F441018

General Info

Members Datasets Scaffolds Average Seq Length
425 174 425 149

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0045400|Ga0466969_0045400_700_1224
Length 174
Sequence VVFGSFRSHRNFGFVYNPHREIRLMKNPFTRRSLLALAAAVFTVASYAQWANPAEDVPAYHPAAPLKVSALPSIISGDKLTGENFRYAWQVHVYQQAAKVGNVIYQLPCNCRCDRALGHTSLRSCFETLHGTECSTCAKEGFYAYQQTKLGKTPAEIRAGIAKHDYESIDLEKQ

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 4.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 1.65
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10037976 3300003320 Bacteria 6915
2 rootL2_10101055 3300003322 Bacteria 7167
3 rootH1_10319483 3300003323 Unclassified 1406
4 Ga0070658_10023901 3300005327 Bacteria 4902
5 Ga0070658_10132880 3300005327 Bacteria 2075
6 Ga0070658_10239424 3300005327 Bacteria 1538
7 Ga0070676_10092380 3300005328 Bacteria 1856
8 Ga0070683_100030597 3300005329 Bacteria 4889
9 Ga0070683_100156164 3300005329 Bacteria 2164
10 Ga0070683_100169552 3300005329 Bacteria 2072
11 Ga0070683_100565385 3300005329 Bacteria 1087
12 Ga0070683_100567363 3300005329 Bacteria 1085
13 Ga0070666_10114295 3300005335 Bacteria 1869
14 Ga0070680_100050432 3300005336 Bacteria 3395
15 Ga0070680_100095147 3300005336 Bacteria 2469
16 Ga0070680_100492776 3300005336 Bacteria 1048
17 Ga0070682_100124905 3300005337 Bacteria 1733
18 Ga0070682_100328655 3300005337 Bacteria 1132
19 Ga0070682_100708424 3300005337 Unclassified 808
20 Ga0068868_100066967 3300005338 Bacteria 2857
21 Ga0068868_100454360 3300005338 Bacteria 1115
22 Ga0070660_100005537 3300005339 Bacteria 8748
23 Ga0070661_100075316 3300005344 Bacteria 2486
24 Ga0070661_100132273 3300005344 Bacteria 1875
25 Ga0070661_100510172 3300005344 Unclassified 963
26 Ga0070692_10477431 3300005345 Bacteria 803
27 Ga0070675_100051677 3300005354 Bacteria 3377
28 Ga0070671_100186383 3300005355 Bacteria 1758
29 Ga0070671_100249376 3300005355 Bacteria 1508
30 Ga0070688_100164606 3300005365 Bacteria 1526
31 Ga0070659_101342310 3300005366 Unclassified 635
32 Ga0070714_101276883 3300005435 Bacteria 717
33 Ga0070713_100121500 3300005436 Bacteria 2292
34 Ga0070713_100195389 3300005436 Bacteria 1825
35 Ga0070713_100652062 3300005436 Bacteria 1003
36 Ga0070711_100552037 3300005439 Bacteria 956
37 Ga0070663_100418431 3300005455 Bacteria 1099
38 Ga0070678_100498009 3300005456 Bacteria 1074
39 Ga0070662_100096546 3300005457 Bacteria 2229
40 Ga0070681_10017164 3300005458 Bacteria 7238
41 Ga0070681_10244500 3300005458 Bacteria 1707
42 Ga0070681_10817739 3300005458 Bacteria 849
43 Ga0068867_101188953 3300005459 Unclassified 700
44 Ga0070679_100003731 3300005530 Bacteria 13961
45 Ga0070679_100038949 3300005530 Bacteria 4726
46 Ga0070684_100029339 3300005535 Bacteria 4661
47 Ga0070684_100043095 3300005535 Bacteria 3896
48 Ga0070684_100097774 3300005535 Bacteria 2618
49 Ga0070684_100142982 3300005535 Bacteria 2164
50 Ga0068853_100000152 3300005539 Bacteria 47430
51 Ga0068853_100055600 3300005539 Unclassified 3412
52 Ga0068853_100131412 3300005539 Bacteria 2241
53 Ga0068853_100138588 3300005539 Bacteria 2183
54 Ga0070672_100187970 3300005543 Bacteria 1723
55 Ga0070665_100001717 3300005548 Bacteria 25110
56 Ga0070665_100124666 3300005548 Bacteria 2578
57 Ga0070665_100443418 3300005548 Bacteria 1307
58 Ga0070665_100478531 3300005548 Bacteria 1256
59 Ga0068855_100020423 3300005563 Bacteria 7943
60 Ga0068855_100181766 3300005563 Bacteria 2377
61 Ga0068855_100393998 3300005563 Bacteria 1519
62 Ga0068855_100870470 3300005563 Bacteria 953
63 Ga0068855_101617012 3300005563 Unclassified 663
64 Ga0070664_100217474 3300005564 Bacteria 1709
65 Ga0070664_100503154 3300005564 Bacteria 1117
66 Ga0068857_100000598 3300005577 Bacteria 26483
67 Ga0068857_100179525 3300005577 Bacteria 1926
68 Ga0068857_100270480 3300005577 Bacteria 1561
69 Ga0068857_101897101 3300005577 Unclassified 584
70 Ga0068854_100032789 3300005578 Bacteria 3616
71 Ga0068856_100012479 3300005614 Bacteria 8224
72 Ga0068856_100030885 3300005614 Bacteria 5239
73 Ga0068856_100103256 3300005614 Bacteria 2844
74 Ga0068856_100246000 3300005614 Bacteria 1804
75 Ga0068856_100477312 3300005614 Bacteria 1268
76 Ga0068856_101148732 3300005614 Bacteria 793
77 Ga0068852_100000028 3300005616 Bacteria 113383
78 Ga0068852_100000191 3300005616 Bacteria 41609
79 Ga0068852_100008441 3300005616 Bacteria 7592
80 Ga0068852_100014864 3300005616 Bacteria 6015
81 Ga0068852_100055357 3300005616 Bacteria 3423
82 Ga0068852_100132923 3300005616 Bacteria 2294
83 Ga0068852_100558684 3300005616 Bacteria 1145
84 Ga0068852_100707956 3300005616 Bacteria 1017
85 Ga0068852_101233129 3300005616 Unclassified 769
86 Ga0068859_100263825 3300005617 Bacteria 1814
87 Ga0068859_100415197 3300005617 Bacteria 1442
88 Ga0068864_100541031 3300005618 Bacteria 1125
89 Ga0068851_10007785 3300005834 Bacteria 4929
90 Ga0068851_10136928 3300005834 Bacteria 1328
91 Ga0068851_10471390 3300005834 Bacteria 749
92 Ga0068863_100241406 3300005841 Bacteria 1744
93 Ga0068860_100461492 3300005843 Bacteria 1264
94 Ga0070712_100941071 3300006175 Bacteria 746
95 Ga0097621_101072175 3300006237 Bacteria 755
96 Ga0068871_100096386 3300006358 Bacteria 2471
97 Ga0068871_100287683 3300006358 Bacteria 1439
98 Ga0068871_100303349 3300006358 Bacteria 1402
99 Ga0068865_100109117 3300006881 Bacteria 2038
100 Ga0097620_100263813 3300006931 Bacteria 1814
101 Ga0097620_100415189 3300006931 Bacteria 1442
102 Ga0105240_10000796 3300009093 Bacteria 57123
103 Ga0105240_10001270 3300009093 Bacteria 43667
104 Ga0105240_10002000 3300009093 Bacteria 33627
105 Ga0105240_10005920 3300009093 Bacteria 18110
106 Ga0105240_10011336 3300009093 Bacteria 12420
107 Ga0105240_10012076 3300009093 Bacteria 11967
108 Ga0105240_10037469 3300009093 Bacteria 6232
109 Ga0105240_10069273 3300009093 Unclassified 4367
110 Ga0105240_10303349 3300009093 Bacteria 1826
111 Ga0105240_10531488 3300009093 Bacteria 1304
112 Ga0105240_10981476 3300009093 Bacteria 904
113 Ga0105240_12098231 3300009093 Bacteria 587
