F441383

General Info

Members Datasets Scaffolds Average Seq Length
427 186 425 414

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10000929|Ga0070676_1000092916
Length 446
Sequence MARRSRAELAEYKRAPSGDTGRVLMSVPRPATGDLAASASRAEPESAYAWTRLFVALTLSAIGGVGMWSVIVALPAVQAEFGVARSAATLPYTATMICFGLGAILTGRLSDRVGIMRPVVAGAVSLGVGYALASQATTLWQFILTQGLIVGVAGSVTFAPLVADTSLWFTRRRGIAVAIIASGSYLAGTIWPPVVQYFIQAQGWRRTYVGIAIFCVVTMLPLSLVLRRRSPLTGTVTASASTGAGSWPLRPLGMSPAALQTVLVIAGLSCCVAMSMPQVHIVAYSADLGHGAARGAQMLSLMLAGGIVSRLVSGWVCDRIGGRRTLLLGSSLQALALVLFLPFDGLASLYVVSVLFGLFQGGIVPSYAVIIREFFPPSEAGLRVSTVLTATVFGMALGGWMTGMIFDLTGSYQAAFVNGILWNLLNIGIAVGLLRQPGRPVQEAWR

Samples

Sample ID Description Type Environment
1 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
125 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.7
Rhizosphere 97.42
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26141J51220_1000358 3300003503 Bacteria 2452
2 Ga0070676_10000929 3300005328 Bacteria 14505
3 Ga0070670_100040498 3300005331 Bacteria 4005
4 Ga0068869_100002616 3300005334 Bacteria 10866
5 Ga0068869_100196422 3300005334 Bacteria 1589
6 Ga0070680_100019470 3300005336 Bacteria 5378
7 Ga0070680_100066832 3300005336 Bacteria 2949
8 Ga0070682_100002851 3300005337 Bacteria 9587
9 Ga0070660_100000970 3300005339 Bacteria 19181
10 Ga0070689_100048350 3300005340 Bacteria 3281
11 Ga0070691_10001273 3300005341 Bacteria 10649
12 Ga0070661_100004743 3300005344 Bacteria 9350
13 Ga0070692_10008016 3300005345 Bacteria 4688
14 Ga0070673_100010542 3300005364 Bacteria 6259
15 Ga0070659_100000818 3300005366 Bacteria 22732
16 Ga0070703_10002634 3300005406 Bacteria 5161
17 Ga0070701_10052164 3300005438 Bacteria 2123
18 Ga0070705_100001408 3300005440 Bacteria 12726
19 Ga0070705_100009258 3300005440 Bacteria 4892
20 Ga0070700_100084403 3300005441 Bacteria 2058
21 Ga0070694_100011016 3300005444 Bacteria 5594
22 Ga0070708_100128037 3300005445 Bacteria 2348
23 Ga0070663_100001424 3300005455 Bacteria 13094
24 Ga0070662_100005438 3300005457 Bacteria 8134
25 Ga0070662_100126074 3300005457 Bacteria 1968
26 Ga0070662_100172801 3300005457 Bacteria 1698
27 Ga0070681_10077136 3300005458 Bacteria 3290
28 Ga0068867_100021346 3300005459 Bacteria 4620
29 Ga0070706_100171292 3300005467 Bacteria 2027
30 Ga0070706_100195707 3300005467 Bacteria 1888
31 Ga0070706_100293767 3300005467 Bacteria 1516
32 Ga0070707_100022319 3300005468 Bacteria 5983
33 Ga0070707_100102264 3300005468 Bacteria 2776
34 Ga0070707_100210867 3300005468 Bacteria 1893
35 Ga0070698_100013819 3300005471 Bacteria 8541
36 Ga0070698_100034823 3300005471 Bacteria 5209
37 Ga0070698_100076475 3300005471 Bacteria 3349
38 Ga0070698_100212574 3300005471 Bacteria 1868
39 Ga0070699_100012203 3300005518 Bacteria 7414
40 Ga0070699_100029770 3300005518 Bacteria 4709
41 Ga0070679_100004451 3300005530 Bacteria 12943
