mga0a205_930737_c1
802 Ga0495619_0059373
803 Ga0495619_0423120
804 Ga0500643_000023
805 Ga0500583_0037249
806 Ga0500650_0497966
807 Ga0500557_030806
808 Ga0500569_059166
809 Ga0500572_014021
810 Ga0500618_000130
811 Ga0500618_008429
812 Ga0500618_008780
813 Ga0500618_010274
814 Ga0500620_082899
815 Ga0500636_0001541
816 Ga0501084_0115439
817 Ga0501084_0174678
818 Ga0587073_0217655
819 Ga0587085_076190
820 Ga0501082_0007315
821 Ga0501082_0037258
822 Ga0501082_0123774
823 Ga0530510_0109687
824 Ga0530510_0191958
825 Ga0530510_0278383
826 Ga0530510_0850485
827 2509076380
828 2513595268
829 2585404948
830 2585538095
831 2585836043
832 2599336156
833 2644492777
834 2738845381
835 2739276434
836 2739345478
837 2792638042
838 2842927415
839 2844168017
840 2857352082
841 2909046041
842 2929143544
843 2987639266
844 3004204490
845 650741427
846 650741921
847 8005307526
848 8005683440
849 8005688813
850 8054465561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

65

139

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bu7-assembly1.cif.gz_B crystal structure and biochemical characterization of gdosp, a gentisate 1,2-dioxygenase from silicibacter pomeroyi 0.9078 48 129
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9071 48 127
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.8771 48 125
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.8759 48 128
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.8739 48 125
ID Description Score Start End Superfamily
5j7mB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9325 48 125 2.60.120.10
3bu7B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9078 48 129 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9035 48 127 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8755 30 126 2.60.120.10
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8754 48 125 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X6JDE2-F1-model_v4 Cupin domain-containing protein 0.9982 50 138
AF-A0A530L736-F1-model_v4 Cupin domain-containing protein 0.9944 35 139
AF-A0A117NLP6-F1-model_v4 Cupin type-2 domain-containing protein 0.9924 29 130
AF-A0A1H8NX39-F1-model_v4 deleted 0.9921 30 139
AF-A0A0G4PKW6-F1-model_v4 Alcohol dehydrogenase superfamily, zinc-containing 0.9914 30 130 GO:0016491

Map