114 Ga0105245_10025273 3300009098 Bacteria 5222
115 Ga0105245_10040010 3300009098 Bacteria 4174
116 Ga0105245_10169759 3300009098 Bacteria 2077
117 Ga0105247_10057596 3300009101 Bacteria 2403
118 Ga0105241_10001746 3300009174 Bacteria 16499
119 Ga0105241_10028210 3300009174 Bacteria 4182
120 Ga0105241_10081789 3300009174 Unclassified 2531
121 Ga0105241_10669193 3300009174 Unclassified 945
122 Ga0105242_10364944 3300009176 Bacteria 1337
123 Ga0105248_10000087 3300009177 Bacteria 104316
124 Ga0105248_10003746 3300009177 Bacteria 16866
125 Ga0105248_10419775 3300009177 Bacteria 1507
126 Ga0105248_11366691 3300009177 Bacteria 801
127 Ga0105248_12748111 3300009177 Unclassified 561
128 Ga0105237_10002782 3300009545 Bacteria 21249
129 Ga0105237_10121828 3300009545 Bacteria 2603
130 Ga0105237_10169634 3300009545 Bacteria 2182
131 Ga0105237_10195451 3300009545 Bacteria 2023
132 Ga0105237_10330670 3300009545 Bacteria 1528
133 Ga0105237_10748802 3300009545 Bacteria 983
134 Ga0105238_10001164 3300009551 Bacteria 26499
135 Ga0105238_10003709 3300009551 Bacteria 15198
136 Ga0105238_10017759 3300009551 Bacteria 7233
137 Ga0105238_10049639 3300009551 Bacteria 4225
138 Ga0105238_10303612 3300009551 Bacteria 1580
139 Ga0105249_10571329 3300009553 Bacteria 1183
140 Ga0105239_10028613 3300010375 Bacteria 6127
141 Ga0105239_10114528 3300010375 Bacteria 2991
142 Ga0105239_10145384 3300010375 Bacteria 2644
143 Ga0105239_10148844 3300010375 Bacteria 2612
144 Ga0105239_10183269 3300010375 Bacteria 2343
145 Ga0105239_10668379 3300010375 Bacteria 1187
146 Ga0105246_10117329 3300011119 Bacteria 1966
147 Ga0157373_10051569 3300013100 Bacteria 2930
148 Ga0157371_10008689 3300013102 Bacteria 8066
149 Ga0157371_10618847 3300013102 Bacteria 806
150 Ga0157370_10000003 3300013104 Bacteria 367417
151 Ga0157370_10001456 3300013104 Bacteria 29303
152 Ga0157370_11089645 3300013104 Bacteria 722
153 Ga0157369_10000535 3300013105 Bacteria 50270
154 Ga0157369_10000767 3300013105 Bacteria 41495
155 Ga0157369_10000949 3300013105 Bacteria 36829
156 Ga0157369_10005570 3300013105 Bacteria 14620
157 Ga0157369_10012347 3300013105 Bacteria 9698
158 Ga0157369_10039251 3300013105 Bacteria 5175
159 Ga0157369_10039984 3300013105 Bacteria 5122
160 Ga0157369_10098966 3300013105 Bacteria 3109
161 Ga0157369_10256995 3300013105 Bacteria 1822
162 Ga0157369_10283604 3300013105 Bacteria 1725
163 Ga0157369_10316282 3300013105 Bacteria 1623
164 Ga0157369_10510063 3300013105 Bacteria 1244
165 Ga0157369_10827012 3300013105 Bacteria 951
166 Ga0157374_10001030 3300013296 Bacteria 24197
167 Ga0157374_10001291 3300013296 Bacteria 21298
168 Ga0157374_10036718 3300013296 Bacteria 4491
169 Ga0157374_10071948 3300013296 Bacteria 3262
170 Ga0157374_10232522 3300013296 Bacteria 1811
171 Ga0157374_10404170 3300013296 Unclassified 1363
172 Ga0157374_10429809 3300013296 Unclassified 1320
173 Ga0157378_10013801 3300013297 Bacteria 7064
174 Ga0157378_10016443 3300013297 Bacteria 6479
175 Ga0157378_10353648 3300013297 Bacteria 1436
176 Ga0157378_11392997 3300013297 Bacteria 744
177 Ga0157378_11415706 3300013297 Unclassified 738
178 Ga0163162_10303064 3300013306 Bacteria 1730
179 Ga0163162_10579546 3300013306 Bacteria 1249
180 Ga0163162_11021872 3300013306 Bacteria 935
181 Ga0157372_10000489 3300013307 Bacteria 43671
182 Ga0157372_10005985 3300013307 Bacteria 12924
183 Ga0157372_10020294 3300013307 Bacteria 7167
184 Ga0157372_10174501 3300013307 Bacteria 2488
185 Ga0157372_10176376 3300013307 Bacteria 2474
186 Ga0157372_10201011 3300013307 Bacteria 2308
187 Ga0157372_10268191 3300013307 Bacteria 1983
188 Ga0157375_10043757 3300013308 Bacteria 4345
189 Ga0157375_10542101 3300013308 Bacteria 1326
190 Ga0157375_11392551 3300013308 Bacteria 826
191 Ga0163163_10396919 3300014325 Bacteria 1437
192 Ga0163163_10479883 3300014325 Bacteria 1304
193 Ga0157377_10408255 3300014745 Bacteria 927
194 Ga0157377_10702418 3300014745 Unclassified 734
195 Ga0157379_10052622 3300014968 Bacteria 3637
196 Ga0157379_10081449 3300014968 Bacteria 2900
197 Ga0157379_10124778 3300014968 Bacteria 2317
198 Ga0157376_10159141 3300014969 Bacteria 2045
199 Ga0157376_10169594 3300014969 Bacteria 1986
200 Ga0157376_12393385 3300014969 Bacteria 568
201 Ga0163161_10242462 3300017792 Bacteria 1402
202 Ga0197907_11094781 3300020069 Bacteria 1710
203 Ga0206349_1098283 3300020075 Bacteria 696
204 Ga0206349_1897553 3300020075 Bacteria 747
205 Ga0206355_1677729 3300020076 Bacteria 1843
206 Ga0206355_1697551 3300020076 Bacteria 1188
207 Ga0206351_10447372 3300020077 Bacteria 868
208 Ga0206352_10144497 3300020078 Bacteria 1826
209 Ga0206352_10447216 3300020078 Bacteria 660
210 Ga0206350_10253880 3300020080 Bacteria 1237
211 Ga0206350_11444285 3300020080 Bacteria 1039
212 Ga0206354_11102674 3300020081 Bacteria 1429
213 Ga0154015_1394471 3300020610 Bacteria 544
214 Ga0224712_10022447 3300022467 Bacteria 2176
215 Ga0224712_10084741 3300022467 Bacteria 1316
216 Ga0207697_10223163 3300025315 Bacteria 831
217 Ga0207656_10023692 3300025321 Bacteria 2475
218 Ga0207656_10038757 3300025321 Bacteria 2012
219 Ga0207656_10106991 3300025321 Bacteria 1288
220 Ga0207656_10275788 3300025321 Bacteria 828
221 Ga0207680_10512117 3300025903 Bacteria 855
222 Ga0207647_10014771 3300025904 Bacteria 5372
223 Ga0207647_10240993 3300025904 Bacteria 1038
224 Ga0207705_10021814 3300025909 Bacteria 4569
225 Ga0207705_10022391 3300025909 Bacteria 4505
226 Ga0207654_10000074 3300025911 Bacteria 66092
227 Ga0207654_10031037 3300025911 Bacteria 2940
228 Ga0207654_10116669 3300025911 Bacteria 1670
229 Ga0207654_10122276 3300025911 Bacteria 1636
230 Ga0207654_10790164 3300025911 Bacteria 685
231 Ga0207707_10060343 3300025912 Unclassified 3299
232 Ga0207707_10108809 3300025912 Bacteria 2423
233 Ga0207695_10000119 3300025913 Bacteria 235221
234 Ga0207695_10000598 3300025913 Bacteria 72240
235 Ga0207695_10001003 3300025913 Bacteria 49974
236 Ga0207695_10016154 3300025913 Bacteria 8753
