F441193

General Info

Members Datasets Scaffolds Average Seq Length
426 297 422 122

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10357381|Ga0105237_103573812
Length 141
Sequence VLRDPGYGSFSARDERRDLMAVTSFQDLPLADRDREWDGDAAEKRVRQWAGAEDEPNEKYRDAHVWYDAENKDNFTAYKLLVADVVDGRLRAVPRGVMAAGNVMQGGRGGVDLPDGDVDRVKSHLAKYYAKMGEDAPWERD

Samples

Sample ID Description Type Environment
1 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
2 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
3 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
4 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
185 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
211 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
217 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
218 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
219 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
273 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
274 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
275 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
278 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
279 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
280 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
281 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
282 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 2.11
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 9.62
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10172456 3300001989 Bacteria 637
2 JGI24737J22298_10109440 3300001990 Bacteria 818
3 JGI24743J22301_10000742 3300001991 Bacteria 4068
4 JGI24735J21928_10054779 3300002067 Bacteria 1149
5 JGI24735J21928_10147001 3300002067 Bacteria 680
6 JGI24745J21846_1002233 3300002073 Bacteria 1959
7 JGI24749J21850_1024916 3300002076 Bacteria 852
8 JGI24744J21845_10002731 3300002077 Bacteria 3600
9 JGI24034J26672_10014905 3300002239 Bacteria 1188
10 JGI24742J22300_10019102 3300002244 Bacteria 1163
11 Ga0006562J51391_1181773 3300003578 Bacteria 1510
12 Ga0006562J51391_1181775 3300003578 Bacteria 1020
13 Ga0070658_10102433 3300005327 Bacteria 2368
14 Ga0070658_10218530 3300005327 Bacteria 1611
15 Ga0070658_10441995 3300005327 Bacteria 1120
16 Ga0070683_100714067 3300005329 Bacteria 960
17 Ga0070683_100721584 3300005329 Bacteria 955
18 Ga0070690_100197695 3300005330 Bacteria 1397
19 Ga0070677_10438817 3300005333 Bacteria 696
20 Ga0068869_100139157 3300005334 Bacteria 1873
21 Ga0068869_100157776 3300005334 Bacteria 1764
22 Ga0070666_10344264 3300005335 Bacteria 1066
23 Ga0070680_100849413 3300005336 Bacteria 787
24 Ga0070680_100928496 3300005336 Bacteria 751
25 Ga0070682_100047607 3300005337 Bacteria 2666
26 Ga0070682_100120957 3300005337 Bacteria 1758
27 Ga0070682_100268781 3300005337 Bacteria 1238
28 Ga0068868_100328114 3300005338 Bacteria 1305
29 Ga0068868_100518345 3300005338 Bacteria 1046
30 Ga0070660_100095244 3300005339 Bacteria 2353
31 Ga0070660_100294280 3300005339 Bacteria 1330
32 Ga0070660_100320344 3300005339 Bacteria 1274
33 Ga0070660_100832653 3300005339 Bacteria 777
34 Ga0070689_100605253 3300005340 Bacteria 949
35 Ga0070691_10018522 3300005341 Bacteria 3211
36 Ga0070687_101046797 3300005343 Bacteria 594
37 Ga0070661_100959597 3300005344 Bacteria 708
38 Ga0070692_10030753 3300005345 Bacteria 2687
39 Ga0070668_100319203 3300005347 Bacteria 1307
40 Ga0070669_100482933 3300005353 Bacteria 1025
41 Ga0070675_100849277 3300005354 Bacteria 835
42 Ga0070671_100977616 3300005355 Bacteria 741
43 Ga0070673_100039136 3300005364 Bacteria 3627
44 Ga0070659_100034852 3300005366 Bacteria 3917
45 Ga0070659_100198593 3300005366 Bacteria 1650
46 Ga0070659_100510472 3300005366 Bacteria 1025
47 Ga0070659_100769723 3300005366 Bacteria 836
48 Ga0070667_100371003 3300005367 Bacteria 1298
49 Ga0070703_10024627 3300005406 Bacteria 1780
50 Ga0070709_10010325 3300005434 Bacteria 5166
51 Ga0070710_10025842 3300005437 Bacteria 3113
52 Ga0070701_10017122 3300005438 Bacteria 3383
53 Ga0070711_100024448 3300005439 Bacteria 3939
54 Ga0070705_100094305 3300005440 Bacteria 1874
55 Ga0070694_100558200 3300005444 Bacteria 918
56 Ga0070663_100087532 3300005455 Bacteria 2302
57 Ga0070663_100656270 3300005455 Bacteria 888
58 Ga0070678_100019861 3300005456 Bacteria 4394
59 Ga0070662_100030611 3300005457 Bacteria 3768
60 Ga0070681_10061593 3300005458 Bacteria 3726
61 Ga0068867_100246232 3300005459 Bacteria 1452
62 Ga0070699_100873813 3300005518 Bacteria 823
63 Ga0070679_100040112 3300005530 Bacteria 4658
64 Ga0070679_100098914 3300005530 Bacteria 2904
65 Ga0070679_100186583 3300005530 Bacteria 2044
66 Ga0070679_100632530 3300005530 Bacteria 1013
67 Ga0068853_100019817 3300005539 Bacteria 5586
68 Ga0070672_100125164 3300005543 Bacteria 2108
69 Ga0070695_100799015 3300005545 Bacteria 756
70 Ga0070696_100104301 3300005546 Bacteria 2036
71 Ga0070693_100226934 3300005547 Bacteria 1227
72 Ga0070665_100173726 3300005548 Bacteria 2155
73 Ga0070704_100215062 3300005549 Bacteria 1559
74 Ga0068855_100015326 3300005563 Bacteria 9230
75 Ga0068854_100119674 3300005578 Bacteria 1997
76 Ga0068856_100905612 3300005614 Bacteria 901
77 Ga0070702_100034305 3300005615 Bacteria 2796
78 Ga0068852_100364812 3300005616 Bacteria 1413
79 Ga0068852_100826185 3300005616 Bacteria 941
80 Ga0068859_100065966 3300005617 Bacteria 3654
81 Ga0068864_100952370 3300005618 Bacteria 849
82 Ga0068866_10058080 3300005718 Bacteria 1996
83 Ga0068861_102289122 3300005719 Bacteria 542
84 Ga0068851_10214982 3300005834 Bacteria 1078
85 Ga0068870_10207504 3300005840 Bacteria 1191
86 Ga0068863_100433355 3300005841 Bacteria 1289
87 Ga0068858_100023214 3300005842 Bacteria 5784
88 Ga0068860_100116298 3300005843 Bacteria 2558
89 Ga0081539_10007733 3300005985 Bacteria 9639
90 Ga0075365_10017807 3300006038 Bacteria 4357
91 Ga0075365_10136041 3300006038 Bacteria 1703
92 Ga0075365_10169151 3300006038 Bacteria 1525
93 Ga0075363_100006126 3300006048 Bacteria 5431
94 Ga0075363_100219665 3300006048 Bacteria 1089
95 Ga0075364_10092598 3300006051 Bacteria 2006
96 Ga0070715_10001371 3300006163 Bacteria 7028
97 Ga0070716_100005621 3300006173 Bacteria 6086