42 Ga0070697_100002828 3300005536 Bacteria 13350
43 Ga0070697_100011641 3300005536 Bacteria 6875
44 Ga0070697_100021738 3300005536 Bacteria 5085
45 Ga0068853_100003042 3300005539 Bacteria 12807
46 Ga0070695_100005633 3300005545 Bacteria 7380
47 Ga0070695_100007566 3300005545 Bacteria 6436
48 Ga0070695_100027140 3300005545 Bacteria 3545
49 Ga0070696_100021441 3300005546 Bacteria 4380
50 Ga0070696_100160010 3300005546 Bacteria 1658
51 Ga0070696_100197214 3300005546 Bacteria 1501
52 Ga0070693_100000604 3300005547 Bacteria 15892
53 Ga0070704_100000528 3300005549 Bacteria 18308
54 Ga0070704_100001625 3300005549 Bacteria 12182
55 Ga0070704_100020574 3300005549 Bacteria 4258
56 Ga0070704_100088685 3300005549 Bacteria 2299
57 Ga0068855_100004425 3300005563 Bacteria 17170
58 Ga0070664_100048211 3300005564 Bacteria 3600
59 Ga0068857_100252090 3300005577 Bacteria 1618
60 Ga0068854_100027569 3300005578 Bacteria 3916
61 Ga0068856_100002103 3300005614 Bacteria 20655
62 Ga0068852_100193240 3300005616 Bacteria 1922
63 Ga0068859_100021420 3300005617 Bacteria 6488
64 Ga0068859_100230529 3300005617 Bacteria 1940
65 Ga0068870_10000542 3300005840 Bacteria 14287
66 Ga0068870_10032965 3300005840 Bacteria 2639
67 Ga0068858_100018450 3300005842 Bacteria 6532
68 Ga0068858_100041616 3300005842 Bacteria 4259
69 Ga0068860_100009397 3300005843 Bacteria 9717
70 Ga0068860_100014432 3300005843 Bacteria 7739
71 Ga0068862_100004918 3300005844 Bacteria 11254
72 Ga0068862_100100930 3300005844 Bacteria 2524
73 Ga0068862_100123368 3300005844 Bacteria 2285
74 Ga0081455_10000060 3300005937 Bacteria 119012
75 Ga0081538_10027233 3300005981 Bacteria 3970
76 Ga0081540_1021441 3300005983 Bacteria 3845
77 Ga0081539_10000271 3300005985 Bacteria 118902
78 Ga0075362_10000550 3300006177 Bacteria 10909
79 Ga0075362_10023505 3300006177 Bacteria 2607
80 Ga0075428_100000367 3300006844 Bacteria 44787
81 Ga0075428_100003078 3300006844 Bacteria 18193
82 Ga0075428_100031753 3300006844 Bacteria 5834
83 Ga0075428_100058488 3300006844 Bacteria 4221
84 Ga0075428_100210101 3300006844 Bacteria 2103
85 Ga0075428_100365603 3300006844 Bacteria 1547
86 Ga0075430_100000034 3300006846 Bacteria 70046
87 Ga0075430_100000036 3300006846 Bacteria 68655
88 Ga0075430_100008304 3300006846 Bacteria 8770
89 Ga0075430_100010413 3300006846 Bacteria 7873
90 Ga0075431_100004963 3300006847 Bacteria 13091
91 Ga0075431_100005295 3300006847 Bacteria 12717
92 Ga0075431_100011834 3300006847 Bacteria 8803
93 Ga0075431_100016278 3300006847 Bacteria 7545
94 Ga0075431_100016368 3300006847 Bacteria 7525
95 Ga0075431_100022483 3300006847 Bacteria 6447
96 Ga0075431_100134314 3300006847 Bacteria 2551
97 Ga0075431_100272085 3300006847 Bacteria 1716
98 Ga0075431_100433953 3300006847 Bacteria 1311
99 Ga0075433_10004051 3300006852 Bacteria 11347
100 Ga0075433_10004993 3300006852 Bacteria 10391