237 Ga0207695_10025289 3300025913 Bacteria 6651
238 Ga0207695_10052308 3300025913 Bacteria 4280
239 Ga0207695_10253963 3300025913 Bacteria 1657
240 Ga0207695_10617798 3300025913 Bacteria 965
241 Ga0207671_10000238 3300025914 Bacteria 82806
242 Ga0207671_10130329 3300025914 Bacteria 1930
243 Ga0207671_10273823 3300025914 Bacteria 1330
244 Ga0207671_10395218 3300025914 Bacteria 1099
245 Ga0207671_10425885 3300025914 Bacteria 1056
246 Ga0207693_11022368 3300025915 Unclassified 630
247 Ga0207663_10717753 3300025916 Bacteria 792
248 Ga0207660_10005977 3300025917 Bacteria 7902
249 Ga0207657_10001966 3300025919 Bacteria 22196
250 Ga0207649_10090956 3300025920 Bacteria 1998
251 Ga0207649_10222775 3300025920 Unclassified 1344
252 Ga0207649_10237083 3300025920 Bacteria 1308
253 Ga0207649_10424511 3300025920 Unclassified 999
254 Ga0207652_10001863 3300025921 Bacteria 18323
255 Ga0207652_10077838 3300025921 Unclassified 2895
256 Ga0207694_10000089 3300025924 Bacteria 103520
257 Ga0207694_10000528 3300025924 Bacteria 34581
258 Ga0207694_10005214 3300025924 Bacteria 10037
259 Ga0207694_10065531 3300025924 Bacteria 2832
260 Ga0207694_10176221 3300025924 Bacteria 1733
261 Ga0207659_10062542 3300025926 Bacteria 2687
262 Ga0207687_10027735 3300025927 Bacteria 3801
263 Ga0207687_10030366 3300025927 Bacteria 3643
264 Ga0207700_10116504 3300025928 Unclassified 2159
265 Ga0207700_10307890 3300025928 Bacteria 1369
266 Ga0207664_10905105 3300025929 Bacteria 792
267 Ga0207664_11073080 3300025929 Bacteria 720
268 Ga0207644_10152854 3300025931 Bacteria 1787
269 Ga0207644_10249718 3300025931 Bacteria 1415
270 Ga0207690_10838238 3300025932 Bacteria 761
271 Ga0207706_10026672 3300025933 Bacteria 5171
272 Ga0207704_10077983 3300025938 Bacteria 2129
273 Ga0207691_10053962 3300025940 Bacteria 3667
274 Ga0207711_10000428 3300025941 Bacteria 44126
275 Ga0207711_10004164 3300025941 Bacteria 12383
276 Ga0207711_10483847 3300025941 Bacteria 1153
277 Ga0207661_10033007 3300025944 Bacteria 4016
278 Ga0207661_10043611 3300025944 Bacteria 3541
279 Ga0207661_10079934 3300025944 Bacteria 2696
280 Ga0207679_11484987 3300025945 Unclassified 622
281 Ga0207667_10001714 3300025949 Bacteria 27583
282 Ga0207667_10003452 3300025949 Bacteria 19512
283 Ga0207667_10005700 3300025949 Bacteria 15186
284 Ga0207667_10107998 3300025949 Bacteria 2871
285 Ga0207667_10191370 3300025949 Bacteria 2099
286 Ga0207667_10281282 3300025949 Bacteria 1700
287 Ga0207651_10728556 3300025960 Bacteria 875
288 Ga0207677_10074239 3300026023 Bacteria 2412
289 Ga0207677_10770085 3300026023 Bacteria 859
290 Ga0207703_11057405 3300026035 Bacteria 779
291 Ga0207639_10000103 3300026041 Bacteria 70103
292 Ga0207639_10006821 3300026041 Bacteria 7776
293 Ga0207639_10338817 3300026041 Bacteria 1340
294 Ga0207639_10356525 3300026041 Bacteria 1308
295 Ga0207639_10775771 3300026041 Bacteria 892
296 Ga0207678_10792705 3300026067 Bacteria 836
297 Ga0207702_10008971 3300026078 Bacteria 8425
298 Ga0207702_10084000 3300026078 Bacteria 2771
299 Ga0207702_10300798 3300026078 Bacteria 1522
300 Ga0207702_10874644 3300026078 Bacteria 890
301 Ga0207641_10202128 3300026088 Bacteria 1833
302 Ga0207676_10990614 3300026095 Bacteria 828
303 Ga0207674_10002326 3300026116 Bacteria 24058
304 Ga0207674_10164441 3300026116 Bacteria 2173
305 Ga0207674_10638799 3300026116 Bacteria 1028
306 Ga0207683_10002152 3300026121 Bacteria 17299
307 Ga0207698_10000271 3300026142 Bacteria 31417
308 Ga0207698_10003152 3300026142 Bacteria 9891
309 Ga0207698_10015700 3300026142 Bacteria 5081
310 Ga0207698_10137751 3300026142 Bacteria 2097
311 Ga0207698_10202626 3300026142 Bacteria 1778
312 Ga0207698_10334657 3300026142 Bacteria 1423
313 Ga0207698_10524810 3300026142 Bacteria 1156
314 Ga0207698_10816848 3300026142 Bacteria 935
315 Ga0268266_10220965 3300028379 Bacteria 1741
316 Ga0268266_10318333 3300028379 Bacteria 1455
317 Ga0268264_10066135 3300028381 Bacteria 3048
318 Ga0265334_10019607 3300028573 Bacteria 2780
319 Ga0265318_10118732 3300028577 Bacteria 972
320 Ga0265318_10157495 3300028577 Bacteria 833
321 Ga0265323_10057067 3300028653 Bacteria 1367
322 Ga0265336_10040955 3300028666 Bacteria 1417
323 Ga0265338_10003286 3300028800 Bacteria 22951
324 Ga0265338_10004003 3300028800 Bacteria 20248
325 Ga0265338_10029667 3300028800 Bacteria 5414
326 Ga0265338_10139012 3300028800 Bacteria 1905
327 Ga0265338_10224167 3300028800 Bacteria 1402
328 Ga0265338_10300396 3300028800 Bacteria 1167
329 Ga0265338_10371856 3300028800 Bacteria 1024
330 Ga0265338_10628479 3300028800 Bacteria 746
331 Ga0265338_10630412 3300028800 Bacteria 745
332 Ga0265760_10098442 3300031090 Bacteria 922
333 Ga0265330_10000087 3300031235 Bacteria 78938
334 Ga0265330_10000459 3300031235 Bacteria 27193
335 Ga0265330_10035615 3300031235 Bacteria 2220
336 Ga0265330_10051007 3300031235 Bacteria 1814
337 Ga0265330_10234358 3300031235 Bacteria 774
338 Ga0265328_10004391 3300031239 Bacteria 6130
339 Ga0265328_10073860 3300031239 Bacteria 1254
340 Ga0265328_10182160 3300031239 Bacteria 795
341 Ga0265328_10233050 3300031239 Bacteria 703
342 Ga0265320_10066105 3300031240 Bacteria 1714
343 Ga0265320_10133542 3300031240 Bacteria 1127
344 Ga0265325_10000500 3300031241 Bacteria 28355
345 Ga0265325_10033226 3300031241 Bacteria 2751
346 Ga0265325_10072541 3300031241 Bacteria 1725
347 Ga0265325_10119279 3300031241 Bacteria 1273
348 Ga0265325_10153656 3300031241 Bacteria 1087
349 Ga0265340_10013037 3300031247 Bacteria 4379
350 Ga0265340_10040005 3300031247 Bacteria 2310
351 Ga0265340_10084577 3300031247 Bacteria 1489
352 Ga0265339_10000026 3300031249 Bacteria 165764
353 Ga0265339_10001353 3300031249 Bacteria 18307
354 Ga0265339_10001525 3300031249 Bacteria 17097
355 Ga0265339_10011604 3300031249 Bacteria 5413
356 Ga0265339_10132742 3300031249 Bacteria 1272
357 Ga0265339_10146051 3300031249 Bacteria 1199
358 Ga0265331_10399937 3300031250 Bacteria 616
359 Ga0265316_10000694 3300031344 Bacteria 37497