98 Ga0070712_100016501 3300006175 Bacteria 4772
99 Ga0075362_10601778 3300006177 Bacteria 568
100 Ga0075367_10209205 3300006178 Bacteria 1219
101 Ga0075369_10117028 3300006186 Bacteria 1204
102 Ga0097621_100224815 3300006237 Bacteria 1637
103 Ga0068871_100175200 3300006358 Bacteria 1841
104 Ga0075428_100011495 3300006844 Bacteria 9848
105 Ga0075431_100182095 3300006847 Bacteria 2156
106 Ga0075429_100601180 3300006880 Bacteria 964
107 Ga0068865_100530883 3300006881 Bacteria 985
108 Ga0097620_100065965 3300006931 Bacteria 3654
109 Ga0105250_10245643 3300009092 Bacteria 764
110 Ga0105240_10011130 3300009093 Bacteria 12570
111 Ga0105245_10954783 3300009098 Bacteria 900
112 Ga0105245_11012271 3300009098 Bacteria 875
113 Ga0105247_10146055 3300009101 Bacteria 1554
114 Ga0105247_10373494 3300009101 Bacteria 1009
115 Ga0114129_10019962 3300009147 Bacteria 9539
116 Ga0105243_10077087 3300009148 Bacteria 2710
117 Ga0105243_10696439 3300009148 Bacteria 990
118 Ga0105243_11618446 3300009148 Bacteria 675
119 Ga0105241_10464878 3300009174 Bacteria 1121
120 Ga0105242_10184264 3300009176 Bacteria 1844
121 Ga0105248_10073989 3300009177 Bacteria 3829
122 Ga0105248_10358251 3300009177 Bacteria 1642
123 Ga0105237_10357381 3300009545 Bacteria 1465
124 Ga0105237_10427769 3300009545 Bacteria 1330
125 Ga0105238_10241820 3300009551 Bacteria 1783
126 Ga0105238_10322824 3300009551 Bacteria 1530
127 Ga0105238_11304780 3300009551 Bacteria 752
128 Ga0105238_11626525 3300009551 Bacteria 676
129 Ga0105238_11957411 3300009551 Bacteria 619
130 Ga0105249_10109808 3300009553 Bacteria 2605
131 Ga0105239_10535005 3300010375 Bacteria 1334
132 Ga0105246_10024680 3300011119 Bacteria 3909
133 Ga0105246_10608428 3300011119 Bacteria 945
134 Ga0105246_10905601 3300011119 Bacteria 791
135 Ga0157373_10425779 3300013100 Bacteria 953
136 Ga0157370_10022049 3300013104 Bacteria 6342
137 Ga0157369_10067878 3300013105 Bacteria 3832
138 Ga0157369_11402060 3300013105 Bacteria 711
139 Ga0157369_11606799 3300013105 Bacteria 661
140 Ga0157374_10024792 3300013296 Bacteria 5379
141 Ga0157374_10660996 3300013296 Bacteria 1057
142 Ga0157378_10100093 3300013297 Bacteria 2645
143 Ga0163162_10154480 3300013306 Bacteria 2414
144 Ga0157375_10144596 3300013308 Bacteria 2508
145 Ga0157375_10216400 3300013308 Bacteria 2074
146 Ga0157375_10526835 3300013308 Bacteria 1344
147 Ga0157375_10761010 3300013308 Bacteria 1119
148 Ga0157375_12798343 3300013308 Bacteria 583
149 Ga0163163_13185109 3300014325 Bacteria 512
150 Ga0163163_13220110 3300014325 Bacteria 509
151 Ga0157380_10104562 3300014326 Bacteria 2365
152 Ga0157380_12987992 3300014326 Bacteria 539
153 Ga0157377_10018344 3300014745 Bacteria 3635
154 Ga0157379_10030193 3300014968 Bacteria 4823
155 Ga0157376_10087190 3300014969 Bacteria 2693
156 Ga0163161_10035189 3300017792 Bacteria 3584
157 Ga0206349_1897956 3300020075 Bacteria 535
158 Ga0206353_10206555 3300020082 Bacteria 710
159 Ga0206353_10783756 3300020082 Bacteria 1709
160 Ga0206353_10949970 3300020082 Bacteria 4663
161 Ga0154015_1569223 3300020610 Bacteria 1037
162 Ga0224712_10190922 3300022467 Bacteria 927
163 Ga0224712_10404933 3300022467 Bacteria 651
164 Ga0207656_10113179 3300025321 Bacteria 1256
165 Ga0207692_10029476 3300025898 Bacteria 2608
166 Ga0207642_10056707 3300025899 Bacteria 1798
167 Ga0207688_10001523 3300025901 Bacteria 12166
168 Ga0207688_10534302 3300025901 Bacteria 736
169 Ga0207680_10415171 3300025903 Bacteria 952
170 Ga0207647_10161401 3300025904 Bacteria 1307
171 Ga0207699_10099037 3300025906 Bacteria 1846
172 Ga0207645_10541089 3300025907 Bacteria 790
173 Ga0207643_10496906 3300025908 Bacteria 779
174 Ga0207705_10387340 3300025909 Bacteria 1080
175 Ga0207654_10331458 3300025911 Bacteria 1043
176 Ga0207707_10024183 3300025912 Bacteria 5314
177 Ga0207707_10095204 3300025912 Bacteria 2602
178 Ga0207695_10862033 3300025913 Bacteria 786
179 Ga0207671_10294098 3300025914 Bacteria 1283
180 Ga0207671_10323095 3300025914 Bacteria 1221
181 Ga0207693_10001955 3300025915 Bacteria 18066
182 Ga0207663_10034783 3300025916 Bacteria 3017
183 Ga0207660_10166892 3300025917 Bacteria 1702
184 Ga0207657_10053477 3300025919 Bacteria 3498
185 Ga0207657_10967818 3300025919 Bacteria 654
186 Ga0207649_10520202 3300025920 Bacteria 907
187 Ga0207652_10099136 3300025921 Bacteria 2570
188 Ga0207652_10197290 3300025921 Bacteria 1811
189 Ga0207652_10330317 3300025921 Bacteria 1377
190 Ga0207652_10592922 3300025921 Bacteria 994
191 Ga0207694_10189999 3300025924 Bacteria 1668
192 Ga0207694_10383919 3300025924 Bacteria 1166
193 Ga0207694_11030985 3300025924 Bacteria 696
194 Ga0207659_11108527 3300025926 Bacteria 681
195 Ga0207687_10566275 3300025927 Bacteria 955
196 Ga0207700_11195570 3300025928 Bacteria 679
197 Ga0207664_10000001 3300025929 Bacteria 724213
198 Ga0207690_10016755 3300025932 Bacteria 4466
199 Ga0207690_10115437 3300025932 Bacteria 1940
200 Ga0207690_10134138 3300025932 Bacteria 1816
201 Ga0207706_10085190 3300025933 Bacteria 2778
202 Ga0207686_10074514 3300025934 Bacteria 2193
203 Ga0207709_10218134 3300025935 Bacteria 1374
204 Ga0207709_10926438 3300025935 Bacteria 709
205 Ga0207670_10061448 3300025936 Bacteria 2564
206 Ga0207665_10011601 3300025939 Bacteria 5790
207 Ga0207691_10030047 3300025940 Bacteria 5081
208 Ga0207711_10420947 3300025941 Bacteria 1242
209 Ga0207689_10005173 3300025942 Bacteria 11718
210 Ga0207689_10112071 3300025942 Bacteria 2243
211 Ga0207661_10539647 3300025944 Bacteria 1068
212 Ga0207679_10040454 3300025945 Bacteria 3338
213 Ga0207667_10145631 3300025949 Bacteria 2438
214 Ga0207651_10321236 3300025960 Bacteria 1294
215 Ga0207668_10078902 3300025972 Bacteria 2379
216 Ga0207640_10160362 3300025981 Bacteria 1663
217 Ga0207677_10214307 3300026023 Bacteria 1540
218 Ga0207677_11274900 3300026023 Bacteria 674
219 Ga0207703_10027818 3300026035 Bacteria 4453
220 Ga0207639_10528108 3300026041 Bacteria 1081
221 Ga0207678_10008563 3300026067 Bacteria 9010
222 Ga0207678_10009394 3300026067 Bacteria 8605
223 Ga0207702_10432684 3300026078 Bacteria 1274
224 Ga0207702_10853145 3300026078 Bacteria 901
225 Ga0207648_10007446 3300026089 Bacteria 10762