101 Ga0075433_10005364 3300006852 Bacteria 10068
102 Ga0075433_10013843 3300006852 Bacteria 6576
103 Ga0075433_10018223 3300006852 Bacteria 5831
104 Ga0075433_10034878 3300006852 Bacteria 4324
105 Ga0075433_10094382 3300006852 Bacteria 2648
106 Ga0075434_100008611 3300006871 Bacteria 9498
107 Ga0075434_100008750 3300006871 Bacteria 9419
108 Ga0075434_100034755 3300006871 Bacteria 4980
109 Ga0075434_100047386 3300006871 Bacteria 4265
110 Ga0075434_100199011 3300006871 Bacteria 2023
111 Ga0075429_100000001 3300006880 Bacteria 139031
112 Ga0075429_100001056 3300006880 Bacteria 22010
113 Ga0075429_100002334 3300006880 Bacteria 15949
114 Ga0075429_100002639 3300006880 Bacteria 15096
115 Ga0075429_100002691 3300006880 Bacteria 14967
116 Ga0075429_100018153 3300006880 Bacteria 6088
117 Ga0075429_100034004 3300006880 Bacteria 4429
118 Ga0075429_100148668 3300006880 Bacteria 2051
119 Ga0068865_100151482 3300006881 Bacteria 1760
120 Ga0075436_100021544 3300006914 Bacteria 4424
121 Ga0075436_100150047 3300006914 Bacteria 1640
122 Ga0097620_100021418 3300006931 Bacteria 6488
123 Ga0097620_100230545 3300006931 Bacteria 1940
124 Ga0075435_100011162 3300007076 Bacteria 6590
125 Ga0075435_100023910 3300007076 Bacteria 4734
126 Ga0075435_100058071 3300007076 Bacteria 3132
127 Ga0111539_10000939 3300009094 Bacteria 38168
128 Ga0111539_10008443 3300009094 Bacteria 13103
129 Ga0111539_10017094 3300009094 Bacteria 8978
130 Ga0114129_10000383 3300009147 Bacteria 51440
131 Ga0114129_10004221 3300009147 Bacteria 20302
132 Ga0114129_10006949 3300009147 Bacteria 16100
133 Ga0114129_10010980 3300009147 Bacteria 12903
134 Ga0114129_10010996 3300009147 Bacteria 12895
135 Ga0114129_10014487 3300009147 Bacteria 11237
136 Ga0114129_10040324 3300009147 Bacteria 6582
137 Ga0114129_10048550 3300009147 Bacteria 5964
138 Ga0114129_10050641 3300009147 Bacteria 5833
139 Ga0114129_10054182 3300009147 Bacteria 5624
140 Ga0114129_10069011 3300009147 Bacteria 4927
141 Ga0114129_10074495 3300009147 Bacteria 4729
142 Ga0114129_10081369 3300009147 Bacteria 4501
143 Ga0114129_10135959 3300009147 Bacteria 3372
144 Ga0114129_10629457 3300009147 Bacteria 1387
145 Ga0105243_10005129 3300009148 Bacteria 10272
146 Ga0105241_10001791 3300009174 Bacteria 16319
147 Ga0105242_10000761 3300009176 Bacteria 25021
148 Ga0105242_10040751 3300009176 Bacteria 3743
149 Ga0105248_10108298 3300009177 Bacteria 3133
150 Ga0105249_10073599 3300009553 Bacteria 3161
151 Ga0105246_10028078 3300011119 Bacteria 3694
152 Ga0157373_10001444 3300013100 Bacteria 18151
153 Ga0157369_10029073 3300013105 Bacteria 6110
154 Ga0157372_10001335 3300013307 Bacteria 26660
155 Ga0157372_10030918 3300013307 Bacteria 5859
156 Ga0207653_10002762 3300025885 Bacteria 5584
157 Ga0207645_10001090 3300025907 Bacteria 22399
158 Ga0207643_10000057 3300025908 Bacteria 73664
159 Ga0207684_10005716 3300025910 Bacteria 11425