360 Ga0265316_10000852 3300031344 Bacteria 33626
361 Ga0265316_10000924 3300031344 Bacteria 31955
362 Ga0265316_10036523 3300031344 Bacteria 3972
363 Ga0265316_10088586 3300031344 Bacteria 2363
364 Ga0265316_10105064 3300031344 Bacteria 2143
365 Ga0265316_10111101 3300031344 Bacteria 2075
366 Ga0265316_10133668 3300031344 Bacteria 1867
367 Ga0265316_10270362 3300031344 Bacteria 1244
368 Ga0265316_10433169 3300031344 Unclassified 944
369 Ga0265313_10003561 3300031595 Bacteria 12522
370 Ga0265313_10016209 3300031595 Bacteria 4295
371 Ga0265313_10055395 3300031595 Bacteria 1878
372 Ga0265313_10087660 3300031595 Bacteria 1402
373 Ga0265313_10197657 3300031595 Unclassified 838
374 Ga0265314_10000067 3300031711 Bacteria 156225
375 Ga0265314_10015363 3300031711 Bacteria 6078
376 Ga0265314_10098189 3300031711 Bacteria 1890
377 Ga0265342_10000067 3300031712 Bacteria 111040
378 Ga0265342_10000537 3300031712 Bacteria 40371
379 Ga0265342_10003998 3300031712 Bacteria 11800
380 Ga0265342_10015915 3300031712 Bacteria 4932
381 Ga0265342_10022733 3300031712 Bacteria 3982
382 Ga0265342_10050347 3300031712 Bacteria 2489
383 Ga0265342_10078837 3300031712 Bacteria 1906
384 Ga0265342_10096652 3300031712 Bacteria 1687
385 Ga0373955_0064368 3300035172 Bacteria 2033
386 Ga0373937_0005972 3300036401 Bacteria 10483
387 Ga0395900_0992774 3300037418 Unclassified 760
388 Ga0451577_0038209 3300042876 Bacteria 4318
389 Ga0466969_0045400 3300044656 Bacteria 2182
390 Ga0453683_0274142 3300044673 Bacteria 1077
391 Ga0466966_0233366 3300044684 Bacteria 1110
392 Ga0466961_0073182 3300044693 Bacteria 2173
393 Ga0466961_0190221 3300044693 Bacteria 1272
394 Ga0466961_0323060 3300044693 Unclassified 941
395 Ga0466963_0457188 3300044694 Bacteria 901
396 Ga0451576_0042504 3300045051 Bacteria 4797
397 Ga0451576_1211893 3300045051 Bacteria 788
398 Ga0466958_0407225 3300045836 Bacteria 878
399 Ga0466967_0027307 3300045976 Bacteria 4747
400 Ga0495651_0207099 3300046462 Viruses 1368
401 Ga0495606_0368710 3300046507 Bacteria 756
402 Ga0495628_0285688 3300046516 Bacteria 1224
403 Ga0495645_0223170 3300046543 Viruses 1266
404 Ga0495623_0198061 3300046679 Bacteria 1156
405 Ga0495649_0514380 3300046694 Bacteria 594
406 Ga0495600_0837327 3300046809 Unclassified 546
407 Ga0495581_0439698 3300047315 Bacteria 760
408 Ga0495636_0559070 3300047318 Bacteria 557
409 Ga0495674_0335799 3300047319 Bacteria 1229
410 Ga0495680_0332318 3300047322 Bacteria 1062
411 Ga0495684_0635012 3300047471 Bacteria 716
412 Ga0495686_0132064 3300047472 Bacteria 1479
413 Ga0496104_0043402 3300048907 Bacteria 4224
414 Ga0496105_0232785 3300048908 Bacteria 1497
415 Ga0496105_0475896 3300048908 Bacteria 983
416 Ga0496114_0002637 3300048917 Bacteria 13682
417 Ga0496114_0371329 3300048917 Bacteria 1266
418 Ga0496115_0094702 3300048918 Bacteria 2443
419 Ga0496115_0684792 3300048918 Bacteria 807
420 Ga0500595_010667 3300053119 Bacteria 3639
421 Ga0587073_0118830 3300059492 Unclassified 711
422 Ga0587088_073729 3300059508 Unclassified 717
423 Ga0587098_023606 3300059604 Bacteria 800
424 Ga0587122_022780 3300059628 Unclassified 693
425 Ga0587076_029475 3300059645 Bacteria 963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1211893 Ga0451576_1211893_162_551 120
2 3300013105 Ga0157369_10000535 Ga0157369_100005357 129
3 3300042876 Ga0451577_0038209 Ga0451577_0038209_1106_1534 133
4 3300044673 Ga0453683_0274142 Ga0453683_0274142_472_900 133
5 3300045051 Ga0451576_0042504 Ga0451576_0042504_2052_2480 133
6 3300047472 Ga0495686_0132064 Ga0495686_0132064_901_1344 135
7 3300044693 Ga0466961_0190221 Ga0466961_0190221_550_975 141
8 3300005548 Ga0070665_100001717 Ga0070665_10000171722 143
9 3300005548 Ga0070665_100443418 Ga0070665_1004434181 143
10 3300006358 Ga0068871_100303349 Ga0068871_1003033493 143
11 3300009177 Ga0105248_12748111 Ga0105248_127481111 143
12 3300013296 Ga0157374_10071948 Ga0157374_100719485 143
13 3300013296 Ga0157374_10232522 Ga0157374_102325222 143
14 3300013306 Ga0163162_10579546 Ga0163162_105795461 143
15 3300013308 Ga0157375_10542101 Ga0157375_105421011 143
16 3300014969 Ga0157376_12393385 Ga0157376_123933851 143
17 3300028379 Ga0268266_10220965 Ga0268266_102209653 143
18 3300005355 Ga0070671_100249376 Ga0070671_1002493761 144
19 3300005548 Ga0070665_100124666 Ga0070665_1001246664 144
20 3300005841 Ga0068863_100241406 Ga0068863_1002414062 144
21 3300009177 Ga0105248_11366691 Ga0105248_113666911 144
22 3300009545 Ga0105237_10748802 Ga0105237_107488021 144
23 3300010375 Ga0105239_10114528 Ga0105239_101145283 144
24 3300013105 Ga0157369_10510063 Ga0157369_105100631 144
25 3300013105 Ga0157369_10827012 Ga0157369_108270121 144
26 3300014325 Ga0163163_10479883 Ga0163163_104798832 144
27 3300025904 Ga0207647_10014771 Ga0207647_100147714 144
28 3300026142 Ga0207698_10816848 Ga0207698_108168481 144
29 3300028800 Ga0265338_10628479 Ga0265338_106284792 144
30 3300031239 Ga0265328_10182160 Ga0265328_101821601 144
31 3300031240 Ga0265320_10133542 Ga0265320_101335422 144
32 3300031250 Ga0265331_10399937 Ga0265331_103999372 144
33 3300031344 Ga0265316_10088586 Ga0265316_100885862 144
34 3300031712 Ga0265342_10096652 Ga0265342_100966522 144
35 3300046507 Ga0495606_0368710 Ga0495606_0368710_155_595 144
36 3300046694 Ga0495649_0514380 Ga0495649_0514380_60_500 144
37 3300047318 Ga0495636_0559070 Ga0495636_0559070_69_509 144
38 3300003322 rootL2_10101055 rootL2_101010554 148
39 3300003323 rootH1_10319483 rootH1_103194831 148
40 3300005327 Ga0070658_10132880 Ga0070658_101328803 148
41 3300005329 Ga0070683_100030597 Ga0070683_1000305973 148
42 3300005329 Ga0070683_100169552 Ga0070683_1001695524 148
43 3300005329 Ga0070683_100567363 Ga0070683_1005673632 148
44 3300005336 Ga0070680_100492776 Ga0070680_1004927763 148
45 3300005337 Ga0070682_100124905 Ga0070682_1001249051 148
46 3300005337 Ga0070682_100328655 Ga0070682_1003286552 148
47 3300005337 Ga0070682_100708424 Ga0070682_1007084242 148