226 Ga0207676_10745281 3300026095 Bacteria 952
227 Ga0207674_10561681 3300026116 Bacteria 1102
228 Ga0207675_100044232 3300026118 Bacteria 4160
229 Ga0207683_10023060 3300026121 Bacteria 5349
230 Ga0207698_10088301 3300026142 Bacteria 2528
231 Ga0207698_10807774 3300026142 Bacteria 940
232 Ga0268265_10358782 3300028380 Bacteria 1333
233 Ga0316181_1104651 3300030744 Bacteria 1268
234 Ga0307408_100123294 3300031548 Bacteria 2011
235 Ga0307408_100247117 3300031548 Bacteria 1469
236 Ga0307408_101203104 3300031548 Bacteria 707
237 Ga0307405_10195518 3300031731 Bacteria 1464
238 Ga0307405_10323864 3300031731 Bacteria 1178
239 Ga0307405_11502384 3300031731 Bacteria 592
240 Ga0307405_11541965 3300031731 Bacteria 585
241 Ga0307410_10327338 3300031852 Bacteria 1218
242 Ga0307410_10503828 3300031852 Bacteria 996
243 Ga0307410_10632904 3300031852 Bacteria 895
244 Ga0307406_10012326 3300031901 Bacteria 4875
245 Ga0307407_10004187 3300031903 Bacteria 6082
246 Ga0307407_10076435 3300031903 Bacteria 2010
247 Ga0307412_10031546 3300031911 Bacteria 3348
248 Ga0307412_11034379 3300031911 Bacteria 727
249 Ga0307409_100039049 3300031995 Bacteria 3518
250 Ga0307409_100309611 3300031995 Bacteria 1473
251 Ga0307409_100629775 3300031995 Bacteria 1064
252 Ga0307416_100190734 3300032002 Bacteria 1932
253 Ga0307414_10375609 3300032004 Bacteria 1227
254 Ga0307411_10099277 3300032005 Bacteria 2054
255 Ga0307411_10460332 3300032005 Bacteria 1066
256 Ga0307415_101098196 3300032126 Bacteria 744
257 Ga0373930_0065748 3300034816 Bacteria 817
258 Ga0373928_0073019 3300035084 Bacteria 852
259 Ga0373929_0038535 3300035085 Bacteria 1052
260 Ga0373934_0409437 3300035086 Bacteria 567
261 Ga0373949_0020953 3300035090 Bacteria 1500
262 Ga0373951_0020382 3300035091 Bacteria 1517
263 Ga0373952_0153743 3300035092 Bacteria 647
264 Ga0373932_0078366 3300035112 Bacteria 1039
265 Ga0373936_0005442 3300035113 Bacteria 4804
266 Ga0373941_0218768 3300035115 Bacteria 731
267 Ga0373956_0399973 3300035119 Bacteria 655
268 Ga0373955_0597378 3300035172 Bacteria 676
269 Ga0373942_0010905 3300035207 Bacteria 2146
270 Ga0373961_0156357 3300035241 Bacteria 780
271 Ga0373962_0044952 3300035242 Bacteria 1256
272 Ga0373924_0161626 3300035410 Bacteria 982
273 Ga0373924_0251226 3300035410 Bacteria 783
274 Ga0373931_0011469 3300035691 Bacteria 4283
275 Ga0373937_0122318 3300036401 Bacteria 2426
276 Ga0373937_0258624 3300036401 Bacteria 1642
277 Ga0373925_0284100 3300037068 Bacteria 1333
278 Ga0395900_0457970 3300037418 Bacteria 1231
279 Ga0395900_0582008 3300037418 Bacteria 1061
280 Ga0395898_0548585 3300037466 Bacteria 1098
281 Ga0395898_0694429 3300037466 Bacteria 959
282 Ga0395905_0294845 3300037471 Bacteria 1509
283 Ga0395901_1106272 3300038443 Bacteria 763
284 Ga0395901_1137471 3300038443 Bacteria 749
285 Ga0395901_1610296 3300038443 Bacteria 603
286 Ga0436363_0523583 3300039450 Bacteria 3727
287 Ga0439438_125233 3300041405 Bacteria 617
288 Ga0439465_0132129 3300041413 Bacteria 882
289 Ga0451791_1633871 3300041451 Bacteria 1545
290 Ga0451837_0552862 3300041494 Bacteria 716
291 Ga0451839_0244655 3300041496 Bacteria 701
292 Ga0451847_0187007 3300041503 Bacteria 702
293 Ga0451843_1335543 3300041509 Bacteria 586
294 Ga0439442_052864 3300042002 Bacteria 858
295 Ga0439443_020213 3300042003 Unclassified 1044
296 Ga0439463_166911 3300042016 Bacteria 571
297 Ga0450888_006790 3300042126 Unclassified 1252
298 Ga0450902_048437 3300042137 Bacteria 728
299 Ga0439458_0046743 3300042157 Bacteria 1061
300 Ga0466972_0023812 3300044658 Bacteria 3043
301 Ga0466972_0029565 3300044658 Bacteria 2698
302 Ga0466972_0041339 3300044658 Bacteria 2245
303 Ga0466965_0002319 3300044683 Bacteria 8043
304 Ga0466966_0823610 3300044684 Bacteria 560
305 Ga0466964_0222561 3300044706 Bacteria 917
306 Ga0466964_0610722 3300044706 Bacteria 599
307 Ga0466964_0874653 3300044706 Bacteria 512
308 Ga0466970_0058993 3300044765 Bacteria 2055
309 Ga0466970_0215444 3300044765 Bacteria 1071
310 Ga0466970_0461439 3300044765 Bacteria 729
311 Ga0466957_0145855 3300044842 Bacteria 1528
312 Ga0466957_0383692 3300044842 Bacteria 959
313 Ga0466957_0569308 3300044842 Bacteria 791
314 Ga0466960_0145917 3300044901 Bacteria 1260
315 Ga0466967_0036154 3300045976 Bacteria 4214
316 Ga0466967_0090760 3300045976 Bacteria 2776
317 Ga0466967_1163456 3300045976 Bacteria 768
318 Ga0466967_1304868 3300045976 Bacteria 723
319 Ga0495651_0051325 3300046462 Bacteria 3180
320 Ga0495639_0553010 3300046475 Bacteria 590
321 Ga0495608_0216591 3300046511 Bacteria 1202
322 Ga0495608_0374634 3300046511 Bacteria 873
323 Ga0495628_0620568 3300046516 Bacteria 770
324 Ga0495652_0267960 3300046529 Bacteria 1257
325 Ga0495667_0013035 3300046559 Bacteria 5630
326 Ga0495667_0206380 3300046559 Bacteria 1256
327 Ga0495656_0473183 3300046615 Bacteria 662
328 Ga0495657_0715820 3300046675 Bacteria 575
329 Ga0495599_0000929 3300046678 Bacteria 16359
330 Ga0495646_0425432 3300046680 Bacteria 688
331 Ga0495647_0307408 3300046681 Bacteria 716
332 Ga0495674_0976782 3300047319 Bacteria 650
333 Ga0495680_0089083 3300047322 Bacteria 2317
334 Ga0495680_0116717 3300047322 Bacteria 1973
335 Ga0495684_0074621 3300047471 Bacteria 2577
336 Ga0495602_0176182 3300048088 Bacteria 1654
337 Ga0496100_0293961 3300048903 Bacteria 1214
338 Ga0496100_0700422 3300048903 Bacteria 790
339 Ga0496101_0263206 3300048904 Bacteria 1345
340 Ga0496101_0576969 3300048904 Bacteria 889
341 Ga0496102_0177260 3300048905 Bacteria 2007
342 Ga0496102_0388686 3300048905 Bacteria 1313
343 Ga0496102_0518873 3300048905 Bacteria 1114
344 Ga0496102_0748158 3300048905 Bacteria 900
345 Ga0496103_0041943 3300048906 Bacteria 2814
346 Ga0496103_0890315 3300048906 Bacteria 558
347 Ga0496104_0077091 3300048907 Bacteria 3176
348 Ga0496104_0842440 3300048907 Bacteria 822
349 Ga0496105_0100475 3300048908 Bacteria 2389
350 Ga0496105_0351791 3300048908 Bacteria 1176
351 Ga0496105_0531388 3300048908 Bacteria 920
352 Ga0496107_0286762 3300048910 Bacteria 1225
353 Ga0496107_0397018 3300048910 Bacteria 1026
354 Ga0496108_0002496 3300048911 Bacteria 14726
355 Ga0496108_0335417 3300048911 Bacteria 1319