160 Ga0207684_10196240 3300025910 Bacteria 1741
161 Ga0207684_10236563 3300025910 Bacteria 1576
162 Ga0207707_10001689 3300025912 Bacteria 20305
163 Ga0207660_10001714 3300025917 Bacteria 14711
164 Ga0207657_10001291 3300025919 Bacteria 26609
165 Ga0207652_10001723 3300025921 Bacteria 19088
166 Ga0207646_10012746 3300025922 Bacteria 8062
167 Ga0207646_10024873 3300025922 Bacteria 5480
168 Ga0207646_10031885 3300025922 Bacteria 4770
169 Ga0207646_10388871 3300025922 Bacteria 1260
170 Ga0207681_10061711 3300025923 Bacteria 2578
171 Ga0207650_10022059 3300025925 Bacteria 4507
172 Ga0207706_10007276 3300025933 Bacteria 10234
173 Ga0207706_10030517 3300025933 Bacteria 4808
174 Ga0207706_10145410 3300025933 Bacteria 2085
175 Ga0207686_10008264 3300025934 Bacteria 5614
176 Ga0207704_10139409 3300025938 Bacteria 1694
177 Ga0207711_10049364 3300025941 Bacteria 3603
178 Ga0207689_10001050 3300025942 Bacteria 26544
179 Ga0207679_10005417 3300025945 Bacteria 7993
180 Ga0207667_10003708 3300025949 Bacteria 18845
181 Ga0207651_10075930 3300025960 Bacteria 2400
182 Ga0207668_10028956 3300025972 Bacteria 3627
183 Ga0207640_10077234 3300025981 Bacteria 2263
184 Ga0207703_10018488 3300026035 Bacteria 5442
185 Ga0207639_10004062 3300026041 Bacteria 9871
186 Ga0207678_10004163 3300026067 Bacteria 12985
187 Ga0207708_10122026 3300026075 Bacteria 2031
188 Ga0207648_10080970 3300026089 Bacteria 2833
189 Ga0207674_10002538 3300026116 Bacteria 23000
190 Ga0207674_10008145 3300026116 Bacteria 12150
191 Ga0207675_100016827 3300026118 Bacteria 6832
192 Ga0207698_10136000 3300026142 Bacteria 2109
193 Ga0209968_1000240 3300027526 Bacteria 9432
194 Ga0209983_1000855 3300027665 Bacteria 6700
195 Ga0209971_1000376 3300027682 Bacteria 12232
196 Ga0209966_1000586 3300027695 Bacteria 8822
197 Ga0209998_10000117 3300027717 Bacteria 31452
198 Ga0209974_10002797 3300027876 Bacteria 6329
199 Ga0207428_10001049 3300027907 Bacteria 30412
200 Ga0207428_10002070 3300027907 Bacteria 20243
201 Ga0268265_10004815 3300028380 Bacteria 9305
202 Ga0268265_10033813 3300028380 Bacteria 3720
203 Ga0307515_10072272 3300028794 Bacteria 4659
204 Ga0307513_10083149 3300031456 Bacteria 3293
205 Ga0307408_100065280 3300031548 Bacteria 2669
206 Ga0307407_10011699 3300031903 Bacteria 4190
207 Ga0307416_100408409 3300032002 Bacteria 1398
208 Ga0373948_0009506 3300034817 Bacteria 1678
209 Ga0373961_0026473 3300035241 Bacteria 1585
210 Ga0373931_0099630 3300035691 Bacteria 1632
211 Ga0373927_0116767 3300035695 Bacteria 1740
212 Ga0395899_0007332 3300037312 Bacteria 8532
213 Ga0395900_0030228 3300037418 Bacteria 5561
214 Ga0395898_0039128 3300037466 Bacteria 4695
215 Ga0395905_0174102 3300037471 Bacteria 2021
216 Ga0395901_0005260 3300038443 Bacteria 13072
217 Ga0439441_008931 3300042001 Bacteria 1649
218 Ga0439456_005721 3300042013 Bacteria 2527