48 3300005344 Ga0070661_100075316 Ga0070661_1000753163 148
49 3300005344 Ga0070661_100132273 Ga0070661_1001322734 148
50 3300005355 Ga0070671_100186383 Ga0070671_1001863834 148
51 3300005435 Ga0070714_101276883 Ga0070714_1012768832 148
52 3300005436 Ga0070713_100121500 Ga0070713_1001215001 148
53 3300005455 Ga0070663_100418431 Ga0070663_1004184312 148
54 3300005458 Ga0070681_10817739 Ga0070681_108177392 148
55 3300005535 Ga0070684_100043095 Ga0070684_1000430955 148
56 3300005535 Ga0070684_100097774 Ga0070684_1000977743 148
57 3300005535 Ga0070684_100142982 Ga0070684_1001429823 148
58 3300005539 Ga0068853_100000152 Ga0068853_1000001525 148
59 3300005539 Ga0068853_100055600 Ga0068853_1000556003 148
60 3300005539 Ga0068853_100138588 Ga0068853_1001385883 148
61 3300005563 Ga0068855_100181766 Ga0068855_1001817664 148
62 3300005563 Ga0068855_100870470 Ga0068855_1008704702 148
63 3300005563 Ga0068855_101617012 Ga0068855_1016170122 148
64 3300005564 Ga0070664_100217474 Ga0070664_1002174743 148
65 3300005577 Ga0068857_100000598 Ga0068857_10000059824 148
66 3300005577 Ga0068857_100179525 Ga0068857_1001795253 148
67 3300005577 Ga0068857_100270480 Ga0068857_1002704802 148
68 3300005578 Ga0068854_100032789 Ga0068854_1000327895 148
69 3300005614 Ga0068856_100030885 Ga0068856_1000308853 148
70 3300005614 Ga0068856_100103256 Ga0068856_1001032564 148
71 3300005614 Ga0068856_100246000 Ga0068856_1002460002 148
72 3300005614 Ga0068856_100477312 Ga0068856_1004773122 148
73 3300005614 Ga0068856_101148732 Ga0068856_1011487321 148
74 3300005616 Ga0068852_100000028 Ga0068852_10000002854 148
75 3300005616 Ga0068852_100000191 Ga0068852_10000019137 148
76 3300005616 Ga0068852_100055357 Ga0068852_1000553575 148
77 3300005616 Ga0068852_100558684 Ga0068852_1005586842 148
78 3300005616 Ga0068852_100707956 Ga0068852_1007079563 148
79 3300005616 Ga0068852_101233129 Ga0068852_1012331292 148
80 3300005617 Ga0068859_100415197 Ga0068859_1004151974 148
81 3300005834 Ga0068851_10136928 Ga0068851_101369282 148
82 3300006358 Ga0068871_100287683 Ga0068871_1002876831 148
83 3300006931 Ga0097620_100415189 Ga0097620_1004151894 148
84 3300009093 Ga0105240_10000796 Ga0105240_1000079648 148
85 3300009093 Ga0105240_10001270 Ga0105240_1000127037 148
86 3300009093 Ga0105240_10002000 Ga0105240_1000200027 148
87 3300009093 Ga0105240_10011336 Ga0105240_100113362 148
88 3300009093 Ga0105240_10012076 Ga0105240_100120762 148
89 3300009093 Ga0105240_10037469 Ga0105240_100374694 148
90 3300009098 Ga0105245_10040010 Ga0105245_100400105 148
91 3300009101 Ga0105247_10057596 Ga0105247_100575963 148
92 3300009174 Ga0105241_10001746 Ga0105241_100017462 148
93 3300009174 Ga0105241_10028210 Ga0105241_100282105 148
94 3300009174 Ga0105241_10081789 Ga0105241_100817893 148
95 3300009176 Ga0105242_10364944 Ga0105242_103649442 148
96 3300009177 Ga0105248_10003746 Ga0105248_1000374613 148
97 3300009545 Ga0105237_10002782 Ga0105237_1000278215 148
98 3300009545 Ga0105237_10121828 Ga0105237_101218284 148
99 3300009545 Ga0105237_10169634 Ga0105237_101696343 148
100 3300009545 Ga0105237_10330670 Ga0105237_103306701 148
101 3300009551 Ga0105238_10003709 Ga0105238_100037092 148
102 3300009551 Ga0105238_10017759 Ga0105238_100177596 148
103 3300009551 Ga0105238_10303612 Ga0105238_103036121 148
104 3300010375 Ga0105239_10145384 Ga0105239_101453844 148
105 3300010375 Ga0105239_10183269 Ga0105239_101832693 148
106 3300010375 Ga0105239_10668379 Ga0105239_106683792 148
107 3300013100 Ga0157373_10051569 Ga0157373_100515693 148
108 3300013104 Ga0157370_10000003 Ga0157370_1000000331 148
109 3300013105 Ga0157369_10000767 Ga0157369_1000076735 148
110 3300013105 Ga0157369_10000949 Ga0157369_1000094930 148
111 3300013105 Ga0157369_10005570 Ga0157369_100055702 148
112 3300013105 Ga0157369_10039984 Ga0157369_100399843 148
113 3300013105 Ga0157369_10098966 Ga0157369_100989664 148
114 3300013296 Ga0157374_10001030 Ga0157374_1000103018 148
115 3300013296 Ga0157374_10036718 Ga0157374_100367186 148
116 3300013296 Ga0157374_10404170 Ga0157374_104041701 148
117 3300013297 Ga0157378_10013801 Ga0157378_100138013 148
118 3300013297 Ga0157378_10353648 Ga0157378_103536482 148
119 3300013297 Ga0157378_11415706 Ga0157378_114157061 148
120 3300013307 Ga0157372_10000489 Ga0157372_100004892 148
121 3300013307 Ga0157372_10174501 Ga0157372_101745014 148
122 3300013307 Ga0157372_10176376 Ga0157372_101763762 148
123 3300013307 Ga0157372_10201011 Ga0157372_102010114 148
124 3300020075 Ga0206349_1098283 Ga0206349_10982831 148
125 3300020076 Ga0206355_1697551 Ga0206355_16975511 148
126 3300020078 Ga0206352_10447216 Ga0206352_104472162 148
127 3300020080 Ga0206350_10253880 Ga0206350_102538802 148
128 3300025321 Ga0207656_10106991 Ga0207656_101069912 148
129 3300025321 Ga0207656_10275788 Ga0207656_102757881 148
130 3300025909 Ga0207705_10021814 Ga0207705_100218144 148
131 3300025911 Ga0207654_10000074 Ga0207654_100000742 148
132 3300025911 Ga0207654_10031037 Ga0207654_100310372 148
133 3300025911 Ga0207654_10116669 Ga0207654_101166693 148
134 3300025913 Ga0207695_10000119 Ga0207695_1000011977 148
135 3300025913 Ga0207695_10000598 Ga0207695_1000059867 148
136 3300025913 Ga0207695_10001003 Ga0207695_1000100338 148
137 3300025913 Ga0207695_10025289 Ga0207695_100252892 148
138 3300025913 Ga0207695_10052308 Ga0207695_100523081 148
139 3300025913 Ga0207695_10253963 Ga0207695_102539632 148
140 3300025914 Ga0207671_10000238 Ga0207671_1000023859 148
141 3300025914 Ga0207671_10273823 Ga0207671_102738232 148
142 3300025914 Ga0207671_10395218 Ga0207671_103952182 148
143 3300025914 Ga0207671_10425885 Ga0207671_104258852 148
144 3300025920 Ga0207649_10090956 Ga0207649_100909562 148
145 3300025920 Ga0207649_10222775 Ga0207649_102227753 148
146 3300025920 Ga0207649_10237083 Ga0207649_102370831 148
147 3300025924 Ga0207694_10000089 Ga0207694_1000008934 148
148 3300025924 Ga0207694_10000528 Ga0207694_1000052813 148
149 3300025924 Ga0207694_10176221 Ga0207694_101762213 148