356 Ga0496108_0358636 3300048911 Bacteria 1272
357 Ga0496108_1031199 3300048911 Bacteria 701
358 Ga0496109_0002371 3300048912 Bacteria 15734
359 Ga0496109_0018642 3300048912 Bacteria 6099
360 Ga0496109_0034856 3300048912 Bacteria 4537
361 Ga0496109_0821915 3300048912 Bacteria 867
362 Ga0496110_0147509 3300048913 Bacteria 2129
363 Ga0496110_0768475 3300048913 Bacteria 867
364 Ga0496111_0317796 3300048914 Bacteria 1153
365 Ga0496112_0005930 3300048915 Bacteria 10658
366 Ga0496112_0120307 3300048915 Bacteria 2596
367 Ga0496112_0149107 3300048915 Bacteria 2306
368 Ga0496112_1143603 3300048915 Bacteria 696
369 Ga0496113_0012945 3300048916 Bacteria 5627
370 Ga0496113_0133589 3300048916 Bacteria 1949
371 Ga0496113_0278190 3300048916 Bacteria 1338
372 Ga0496114_0057585 3300048917 Bacteria 3244
373 Ga0496114_0357718 3300048917 Bacteria 1291
374 Ga0496114_0419974 3300048917 Bacteria 1184
375 Ga0496115_0040837 3300048918 Bacteria 3690
376 Ga0496115_0134301 3300048918 Bacteria 2040
377 Ga0501295_053034 3300049518 Bacteria 872
378 Ga0501031_0427847 3300049568 Bacteria 856
379 Ga0501031_0862823 3300049568 Bacteria 580
380 Ga0501036_0247691 3300049572 Bacteria 1494
381 Ga0501036_0711156 3300049572 Bacteria 830
382 Ga0501039_1504543 3300049575 Bacteria 517
383 Ga0501041_0129986 3300049577 Bacteria 1569
384 Ga0501042_1225545 3300049578 Bacteria 547
385 Ga0501047_0594819 3300049581 Bacteria 928
386 Ga0501048_0696226 3300049582 Bacteria 730
387 Ga0501067_0095789 3300049583 Bacteria 1648
388 Ga0501067_0215128 3300049583 Bacteria 1070
389 Ga0501069_0027907 3300049585 Bacteria 3095
390 Ga0501069_0444695 3300049585 Bacteria 770
391 Ga0501071_0453114 3300049587 Bacteria 982
392 Ga0501071_0729886 3300049587 Bacteria 763
393 Ga0501075_1228193 3300049591 Bacteria 568
394 Ga0501076_0248692 3300049592 Bacteria 1455
395 Ga0501202_010377 3300049652 Bacteria 1727
396 Ga0501207_058091 3300049654 Bacteria 703
397 Ga0501208_014351 3300049655 Bacteria 1197
398 Ga0501209_060955 3300049656 Bacteria 1053
399 Ga0501243_012373 3300049675 Bacteria 1346
400 Ga0501259_102786 3300049688 Bacteria 658
401 Ga0501261_033006 3300049690 Bacteria 790
402 Ga0501245_012765 3300049708 Bacteria 1236
403 Ga0501264_049464 3300049761 Bacteria 538
404 Ga0501270_065274 3300049767 Bacteria 692
405 Ga0501283_052439 3300049779 Bacteria 725
406 Ga0501044_1121301 3300049823 Bacteria 656
407 Ga0501045_0136170 3300049824 Bacteria 1826
408 Ga0501212_024454 3300049851 Bacteria 950
409 nmdc:mga03683_539792_c1 3300050489 Bacteria 567
410 nmdc:mga03n38_219729_c1 3300050490 Bacteria 991
411 nmdc:mga00v17_49605_c1 3300050491 Bacteria 2547
412 nmdc:mga0yw44_391572_c1 3300050492 Bacteria 939
413 nmdc:mga0yw44_95779_c1 3300050492 Bacteria 1883
414 nmdc:mga06z11_179864_c1 3300050494 Bacteria 1219
415 nmdc:mga05p37_17458_c1 3300050507 Bacteria 8661
416 nmdc:mga09592_641420_c1 3300050508 Bacteria 907
417 nmdc:mga06r32_194419_c1 3300050510 Bacteria 2016
418 nmdc:mga0sz30_54888_c1 3300050516 Bacteria 1695
419 Ga0495601_0501896 3300053077 Bacteria 783
420 Ga0495595_0014325 3300053084 Bacteria 3362
421 Ga0495595_0284315 3300053084 Bacteria 831
422 Ga0530510_0522050 3300061734 Bacteria 901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0161626 Ga0373924_0161626_570_941 113
2 iso_pu_bacteria 2811994874 2812334466 117
3 3300005985 Ga0081539_10007733 Ga0081539_100077336 118
4 iso_pu_bacteria 2808606365 2808872283 118
5 iso_pu_bacteria 2811994882 2812373644 118
6 iso_pu_bacteria 2818991458 2819665270 118
7 3300020082 Ga0206353_10206555 Ga0206353_102065551 120
8 3300030744 Ga0316181_1104651 Ga0316181_11046512 120
9 3300031548 Ga0307408_101203104 Ga0307408_1012031041 120
10 3300031731 Ga0307405_11541965 Ga0307405_115419652 120
11 3300031995 Ga0307409_100629775 Ga0307409_1006297752 120
12 3300005333 Ga0070677_10438817 Ga0070677_104388172 121
13 3300005334 Ga0068869_100139157 Ga0068869_1001391574 121
14 3300005339 Ga0070660_100095244 Ga0070660_1000952442 121
15 3300005366 Ga0070659_100034852 Ga0070659_1000348523 121
16 3300005366 Ga0070659_100198593 Ga0070659_1001985932 121
17 3300005530 Ga0070679_100186583 Ga0070679_1001865833 121
18 3300005719 Ga0068861_102289122 Ga0068861_1022891221 121
19 3300006844 Ga0075428_100011495 Ga0075428_1000114952 121
20 3300006847 Ga0075431_100182095 Ga0075431_1001820952 121
21 3300006880 Ga0075429_100601180 Ga0075429_1006011802 121
22 3300009147 Ga0114129_10019962 Ga0114129_100199628 121
23 3300009148 Ga0105243_11618446 Ga0105243_116184461 121
24 3300009551 Ga0105238_11957411 Ga0105238_119574111 121
25 3300013308 Ga0157375_10144596 Ga0157375_101445961 121
26 3300014326 Ga0157380_12987992 Ga0157380_129879921 121
27 3300014969 Ga0157376_10087190 Ga0157376_100871903 121
28 3300020075 Ga0206349_1897956 Ga0206349_18979561 121
29 3300020082 Ga0206353_10783756 Ga0206353_107837561 121
30 3300022467 Ga0224712_10190922 Ga0224712_101909221 121
31 3300022467 Ga0224712_10404933 Ga0224712_104049331 121
32 3300025908 Ga0207643_10496906 Ga0207643_104969061 121
33 3300025912 Ga0207707_10024183 Ga0207707_100241837 121
34 3300025919 Ga0207657_10053477 Ga0207657_100534772 121
35 3300025921 Ga0207652_10197290 Ga0207652_101972902 121
36 3300025921 Ga0207652_10592922 Ga0207652_105929222 121
37 3300025929 Ga0207664_10000001 Ga0207664_10000001191 121
38 3300025932 Ga0207690_10016755 Ga0207690_100167553 121
39 3300025942 Ga0207689_10112071 Ga0207689_101120714 121
40 3300026142 Ga0207698_10807774 Ga0207698_108077741 121
41 3300031548 Ga0307408_100247117 Ga0307408_1002471172 121
42 3300031731 Ga0307405_10323864 Ga0307405_103238642 121
43 3300031852 Ga0307410_10327338 Ga0307410_103273382 121
44 3300031852 Ga0307410_10503828 Ga0307410_105038282 121
45 3300031901 Ga0307406_10012326 Ga0307406_100123264 121
46 3300031903 Ga0307407_10076435 Ga0307407_100764353 121
47 3300031911 Ga0307412_11034379 Ga0307412_110343792 121
48 3300031995 Ga0307409_100309611 Ga0307409_1003096112 121
49 3300032004 Ga0307414_10375609 Ga0307414_103756091 121
50 3300032005 Ga0307411_10099277 Ga0307411_100992774 121
51 3300037466 Ga0395898_0548585 Ga0395898_0548585_259_624 121
52 3300041413 Ga0439465_0132129 Ga0439465_0132129_177_542 121
53 3300041503 Ga0451847_0187007 Ga0451847_0187007_68_433 121
54 3300042003 Ga0439443_020213 Ga0439443_020213_533_898 121
55 3300042016 Ga0439463_166911 Ga0439463_166911_145_510 121
56 3300042126 Ga0450888_006790 Ga0450888_006790_873_1238 121
57 3300042157 Ga0439458_0046743 Ga0439458_0046743_257_622 121
58 3300044658 Ga0466972_0023812 Ga0466972_0023812_2566_2931 121
59 3300044658 Ga0466972_0029565 Ga0466972_0029565_586_951 121
60 3300044683 Ga0466965_0002319 Ga0466965_0002319_3833_4198 121
61 3300044684 Ga0466966_0823610 Ga0466966_0823610_91_456 121
62 3300044706 Ga0466964_0222561 Ga0466964_0222561_95_460 121
63 3300044706 Ga0466964_0874653 Ga0466964_0874653_43_408 121
64 3300044765 Ga0466970_0215444 Ga0466970_0215444_250_615 121
65 3300044765 Ga0466970_0461439 Ga0466970_0461439_195_581 121
66 3300044842 Ga0466957_0145855 Ga0466957_0145855_300_665 121
67 3300044842 Ga0466957_0383692 Ga0466957_0383692_186_551 121
68 3300044842 Ga0466957_0569308 Ga0466957_0569308_360_725 121
69 3300045976 Ga0466967_1304868 Ga0466967_1304868_266_631 121
70 3300046615 Ga0495656_0473183 Ga0495656_0473183_264_629 121
71 3300049518 Ga0501295_053034 Ga0501295_053034_244_609 121
72 3300049568 Ga0501031_0427847 Ga0501031_0427847_64_429 121
73 3300049572 Ga0501036_0711156 Ga0501036_0711156_69_434 121
74 3300049575 Ga0501039_1504543 Ga0501039_1504543_10_375 121
75 3300049578 Ga0501042_1225545 Ga0501042_1225545_75_440 121
76 3300049583 Ga0501067_0095789 Ga0501067_0095789_923_1288 121
77 3300049585 Ga0501069_0027907 Ga0501069_0027907_2011_2376 121
78 3300049587 Ga0501071_0453114 Ga0501071_0453114_55_420 121
79 3300049587 Ga0501071_0729886 Ga0501071_0729886_113_478 121
80 3300049592 Ga0501076_0248692 Ga0501076_0248692_459_824 121
81 3300049652 Ga0501202_010377 Ga0501202_010377_630_995 121
82 3300049654 Ga0501207_058091 Ga0501207_058091_269_667 121
83 3300049655 Ga0501208_014351 Ga0501208_014351_341_739 121
84 3300049656 Ga0501209_060955 Ga0501209_060955_149_514 121
85 3300049675 Ga0501243_012373 Ga0501243_012373_388_786 121
86 3300049688 Ga0501259_102786 Ga0501259_102786_61_426 121
87 3300049690 Ga0501261_033006 Ga0501261_033006_305_703 121
88 3300049708 Ga0501245_012765 Ga0501245_012765_567_932 121
89 3300049761 Ga0501264_049464 Ga0501264_049464_158_523 121
90 3300049767 Ga0501270_065274 Ga0501270_065274_304_669 121
91 3300049779 Ga0501283_052439 Ga0501283_052439_175_573 121
92 3300049851 Ga0501212_024454 Ga0501212_024454_117_515 121
93 3300050507 nmdc:mga05p37_17458_c1 nmdc:mga05p37_17458_c1_520_885 121
94 3300050508 nmdc:mga09592_641420_c1 nmdc:mga09592_641420_c1_400_765 121
95 3300050510 nmdc:mga06r32_194419_c1 nmdc:mga06r32_194419_c1_913_1278 121
96 3300061734 Ga0530510_0522050 Ga0530510_0522050_462_827 121
97 3300001989 JGI24739J22299_10172456 JGI24739J22299_101724562 122
98 3300001990 JGI24737J22298_10109440 JGI24737J22298_101094402 122
99 3300001991 JGI24743J22301_10000742 JGI24743J22301_100007423 122
100 3300002067 JGI24735J21928_10054779 JGI24735J21928_100547791 122
101 3300002067 JGI24735J21928_10147001 JGI24735J21928_101470012 122
102 3300002073 JGI24745J21846_1002233 JGI24745J21846_10022332 122
103 3300002076 JGI24749J21850_1024916 JGI24749J21850_10249162 122
104 3300002077 JGI24744J21845_10002731 JGI24744J21845_100027312 122
105 3300002239 JGI24034J26672_10014905 JGI24034J26672_100149052 122
106 3300002244 JGI24742J22300_10019102 JGI24742J22300_100191022 122
107 3300003578 Ga0006562J51391_1181773 Ga0006562J51391_11817732 122
108 3300003578 Ga0006562J51391_1181775 Ga0006562J51391_11817752 122
109 3300005327 Ga0070658_10102433 Ga0070658_101024332 122
110 3300005327 Ga0070658_10218530 Ga0070658_102185302 122
111 3300005327 Ga0070658_10441995 Ga0070658_104419951 122
112 3300005329 Ga0070683_100714067 Ga0070683_1007140671 122
113 3300005329 Ga0070683_100721584 Ga0070683_1007215842 122
114 3300005330 Ga0070690_100197695 Ga0070690_1001976952 122
115 3300005334 Ga0068869_100157776 Ga0068869_1001577762 122
116 3300005335 Ga0070666_10344264 Ga0070666_103442642 122
117 3300005336 Ga0070680_100849413 Ga0070680_1008494132 122
118 3300005336 Ga0070680_100928496 Ga0070680_1009284962 122
119 3300005337 Ga0070682_100047607 Ga0070682_1000476072 122
120 3300005337 Ga0070682_100120957 Ga0070682_1001209572 122
121 3300005337 Ga0070682_100268781 Ga0070682_1002687812 122
122 3300005338 Ga0068868_100328114 Ga0068868_1003281142 122
123 3300005338 Ga0068868_100518345 Ga0068868_1005183452 122
124 3300005339 Ga0070660_100294280 Ga0070660_1002942801 122
125 3300005339 Ga0070660_100320344 Ga0070660_1003203442 122
126 3300005339 Ga0070660_100832653 Ga0070660_1008326532 122
127 3300005340 Ga0070689_100605253 Ga0070689_1006052532 122
128 3300005341 Ga0070691_10018522 Ga0070691_100185222 122
129 3300005343 Ga0070687_101046797 Ga0070687_1010467971 122
130 3300005344 Ga0070661_100959597 Ga0070661_1009595971 122
131 3300005345 Ga0070692_10030753 Ga0070692_100307533 122
132 3300005347 Ga0070668_100319203 Ga0070668_1003192032 122
133 3300005353 Ga0070669_100482933 Ga0070669_1004829332 122
134 3300005354 Ga0070675_100849277 Ga0070675_1008492772 122
135 3300005355 Ga0070671_100977616 Ga0070671_1009776161 122
136 3300005364 Ga0070673_100039136 Ga0070673_1000391363 122
137 3300005366 Ga0070659_100510472 Ga0070659_1005104721 122
138 3300005366 Ga0070659_100769723 Ga0070659_1007697232 122
139 3300005367 Ga0070667_100371003 Ga0070667_1003710032 122
140 3300005406 Ga0070703_10024627 Ga0070703_100246272 122
141 3300005434 Ga0070709_10010325 Ga0070709_100103255 122
142 3300005437 Ga0070710_10025842 Ga0070710_100258424 122
143 3300005438 Ga0070701_10017122 Ga0070701_100171222 122
144 3300005439 Ga0070711_100024448 Ga0070711_1000244483 122
145 3300005440 Ga0070705_100094305 Ga0070705_1000943052 122
146 3300005444 Ga0070694_100558200 Ga0070694_1005582002 122
147 3300005455 Ga0070663_100087532 Ga0070663_1000875322 122
148 3300005455 Ga0070663_100656270 Ga0070663_1006562702 122
149 3300005456 Ga0070678_100019861 Ga0070678_1000198614 122
150 3300005457 Ga0070662_100030611 Ga0070662_1000306113 122
151 3300005458 Ga0070681_10061593 Ga0070681_100615933 122