150 3300025927 Ga0207687_10030366 Ga0207687_100303664 148
151 3300025929 Ga0207664_11073080 Ga0207664_110730801 148
152 3300025931 Ga0207644_10152854 Ga0207644_101528543 148
153 3300025941 Ga0207711_10004164 Ga0207711_100041643 148
154 3300025944 Ga0207661_10033007 Ga0207661_100330075 148
155 3300025944 Ga0207661_10079934 Ga0207661_100799343 148
156 3300025945 Ga0207679_11484987 Ga0207679_114849871 148
157 3300025949 Ga0207667_10001714 Ga0207667_100017148 148
158 3300025949 Ga0207667_10005700 Ga0207667_1000570013 148
159 3300025949 Ga0207667_10281282 Ga0207667_102812821 148
160 3300026041 Ga0207639_10000103 Ga0207639_1000010330 148
161 3300026041 Ga0207639_10338817 Ga0207639_103388172 148
162 3300026041 Ga0207639_10775771 Ga0207639_107757711 148
163 3300026078 Ga0207702_10084000 Ga0207702_100840004 148
164 3300026078 Ga0207702_10300798 Ga0207702_103007981 148
165 3300026078 Ga0207702_10874644 Ga0207702_108746441 148
166 3300026116 Ga0207674_10002326 Ga0207674_1000232620 148
167 3300026116 Ga0207674_10164441 Ga0207674_101644411 148
168 3300026142 Ga0207698_10000271 Ga0207698_1000027133 148
169 3300026142 Ga0207698_10003152 Ga0207698_100031525 148
170 3300026142 Ga0207698_10137751 Ga0207698_101377512 148
171 3300026142 Ga0207698_10202626 Ga0207698_102026263 148
172 3300026142 Ga0207698_10524810 Ga0207698_105248102 148
173 3300028379 Ga0268266_10318333 Ga0268266_103183331 148
174 3300037418 Ga0395900_0992774 Ga0395900_0992774_214_660 148
175 3300044694 Ga0466963_0457188 Ga0466963_0457188_152_598 148
176 3300045976 Ga0466967_0027307 Ga0466967_0027307_697_1143 148
177 3300059492 Ga0587073_0118830 Ga0587073_0118830_187_633 148
178 3300059508 Ga0587088_073729 Ga0587088_073729_87_533 148
179 3300059604 Ga0587098_023606 Ga0587098_023606_34_480 148
180 3300059628 Ga0587122_022780 Ga0587122_022780_63_509 148
181 3300059645 Ga0587076_029475 Ga0587076_029475_204_650 148
182 3300005328 Ga0070676_10092380 Ga0070676_100923803 149
183 3300005335 Ga0070666_10114295 Ga0070666_101142951 149
184 3300005338 Ga0068868_100066967 Ga0068868_1000669672 149
185 3300005338 Ga0068868_100454360 Ga0068868_1004543601 149
186 3300005354 Ga0070675_100051677 Ga0070675_1000516772 149
187 3300005365 Ga0070688_100164606 Ga0070688_1001646061 149
188 3300005436 Ga0070713_100652062 Ga0070713_1006520621 149
189 3300005456 Ga0070678_100498009 Ga0070678_1004980091 149
190 3300005457 Ga0070662_100096546 Ga0070662_1000965461 149
191 3300005459 Ga0068867_101188953 Ga0068867_1011889531 149
192 3300005543 Ga0070672_100187970 Ga0070672_1001879702 149
193 3300005548 Ga0070665_100478531 Ga0070665_1004785312 149
194 3300005563 Ga0068855_100393998 Ga0068855_1003939981 149
195 3300005564 Ga0070664_100503154 Ga0070664_1005031541 149
196 3300005616 Ga0068852_100008441 Ga0068852_1000084416 149
197 3300005616 Ga0068852_100132923 Ga0068852_1001329234 149
198 3300005617 Ga0068859_100263825 Ga0068859_1002638253 149
199 3300005618 Ga0068864_100541031 Ga0068864_1005410312 149
200 3300005834 Ga0068851_10007785 Ga0068851_100077853 149
201 3300005834 Ga0068851_10471390 Ga0068851_104713902 149
202 3300005843 Ga0068860_100461492 Ga0068860_1004614921 149
203 3300006237 Ga0097621_101072175 Ga0097621_1010721751 149
204 3300006358 Ga0068871_100096386 Ga0068871_1000963861 149
205 3300006881 Ga0068865_100109117 Ga0068865_1001091172 149
206 3300006931 Ga0097620_100263813 Ga0097620_1002638132 149
207 3300009093 Ga0105240_10069273 Ga0105240_100692734 149
208 3300009093 Ga0105240_10981476 Ga0105240_109814761 149
209 3300009098 Ga0105245_10025273 Ga0105245_100252732 149
210 3300009098 Ga0105245_10169759 Ga0105245_101697593 149
211 3300009174 Ga0105241_10669193 Ga0105241_106691932 149
212 3300009551 Ga0105238_10049639 Ga0105238_100496393 149
213 3300009553 Ga0105249_10571329 Ga0105249_105713291 149
214 3300010375 Ga0105239_10028613 Ga0105239_100286135 149
215 3300010375 Ga0105239_10148844 Ga0105239_101488444 149
216 3300011119 Ga0105246_10117329 Ga0105246_101173292 149
217 3300013102 Ga0157371_10618847 Ga0157371_106188471 149
218 3300013104 Ga0157370_11089645 Ga0157370_110896451 149
219 3300013105 Ga0157369_10039251 Ga0157369_100392514 149
220 3300013105 Ga0157369_10256995 Ga0157369_102569953 149
221 3300013105 Ga0157369_10316282 Ga0157369_103162821 149
222 3300013296 Ga0157374_10429809 Ga0157374_104298092 149
223 3300013297 Ga0157378_10016443 Ga0157378_100164433 149
224 3300013297 Ga0157378_11392997 Ga0157378_113929971 149
225 3300013306 Ga0163162_11021872 Ga0163162_110218721 149
226 3300013307 Ga0157372_10020294 Ga0157372_100202942 149
227 3300013307 Ga0157372_10268191 Ga0157372_102681911 149
228 3300013308 Ga0157375_10043757 Ga0157375_100437575 149
229 3300013308 Ga0157375_11392551 Ga0157375_113925512 149
230 3300014325 Ga0163163_10396919 Ga0163163_103969191 149
231 3300014745 Ga0157377_10408255 Ga0157377_104082551 149
232 3300014745 Ga0157377_10702418 Ga0157377_107024181 149
233 3300014968 Ga0157379_10124778 Ga0157379_101247784 149
234 3300014969 Ga0157376_10159141 Ga0157376_101591412 149
235 3300014969 Ga0157376_10169594 Ga0157376_101695942 149
236 3300017792 Ga0163161_10242462 Ga0163161_102424621 149
237 3300020078 Ga0206352_10144497 Ga0206352_101444972 149
238 3300025315 Ga0207697_10223163 Ga0207697_102231631 149
239 3300025321 Ga0207656_10023692 Ga0207656_100236922 149
240 3300025321 Ga0207656_10038757 Ga0207656_100387572 149
241 3300025903 Ga0207680_10512117 Ga0207680_105121171 149
242 3300025904 Ga0207647_10240993 Ga0207647_102409932 149
243 3300025911 Ga0207654_10122276 Ga0207654_101222763 149
244 3300025911 Ga0207654_10790164 Ga0207654_107901641 149
245 3300025914 Ga0207671_10130329 Ga0207671_101303293 149
246 3300025920 Ga0207649_10424511 Ga0207649_104245111 149
247 3300025924 Ga0207694_10065531 Ga0207694_100655313 149
248 3300025926 Ga0207659_10062542 Ga0207659_100625423 149
249 3300025927 Ga0207687_10027735 Ga0207687_100277353 149
250 3300025928 Ga0207700_10116504 Ga0207700_101165041 149