152 3300005459 Ga0068867_100246232 Ga0068867_1002462322 122
153 3300005518 Ga0070699_100873813 Ga0070699_1008738132 122
154 3300005530 Ga0070679_100040112 Ga0070679_1000401123 122
155 3300005530 Ga0070679_100098914 Ga0070679_1000989143 122
156 3300005530 Ga0070679_100632530 Ga0070679_1006325302 122
157 3300005539 Ga0068853_100019817 Ga0068853_1000198174 122
158 3300005543 Ga0070672_100125164 Ga0070672_1001251642 122
159 3300005545 Ga0070695_100799015 Ga0070695_1007990152 122
160 3300005546 Ga0070696_100104301 Ga0070696_1001043013 122
161 3300005547 Ga0070693_100226934 Ga0070693_1002269342 122
162 3300005548 Ga0070665_100173726 Ga0070665_1001737262 122
163 3300005549 Ga0070704_100215062 Ga0070704_1002150622 122
164 3300005563 Ga0068855_100015326 Ga0068855_1000153266 122
165 3300005578 Ga0068854_100119674 Ga0068854_1001196742 122
166 3300005614 Ga0068856_100905612 Ga0068856_1009056121 122
167 3300005615 Ga0070702_100034305 Ga0070702_1000343052 122
168 3300005616 Ga0068852_100364812 Ga0068852_1003648121 122
169 3300005616 Ga0068852_100826185 Ga0068852_1008261852 122
170 3300005617 Ga0068859_100065966 Ga0068859_1000659662 122
171 3300005618 Ga0068864_100952370 Ga0068864_1009523701 122
172 3300005718 Ga0068866_10058080 Ga0068866_100580802 122
173 3300005834 Ga0068851_10214982 Ga0068851_102149822 122
174 3300005840 Ga0068870_10207504 Ga0068870_102075042 122
175 3300005841 Ga0068863_100433355 Ga0068863_1004333552 122
176 3300005842 Ga0068858_100023214 Ga0068858_1000232142 122
177 3300005843 Ga0068860_100116298 Ga0068860_1001162982 122
178 3300006038 Ga0075365_10017807 Ga0075365_100178073 122
179 3300006038 Ga0075365_10136041 Ga0075365_101360412 122
180 3300006038 Ga0075365_10169151 Ga0075365_101691513 122
181 3300006048 Ga0075363_100006126 Ga0075363_1000061264 122
182 3300006048 Ga0075363_100219665 Ga0075363_1002196652 122
183 3300006051 Ga0075364_10092598 Ga0075364_100925982 122
184 3300006163 Ga0070715_10001371 Ga0070715_100013714 122
185 3300006173 Ga0070716_100005621 Ga0070716_1000056214 122
186 3300006175 Ga0070712_100016501 Ga0070712_1000165015 122
187 3300006177 Ga0075362_10601778 Ga0075362_106017782 122
188 3300006178 Ga0075367_10209205 Ga0075367_102092052 122
189 3300006186 Ga0075369_10117028 Ga0075369_101170282 122
190 3300006237 Ga0097621_100224815 Ga0097621_1002248152 122
191 3300006358 Ga0068871_100175200 Ga0068871_1001752002 122
192 3300006881 Ga0068865_100530883 Ga0068865_1005308832 122
193 3300006931 Ga0097620_100065965 Ga0097620_1000659652 122
194 3300009092 Ga0105250_10245643 Ga0105250_102456431 122
195 3300009093 Ga0105240_10011130 Ga0105240_100111301 122
196 3300009098 Ga0105245_10954783 Ga0105245_109547832 122
197 3300009098 Ga0105245_11012271 Ga0105245_110122712 122
198 3300009101 Ga0105247_10146055 Ga0105247_101460552 122
199 3300009101 Ga0105247_10373494 Ga0105247_103734942 122
200 3300009148 Ga0105243_10077087 Ga0105243_100770872 122
201 3300009148 Ga0105243_10696439 Ga0105243_106964392 122
202 3300009174 Ga0105241_10464878 Ga0105241_104648782 122
203 3300009176 Ga0105242_10184264 Ga0105242_101842642 122
204 3300009177 Ga0105248_10073989 Ga0105248_100739893 122
205 3300009177 Ga0105248_10358251 Ga0105248_103582512 122
206 3300009545 Ga0105237_10357381 Ga0105237_103573812 122
207 3300009545 Ga0105237_10427769 Ga0105237_104277692 122
208 3300009551 Ga0105238_10241820 Ga0105238_102418202 122
209 3300009551 Ga0105238_10322824 Ga0105238_103228242 122
210 3300009551 Ga0105238_11304780 Ga0105238_113047802 122
211 3300009551 Ga0105238_11626525 Ga0105238_116265252 122
212 3300009553 Ga0105249_10109808 Ga0105249_101098082 122
213 3300010375 Ga0105239_10535005 Ga0105239_105350052 122
214 3300011119 Ga0105246_10024680 Ga0105246_100246804 122
215 3300011119 Ga0105246_10608428 Ga0105246_106084282 122
216 3300011119 Ga0105246_10905601 Ga0105246_109056012 122
217 3300013100 Ga0157373_10425779 Ga0157373_104257792 122
218 3300013104 Ga0157370_10022049 Ga0157370_100220491 122
219 3300013105 Ga0157369_10067878 Ga0157369_100678784 122
220 3300013105 Ga0157369_11402060 Ga0157369_114020601 122
221 3300013105 Ga0157369_11606799 Ga0157369_116067992 122
222 3300013296 Ga0157374_10024792 Ga0157374_100247923 122
223 3300013296 Ga0157374_10660996 Ga0157374_106609962 122
224 3300013297 Ga0157378_10100093 Ga0157378_101000933 122
225 3300013306 Ga0163162_10154480 Ga0163162_101544802 122
226 3300013308 Ga0157375_10216400 Ga0157375_102164002 122
227 3300013308 Ga0157375_10526835 Ga0157375_105268353 122
228 3300013308 Ga0157375_10761010 Ga0157375_107610102 122
229 3300013308 Ga0157375_12798343 Ga0157375_127983431 122
230 3300014325 Ga0163163_13185109 Ga0163163_131851092 122
231 3300014325 Ga0163163_13220110 Ga0163163_132201101 122
232 3300014326 Ga0157380_10104562 Ga0157380_101045622 122
233 3300014745 Ga0157377_10018344 Ga0157377_100183444 122
234 3300014968 Ga0157379_10030193 Ga0157379_100301932 122
235 3300017792 Ga0163161_10035189 Ga0163161_100351893 122
236 3300020082 Ga0206353_10949970 Ga0206353_109499703 122
237 3300020610 Ga0154015_1569223 Ga0154015_15692231 122
238 3300025321 Ga0207656_10113179 Ga0207656_101131792 122
239 3300025898 Ga0207692_10029476 Ga0207692_100294762 122
240 3300025899 Ga0207642_10056707 Ga0207642_100567072 122
241 3300025901 Ga0207688_10001523 Ga0207688_1000152310 122
242 3300025901 Ga0207688_10534302 Ga0207688_105343022 122
243 3300025903 Ga0207680_10415171 Ga0207680_104151712 122
244 3300025904 Ga0207647_10161401 Ga0207647_101614012 122
245 3300025906 Ga0207699_10099037 Ga0207699_100990372 122
246 3300025907 Ga0207645_10541089 Ga0207645_105410892 122
247 3300025909 Ga0207705_10387340 Ga0207705_103873402 122
248 3300025911 Ga0207654_10331458 Ga0207654_103314582 122
249 3300025912 Ga0207707_10095204 Ga0207707_100952042 122
250 3300025913 Ga0207695_10862033 Ga0207695_108620331 122
251 3300025914 Ga0207671_10294098 Ga0207671_102940982 122
252 3300025914 Ga0207671_10323095 Ga0207671_103230952 122
253 3300025915 Ga0207693_10001955 Ga0207693_1000195515 122
254 3300025916 Ga0207663_10034783 Ga0207663_100347832 122
255 3300025917 Ga0207660_10166892 Ga0207660_101668922 122
256 3300025919 Ga0207657_10967818 Ga0207657_109678181 122
257 3300025920 Ga0207649_10520202 Ga0207649_105202022 122
258 3300025921 Ga0207652_10099136 Ga0207652_100991362 122
259 3300025921 Ga0207652_10330317 Ga0207652_103303173 122
260 3300025924 Ga0207694_10189999 Ga0207694_101899992 122
261 3300025924 Ga0207694_10383919 Ga0207694_103839192 122
262 3300025924 Ga0207694_11030985 Ga0207694_110309852 122
263 3300025926 Ga0207659_11108527 Ga0207659_111085272 122
264 3300025927 Ga0207687_10566275 Ga0207687_105662752 122
265 3300025928 Ga0207700_11195570 Ga0207700_111955702 122
266 3300025932 Ga0207690_10115437 Ga0207690_101154372 122
267 3300025932 Ga0207690_10134138 Ga0207690_101341382 122
268 3300025933 Ga0207706_10085190 Ga0207706_100851903 122
269 3300025934 Ga0207686_10074514 Ga0207686_100745142 122
270 3300025935 Ga0207709_10218134 Ga0207709_102181342 122
271 3300025935 Ga0207709_10926438 Ga0207709_109264381 122
272 3300025936 Ga0207670_10061448 Ga0207670_100614482 122
273 3300025939 Ga0207665_10011601 Ga0207665_100116013 122
274 3300025940 Ga0207691_10030047 Ga0207691_100300472 122
275 3300025941 Ga0207711_10420947 Ga0207711_104209472 122
276 3300025942 Ga0207689_10005173 Ga0207689_100051733 122
277 3300025944 Ga0207661_10539647 Ga0207661_105396472 122
278 3300025945 Ga0207679_10040454 Ga0207679_100404544 122
279 3300025949 Ga0207667_10145631 Ga0207667_101456315 122
280 3300025960 Ga0207651_10321236 Ga0207651_103212362 122
281 3300025972 Ga0207668_10078902 Ga0207668_100789022 122
282 3300025981 Ga0207640_10160362 Ga0207640_101603622 122
283 3300026023 Ga0207677_10214307 Ga0207677_102143072 122
284 3300026023 Ga0207677_11274900 Ga0207677_112749002 122
285 3300026035 Ga0207703_10027818 Ga0207703_100278183 122
286 3300026041 Ga0207639_10528108 Ga0207639_105281082 122
287 3300026067 Ga0207678_10008563 Ga0207678_100085633 122
288 3300026067 Ga0207678_10009394 Ga0207678_100093947 122
289 3300026078 Ga0207702_10432684 Ga0207702_104326841 122
290 3300026078 Ga0207702_10853145 Ga0207702_108531451 122
291 3300026089 Ga0207648_10007446 Ga0207648_100074462 122
292 3300026095 Ga0207676_10745281 Ga0207676_107452812 122
293 3300026116 Ga0207674_10561681 Ga0207674_105616812 122
294 3300026118 Ga0207675_100044232 Ga0207675_1000442322 122
295 3300026121 Ga0207683_10023060 Ga0207683_100230604 122
296 3300026142 Ga0207698_10088301 Ga0207698_100883011 122
297 3300028380 Ga0268265_10358782 Ga0268265_103587822 122
298 3300031548 Ga0307408_100123294 Ga0307408_1001232942 122
299 3300031731 Ga0307405_10195518 Ga0307405_101955182 122
300 3300031731 Ga0307405_11502384 Ga0307405_115023841 122
301 3300031852 Ga0307410_10632904 Ga0307410_106329042 122
302 3300031903 Ga0307407_10004187 Ga0307407_100041876 122
303 3300031911 Ga0307412_10031546 Ga0307412_100315463 122
304 3300031995 Ga0307409_100039049 Ga0307409_1000390494 122
305 3300032002 Ga0307416_100190734 Ga0307416_1001907342 122
306 3300032005 Ga0307411_10460332 Ga0307411_104603322 122
307 3300032126 Ga0307415_101098196 Ga0307415_1010981962 122
308 3300034816 Ga0373930_0065748 Ga0373930_0065748_392_760 122
309 3300035084 Ga0373928_0073019 Ga0373928_0073019_302_670 122
310 3300035085 Ga0373929_0038535 Ga0373929_0038535_296_664 122
311 3300035086 Ga0373934_0409437 Ga0373934_0409437_10_378 122
312 3300035090 Ga0373949_0020953 Ga0373949_0020953_42_410 122
313 3300035091 Ga0373951_0020382 Ga0373951_0020382_819_1187 122
314 3300035092 Ga0373952_0153743 Ga0373952_0153743_194_562 122
315 3300035112 Ga0373932_0078366 Ga0373932_0078366_558_926 122
316 3300035113 Ga0373936_0005442 Ga0373936_0005442_2831_3199 122
317 3300035115 Ga0373941_0218768 Ga0373941_0218768_329_697 122
318 3300035119 Ga0373956_0399973 Ga0373956_0399973_116_484 122
319 3300035172 Ga0373955_0597378 Ga0373955_0597378_155_523 122
320 3300035207 Ga0373942_0010905 Ga0373942_0010905_316_684 122
321 3300035241 Ga0373961_0156357 Ga0373961_0156357_243_611 122
322 3300035242 Ga0373962_0044952 Ga0373962_0044952_329_697 122
323 3300035410 Ga0373924_0251226 Ga0373924_0251226_19_390 122
324 3300035691 Ga0373931_0011469 Ga0373931_0011469_984_1352 122
325 3300036401 Ga0373937_0122318 Ga0373937_0122318_1705_2073 122
326 3300036401 Ga0373937_0258624 Ga0373937_0258624_927_1298 122
327 3300037068 Ga0373925_0284100 Ga0373925_0284100_119_490 122
328 3300037418 Ga0395900_0457970 Ga0395900_0457970_267_635 122
329 3300037418 Ga0395900_0582008 Ga0395900_0582008_557_928 122
330 3300037466 Ga0395898_0694429 Ga0395898_0694429_231_602 122
331 3300037471 Ga0395905_0294845 Ga0395905_0294845_250_618 122
332 3300038443 Ga0395901_1106272 Ga0395901_1106272_206_574 122
333 3300038443 Ga0395901_1137471 Ga0395901_1137471_358_729 122
334 3300038443 Ga0395901_1610296 Ga0395901_1610296_153_521 122
335 3300039450 Ga0436363_0523583 Ga0436363_0523583_794_1162 122
336 3300041405 Ga0439438_125233 Ga0439438_125233_71_439 122
337 3300041451 Ga0451791_1633871 Ga0451791_1633871_864_1232 122
338 3300041494 Ga0451837_0552862 Ga0451837_0552862_102_470 122
339 3300041496 Ga0451839_0244655 Ga0451839_0244655_274_642 122
340 3300041509 Ga0451843_1335543 Ga0451843_1335543_103_471 122
341 3300042002 Ga0439442_052864 Ga0439442_052864_98_466 122
342 3300042137 Ga0450902_048437 Ga0450902_048437_252_623 122
343 3300044658 Ga0466972_0041339 Ga0466972_0041339_97_465 122
344 3300044706 Ga0466964_0610722 Ga0466964_0610722_74_442 122
345 3300044765 Ga0466970_0058993 Ga0466970_0058993_1083_1451 122
346 3300044901 Ga0466960_0145917 Ga0466960_0145917_443_811 122
347 3300045976 Ga0466967_0036154 Ga0466967_0036154_2832_3200 122
348 3300045976 Ga0466967_0090760 Ga0466967_0090760_284_652 122
349 3300045976 Ga0466967_1163456 Ga0466967_1163456_209_577 122
350 3300046462 Ga0495651_0051325 Ga0495651_0051325_844_1212 122
351 3300046475 Ga0495639_0553010 Ga0495639_0553010_75_443 122
352 3300046511 Ga0495608_0216591 Ga0495608_0216591_751_1122 122
353 3300046511 Ga0495608_0374634 Ga0495608_0374634_89_457 122
354 3300046516 Ga0495628_0620568 Ga0495628_0620568_376_747 122
355 3300046529 Ga0495652_0267960 Ga0495652_0267960_454_822 122
356 3300046559 Ga0495667_0013035 Ga0495667_0013035_447_815 122