251 3300025931 Ga0207644_10249718 Ga0207644_102497182 149
252 3300025932 Ga0207690_10838238 Ga0207690_108382381 149
253 3300025933 Ga0207706_10026672 Ga0207706_100266722 149
254 3300025938 Ga0207704_10077983 Ga0207704_100779832 149
255 3300025940 Ga0207691_10053962 Ga0207691_100539621 149
256 3300025949 Ga0207667_10191370 Ga0207667_101913701 149
257 3300025960 Ga0207651_10728556 Ga0207651_107285562 149
258 3300026023 Ga0207677_10074239 Ga0207677_100742394 149
259 3300026023 Ga0207677_10770085 Ga0207677_107700851 149
260 3300026035 Ga0207703_11057405 Ga0207703_110574051 149
261 3300026041 Ga0207639_10006821 Ga0207639_100068216 149
262 3300026041 Ga0207639_10356525 Ga0207639_103565251 149
263 3300026067 Ga0207678_10792705 Ga0207678_107927051 149
264 3300026088 Ga0207641_10202128 Ga0207641_102021283 149
265 3300026095 Ga0207676_10990614 Ga0207676_109906142 149
266 3300026121 Ga0207683_10002152 Ga0207683_1000215211 149
267 3300026142 Ga0207698_10015700 Ga0207698_100157003 149
268 3300026142 Ga0207698_10334657 Ga0207698_103346571 149
269 3300028381 Ga0268264_10066135 Ga0268264_100661354 149
270 3300028800 Ga0265338_10371856 Ga0265338_103718561 149
271 3300031249 Ga0265339_10000026 Ga0265339_1000002638 149
272 3300031711 Ga0265314_10098189 Ga0265314_100981893 149
273 3300031712 Ga0265342_10022733 Ga0265342_100227331 149
274 3300046462 Ga0495651_0207099 Ga0495651_0207099_891_1340 149
275 3300046516 Ga0495628_0285688 Ga0495628_0285688_664_1113 149
276 3300046543 Ga0495645_0223170 Ga0495645_0223170_13_462 149
277 3300046679 Ga0495623_0198061 Ga0495623_0198061_604_1053 149
278 3300047322 Ga0495680_0332318 Ga0495680_0332318_252_701 149
279 3300048908 Ga0496105_0232785 Ga0496105_0232785_571_1020 149
280 3300048917 Ga0496114_0002637 Ga0496114_0002637_2417_2866 149
281 3300048918 Ga0496115_0094702 Ga0496115_0094702_1264_1713 149
282 3300048918 Ga0496115_0684792 Ga0496115_0684792_215_664 149
283 3300003320 rootH2_10037976 rootH2_100379765 150
284 3300005327 Ga0070658_10023901 Ga0070658_100239011 150
285 3300005327 Ga0070658_10239424 Ga0070658_102394242 150
286 3300005329 Ga0070683_100156164 Ga0070683_1001561643 150
287 3300005329 Ga0070683_100565385 Ga0070683_1005653851 150
288 3300005336 Ga0070680_100050432 Ga0070680_1000504324 150
289 3300005336 Ga0070680_100095147 Ga0070680_1000951472 150
290 3300005339 Ga0070660_100005537 Ga0070660_1000055378 150
291 3300005344 Ga0070661_100510172 Ga0070661_1005101722 150
292 3300005345 Ga0070692_10477431 Ga0070692_104774311 150
293 3300005366 Ga0070659_101342310 Ga0070659_1013423101 150
294 3300005436 Ga0070713_100195389 Ga0070713_1001953893 150
295 3300005439 Ga0070711_100552037 Ga0070711_1005520371 150
296 3300005458 Ga0070681_10017164 Ga0070681_100171641 150
297 3300005458 Ga0070681_10244500 Ga0070681_102445003 150
298 3300005530 Ga0070679_100003731 Ga0070679_10000373110 150
299 3300005530 Ga0070679_100038949 Ga0070679_1000389496 150
300 3300005535 Ga0070684_100029339 Ga0070684_1000293396 150
301 3300005539 Ga0068853_100131412 Ga0068853_1001314124 150
302 3300005563 Ga0068855_100020423 Ga0068855_1000204233 150
303 3300005577 Ga0068857_101897101 Ga0068857_1018971011 150
304 3300005614 Ga0068856_100012479 Ga0068856_1000124791 150
305 3300005616 Ga0068852_100014864 Ga0068852_1000148641 150
306 3300006175 Ga0070712_100941071 Ga0070712_1009410711 150
307 3300009093 Ga0105240_10005920 Ga0105240_100059201 150
308 3300009093 Ga0105240_10303349 Ga0105240_103033491 150
309 3300009093 Ga0105240_10531488 Ga0105240_105314883 150
310 3300009093 Ga0105240_12098231 Ga0105240_120982311 150
311 3300009177 Ga0105248_10000087 Ga0105248_1000008726 150
312 3300009177 Ga0105248_10419775 Ga0105248_104197751 150
313 3300009545 Ga0105237_10195451 Ga0105237_101954513 150
314 3300009551 Ga0105238_10001164 Ga0105238_1000116412 150
315 3300013102 Ga0157371_10008689 Ga0157371_100086896 150
316 3300013104 Ga0157370_10001456 Ga0157370_1000145615 150
317 3300013105 Ga0157369_10012347 Ga0157369_100123477 150
318 3300013105 Ga0157369_10283604 Ga0157369_102836042 150
319 3300013296 Ga0157374_10001291 Ga0157374_1000129113 150
320 3300013306 Ga0163162_10303064 Ga0163162_103030641 150
321 3300013307 Ga0157372_10005985 Ga0157372_1000598510 150
322 3300014968 Ga0157379_10052622 Ga0157379_100526222 150
323 3300014968 Ga0157379_10081449 Ga0157379_100814494 150
324 3300020069 Ga0197907_11094781 Ga0197907_110947811 150
325 3300020075 Ga0206349_1897553 Ga0206349_18975531 150
326 3300020076 Ga0206355_1677729 Ga0206355_16777291 150
327 3300020077 Ga0206351_10447372 Ga0206351_104473721 150
328 3300020080 Ga0206350_11444285 Ga0206350_114442851 150
329 3300020081 Ga0206354_11102674 Ga0206354_111026743 150
330 3300020610 Ga0154015_1394471 Ga0154015_13944711 150
331 3300022467 Ga0224712_10022447 Ga0224712_100224473 150
332 3300022467 Ga0224712_10084741 Ga0224712_100847411 150
333 3300025909 Ga0207705_10022391 Ga0207705_100223911 150
334 3300025912 Ga0207707_10060343 Ga0207707_100603431 150
335 3300025912 Ga0207707_10108809 Ga0207707_101088094 150
336 3300025913 Ga0207695_10016154 Ga0207695_100161543 150
337 3300025913 Ga0207695_10617798 Ga0207695_106177981 150
338 3300025915 Ga0207693_11022368 Ga0207693_110223681 150
339 3300025916 Ga0207663_10717753 Ga0207663_107177531 150
340 3300025917 Ga0207660_10005977 Ga0207660_1000597711 150
341 3300025919 Ga0207657_10001966 Ga0207657_100019669 150
342 3300025921 Ga0207652_10001863 Ga0207652_1000186310 150
343 3300025921 Ga0207652_10077838 Ga0207652_100778384 150
344 3300025924 Ga0207694_10005214 Ga0207694_100052146 150
345 3300025928 Ga0207700_10307890 Ga0207700_103078901 150
346 3300025929 Ga0207664_10905105 Ga0207664_109051051 150
347 3300025941 Ga0207711_10000428 Ga0207711_1000042853 150
348 3300025941 Ga0207711_10483847 Ga0207711_104838471 150
349 3300025944 Ga0207661_10043611 Ga0207661_100436112 150
350 3300025949 Ga0207667_10003452 Ga0207667_1000345210 150
351 3300025949 Ga0207667_10107998 Ga0207667_101079984 150