357 3300046559 Ga0495667_0206380 Ga0495667_0206380_678_1049 122
358 3300046675 Ga0495657_0715820 Ga0495657_0715820_73_444 122
359 3300046678 Ga0495599_0000929 Ga0495599_0000929_5109_5480 122
360 3300046680 Ga0495646_0425432 Ga0495646_0425432_287_655 122
361 3300046681 Ga0495647_0307408 Ga0495647_0307408_93_461 122
362 3300047319 Ga0495674_0976782 Ga0495674_0976782_78_446 122
363 3300047322 Ga0495680_0089083 Ga0495680_0089083_853_1224 122
364 3300047322 Ga0495680_0116717 Ga0495680_0116717_414_782 122
365 3300047471 Ga0495684_0074621 Ga0495684_0074621_1205_1573 122
366 3300048088 Ga0495602_0176182 Ga0495602_0176182_47_415 122
367 3300048903 Ga0496100_0293961 Ga0496100_0293961_783_1154 122
368 3300048903 Ga0496100_0700422 Ga0496100_0700422_63_431 122
369 3300048904 Ga0496101_0263206 Ga0496101_0263206_517_885 122
370 3300048904 Ga0496101_0576969 Ga0496101_0576969_416_784 122
371 3300048905 Ga0496102_0177260 Ga0496102_0177260_922_1290 122
372 3300048905 Ga0496102_0388686 Ga0496102_0388686_587_955 122
373 3300048905 Ga0496102_0518873 Ga0496102_0518873_101_472 122
374 3300048905 Ga0496102_0748158 Ga0496102_0748158_105_473 122
375 3300048906 Ga0496103_0041943 Ga0496103_0041943_485_853 122
376 3300048906 Ga0496103_0890315 Ga0496103_0890315_34_402 122
377 3300048907 Ga0496104_0077091 Ga0496104_0077091_1697_2065 122
378 3300048907 Ga0496104_0842440 Ga0496104_0842440_333_704 122
379 3300048908 Ga0496105_0100475 Ga0496105_0100475_434_802 122
380 3300048908 Ga0496105_0351791 Ga0496105_0351791_227_598 122
381 3300048908 Ga0496105_0531388 Ga0496105_0531388_65_433 122
382 3300048910 Ga0496107_0286762 Ga0496107_0286762_746_1114 122
383 3300048910 Ga0496107_0397018 Ga0496107_0397018_254_622 122
384 3300048911 Ga0496108_0002496 Ga0496108_0002496_11476_11844 122
385 3300048911 Ga0496108_0335417 Ga0496108_0335417_828_1196 122
386 3300048911 Ga0496108_0358636 Ga0496108_0358636_72_443 122
387 3300048911 Ga0496108_1031199 Ga0496108_1031199_201_569 122
388 3300048912 Ga0496109_0002371 Ga0496109_0002371_2338_2706 122
389 3300048912 Ga0496109_0018642 Ga0496109_0018642_5610_5981 122
390 3300048912 Ga0496109_0034856 Ga0496109_0034856_431_799 122
391 3300048912 Ga0496109_0821915 Ga0496109_0821915_19_387 122
392 3300048913 Ga0496110_0147509 Ga0496110_0147509_966_1334 122
393 3300048913 Ga0496110_0768475 Ga0496110_0768475_264_632 122
394 3300048914 Ga0496111_0317796 Ga0496111_0317796_297_665 122
395 3300048915 Ga0496112_0005930 Ga0496112_0005930_1309_1677 122
396 3300048915 Ga0496112_0120307 Ga0496112_0120307_442_810 122
397 3300048915 Ga0496112_0149107 Ga0496112_0149107_632_1000 122
398 3300048915 Ga0496112_1143603 Ga0496112_1143603_101_472 122
399 3300048916 Ga0496113_0012945 Ga0496113_0012945_823_1191 122
400 3300048916 Ga0496113_0133589 Ga0496113_0133589_1182_1550 122
401 3300048916 Ga0496113_0278190 Ga0496113_0278190_38_409 122
402 3300048917 Ga0496114_0057585 Ga0496114_0057585_1765_2133 122
403 3300048917 Ga0496114_0357718 Ga0496114_0357718_416_784 122
404 3300048917 Ga0496114_0419974 Ga0496114_0419974_791_1162 122
405 3300048918 Ga0496115_0040837 Ga0496115_0040837_1091_1459 122
406 3300048918 Ga0496115_0134301 Ga0496115_0134301_1021_1389 122
407 3300049568 Ga0501031_0862823 Ga0501031_0862823_43_420 122
408 3300049572 Ga0501036_0247691 Ga0501036_0247691_388_765 122
409 3300049577 Ga0501041_0129986 Ga0501041_0129986_649_1026 122
410 3300049581 Ga0501047_0594819 Ga0501047_0594819_427_795 122
411 3300049582 Ga0501048_0696226 Ga0501048_0696226_338_715 122
412 3300049583 Ga0501067_0215128 Ga0501067_0215128_384_752 122
413 3300049585 Ga0501069_0444695 Ga0501069_0444695_329_697 122
414 3300049591 Ga0501075_1228193 Ga0501075_1228193_31_408 122
415 3300049823 Ga0501044_1121301 Ga0501044_1121301_101_469 122
416 3300049824 Ga0501045_0136170 Ga0501045_0136170_208_585 122
417 3300050489 nmdc:mga03683_539792_c1 nmdc:mga03683_539792_c1_163_531 122
418 3300050490 nmdc:mga03n38_219729_c1 nmdc:mga03n38_219729_c1_400_768 122
419 3300050491 nmdc:mga00v17_49605_c1 nmdc:mga00v17_49605_c1_610_978 122
420 3300050492 nmdc:mga0yw44_391572_c1 nmdc:mga0yw44_391572_c1_201_569 122
421 3300050492 nmdc:mga0yw44_95779_c1 nmdc:mga0yw44_95779_c1_1446_1814 122
422 3300050494 nmdc:mga06z11_179864_c1 nmdc:mga06z11_179864_c1_717_1085 122
423 3300050516 nmdc:mga0sz30_54888_c1 nmdc:mga0sz30_54888_c1_610_978 122
424 3300053077 Ga0495601_0501896 Ga0495601_0501896_156_527 122
425 3300053084 Ga0495595_0014325 Ga0495595_0014325_2060_2431 122
426 3300053084 Ga0495595_0284315 Ga0495595_0284315_162_530 122

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rmr-assembly2.cif.gz_B crystal structure of hyaloperonospora arabidopsidis atr1 effector domain 0.6175 77 116
3rmr-assembly1.cif.gz_A crystal structure of hyaloperonospora arabidopsidis atr1 effector domain 0.6138 77 116
5x5l-assembly1.cif.gz_E crystal structure of response regulator ader dna binding domain in complex with an intercistronic region 0.5905 82 116
5x5l-assembly1.cif.gz_A crystal structure of response regulator ader dna binding domain in complex with an intercistronic region 0.586 82 114
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.5535 77 111
ID Description Score Start End Superfamily
af_I1M6L1_1_137_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7373 76 114 1.20.58.70
af_Q5A7P2_449_801_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6653 88 114 3.60.15.10
af_O17816_1_365_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6246 76 113 1.20.1070.10
4oydD00 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.6174 76 114 1.10.132.20
3uz3E02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.6098 78 114 1.10.287.610
ID Description Score Start End GO Terms
AF-A0A2W4NJ42-F1-model_v4 Uncharacterized protein 0.962 72 122
AF-A0A1H6EZK4-F1-model_v4 Uncharacterized protein 0.9569 1 121
AF-A0A5M3WAZ9-F1-model_v4 Uncharacterized protein 0.9546 2 121
AF-A0A1I3K9G5-F1-model_v4 Uncharacterized protein 0.9531 2 121
AF-A0A2K3JD89-F1-model_v4 Prohead serine protease domain-containing protein 0.952 2 122

Feature Viewer

pLDDT pTM Quality
91.31 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map