352 3300026078 Ga0207702_10008971 Ga0207702_1000897110 150
353 3300026116 Ga0207674_10638799 Ga0207674_106387992 150
354 3300028573 Ga0265334_10019607 Ga0265334_100196073 150
355 3300028577 Ga0265318_10118732 Ga0265318_101187321 150
356 3300028577 Ga0265318_10157495 Ga0265318_101574951 150
357 3300028653 Ga0265323_10057067 Ga0265323_100570671 150
358 3300028666 Ga0265336_10040955 Ga0265336_100409552 150
359 3300028800 Ga0265338_10003286 Ga0265338_1000328612 150
360 3300028800 Ga0265338_10004003 Ga0265338_1000400315 150
361 3300028800 Ga0265338_10029667 Ga0265338_100296676 150
362 3300028800 Ga0265338_10139012 Ga0265338_101390121 150
363 3300028800 Ga0265338_10224167 Ga0265338_102241672 150
364 3300028800 Ga0265338_10300396 Ga0265338_103003962 150
365 3300028800 Ga0265338_10630412 Ga0265338_106304121 150
366 3300031090 Ga0265760_10098442 Ga0265760_100984421 150
367 3300031235 Ga0265330_10000087 Ga0265330_1000008714 150
368 3300031235 Ga0265330_10000459 Ga0265330_100004599 150
369 3300031235 Ga0265330_10035615 Ga0265330_100356152 150
370 3300031235 Ga0265330_10051007 Ga0265330_100510072 150
371 3300031235 Ga0265330_10234358 Ga0265330_102343581 150
372 3300031239 Ga0265328_10004391 Ga0265328_100043915 150
373 3300031239 Ga0265328_10073860 Ga0265328_100738602 150
374 3300031239 Ga0265328_10233050 Ga0265328_102330501 150
375 3300031240 Ga0265320_10066105 Ga0265320_100661052 150
376 3300031241 Ga0265325_10000500 Ga0265325_100005006 150
377 3300031241 Ga0265325_10033226 Ga0265325_100332264 150
378 3300031241 Ga0265325_10072541 Ga0265325_100725411 150
379 3300031241 Ga0265325_10119279 Ga0265325_101192792 150
380 3300031241 Ga0265325_10153656 Ga0265325_101536562 150
381 3300031247 Ga0265340_10013037 Ga0265340_100130371 150
382 3300031247 Ga0265340_10040005 Ga0265340_100400053 150
383 3300031247 Ga0265340_10084577 Ga0265340_100845772 150
384 3300031249 Ga0265339_10001353 Ga0265339_100013539 150
385 3300031249 Ga0265339_10001525 Ga0265339_100015253 150
386 3300031249 Ga0265339_10011604 Ga0265339_100116046 150
387 3300031249 Ga0265339_10132742 Ga0265339_101327421 150
388 3300031249 Ga0265339_10146051 Ga0265339_101460511 150
389 3300031344 Ga0265316_10000694 Ga0265316_1000069435 150
390 3300031344 Ga0265316_10000852 Ga0265316_1000085213 150
391 3300031344 Ga0265316_10000924 Ga0265316_1000092413 150
392 3300031344 Ga0265316_10036523 Ga0265316_100365235 150
393 3300031344 Ga0265316_10105064 Ga0265316_101050641 150
394 3300031344 Ga0265316_10111101 Ga0265316_101111011 150
395 3300031344 Ga0265316_10133668 Ga0265316_101336681 150
396 3300031344 Ga0265316_10270362 Ga0265316_102703622 150
397 3300031344 Ga0265316_10433169 Ga0265316_104331691 150
398 3300031595 Ga0265313_10003561 Ga0265313_100035612 150
399 3300031595 Ga0265313_10016209 Ga0265313_100162091 150
400 3300031595 Ga0265313_10055395 Ga0265313_100553951 150
401 3300031595 Ga0265313_10087660 Ga0265313_100876601 150
402 3300031595 Ga0265313_10197657 Ga0265313_101976572 150
403 3300031711 Ga0265314_10000067 Ga0265314_1000006760 150
404 3300031711 Ga0265314_10015363 Ga0265314_100153632 150
405 3300031712 Ga0265342_10000067 Ga0265342_100000673 150
406 3300031712 Ga0265342_10000537 Ga0265342_1000053736 150
407 3300031712 Ga0265342_10003998 Ga0265342_100039985 150
408 3300031712 Ga0265342_10015915 Ga0265342_100159154 150
409 3300031712 Ga0265342_10050347 Ga0265342_100503471 150
410 3300031712 Ga0265342_10078837 Ga0265342_100788371 150
411 3300035172 Ga0373955_0064368 Ga0373955_0064368_776_1228 150
412 3300036401 Ga0373937_0005972 Ga0373937_0005972_2913_3365 150
413 3300044656 Ga0466969_0045400 Ga0466969_0045400_700_1224 150
414 3300044684 Ga0466966_0233366 Ga0466966_0233366_137_661 150
415 3300044693 Ga0466961_0073182 Ga0466961_0073182_1389_1913 150
416 3300044693 Ga0466961_0323060 Ga0466961_0323060_49_501 150
417 3300045836 Ga0466958_0407225 Ga0466958_0407225_217_669 150
418 3300046809 Ga0495600_0837327 Ga0495600_0837327_39_491 150
419 3300047315 Ga0495581_0439698 Ga0495581_0439698_71_523 150
420 3300047319 Ga0495674_0335799 Ga0495674_0335799_229_681 150
421 3300047471 Ga0495684_0635012 Ga0495684_0635012_230_682 150
422 3300048907 Ga0496104_0043402 Ga0496104_0043402_558_1010 150
423 3300048908 Ga0496105_0475896 Ga0496105_0475896_19_471 150
424 3300048917 Ga0496114_0371329 Ga0496114_0371329_171_623 150
425 3300053119 Ga0500595_010667 Ga0500595_010667_2180_2632 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13798

PCYCGC

Protein of unknown function with PCYCGC motif

83

169

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.6224 68 133
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.4184 68 133
3lcn-assembly2.cif.gz_B nab2:gfd1 complex 0.3693 68 146
3sdz-assembly1.cif.gz_A structural characterization of the subunit a mutant f427w of the a-atp synthase from pyrococcus horikoshii 0.3549 64 142
3ikj-assembly1.cif.gz_A structural characterization for the nucleotide binding ability of subunit a mutant s238a of the a1ao atp synthase 0.3403 62 144
ID Description Score Start End Superfamily
af_C6SYH8_3_82_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6867 68 139 1.10.8.640
af_P0ABM9_18_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6596 68 140 1.10.8.640
af_P32711_19_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6511 61 140 1.10.8.640
2hl7A00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6224 68 133 1.10.8.640
af_C6SYH8_3_82_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.5155 68 139 1.10.8.640
ID Description Score Start End GO Terms
AF-A0A2V9AZJ5-F1-model_v4 Uncharacterized protein 0.9602 64 147
AF-A0A2V7K3L4-F1-model_v4 Uncharacterized protein 0.9356 79 140
AF-A0A2V7LG80-F1-model_v4 Uncharacterized protein 0.9352 62 140
AF-A0A2V9ZW13-F1-model_v4 Uncharacterized protein 0.9249 33 149
AF-A0A7V1UKR8-F1-model_v4 Uncharacterized protein 0.9134 28 147

Feature Viewer

pLDDT pTM Quality
89.42 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map