219 Ga0439458_0001784 3300042157 Bacteria 5359
220 Ga0439460_0001583 3300042461 Bacteria 5387
221 Ga0451577_0012743 3300042876 Bacteria 7887
222 Ga0451577_0026336 3300042876 Bacteria 5268
223 Ga0453683_0052965 3300044673 Bacteria 2540
224 Ga0453684_0008187 3300044712 Bacteria 18852
225 Ga0453684_0160155 3300044712 Bacteria 2663
226 Ga0453684_0418884 3300044712 Bacteria 1496
227 Ga0451576_0027219 3300045051 Bacteria 6143
228 Ga0451576_0036385 3300045051 Bacteria 5218
229 Ga0451576_0069126 3300045051 Bacteria 3675
230 Ga0451576_0071880 3300045051 Bacteria 3600
231 Ga0451576_0095008 3300045051 Bacteria 3101
232 Ga0451576_0114148 3300045051 Bacteria 2812
233 Ga0495580_0005148 3300046472 Bacteria 10877
234 Ga0495662_0020723 3300046476 Bacteria 3180
235 Ga0495630_0013500 3300046517 Bacteria 5940
236 Ga0495586_0068059 3300046535 Bacteria 1942
237 Ga0495634_0130220 3300046642 Bacteria 1604
238 Ga0495635_0143434 3300046663 Bacteria 1626
239 Ga0495624_0073469 3300046690 Bacteria 2126
240 Ga0495636_0004675 3300047318 Bacteria 5371
241 Ga0496102_0385716 3300048905 Bacteria 1318
242 Ga0496110_0116944 3300048913 Bacteria 2401
243 Ga0496112_0110515 3300048915 Bacteria 2719
244 Ga0501031_0014480 3300049568 Bacteria 5127
245 Ga0501032_0119094 3300049569 Bacteria 1746
246 Ga0501033_0016683 3300049570 Bacteria 5554
247 Ga0501033_0033235 3300049570 Bacteria 3873
248 Ga0501036_0000094 3300049572 Bacteria 55558
249 Ga0501036_0028511 3300049572 Bacteria 4717
250 Ga0501037_0012375 3300049573 Bacteria 6282
251 Ga0501037_0060578 3300049573 Bacteria 2761
252 Ga0501038_0001660 3300049574 Bacteria 20637
253 Ga0501038_0008917 3300049574 Bacteria 9202
254 Ga0501039_0001935 3300049575 Bacteria 15343
255 Ga0501039_0029090 3300049575 Bacteria 4255
256 Ga0501039_0040484 3300049575 Bacteria 3598
257 Ga0501039_0048117 3300049575 Bacteria 3296
258 Ga0501040_0000163 3300049576 Bacteria 37302
259 Ga0501040_0002278 3300049576 Bacteria 12335
260 Ga0501040_0099425 3300049576 Bacteria 2028
261 Ga0501041_0000062 3300049577 Bacteria 40482
262 Ga0501041_0020075 3300049577 Bacteria 3991
263 Ga0501041_0117189 3300049577 Bacteria 1654
264 Ga0501042_0000141 3300049578 Bacteria 31706
265 Ga0501042_0000424 3300049578 Bacteria 21414
266 Ga0501042_0013344 3300049578 Bacteria 5588
267 Ga0501042_0195435 3300049578 Bacteria 1459
268 Ga0501043_0004421 3300049579 Bacteria 11419
269 Ga0501046_0001548 3300049580 Bacteria 21972
270 Ga0501046_0002744 3300049580 Bacteria 16392
271 Ga0501046_0015294 3300049580 Bacteria 6453
272 Ga0501046_0108186 3300049580 Bacteria 2126
273 Ga0501047_0218846 3300049581 Bacteria 1761
274 Ga0501047_0227170 3300049581 Bacteria 1721
275 Ga0501048_0014617 3300049582 Bacteria 5810
276 Ga0501048_0053290 3300049582 Bacteria 2877
277 Ga0501048_0071386 3300049582 Bacteria 2451
278 Ga0501048_0086625 3300049582 Bacteria 2209
279 Ga0501048_0096784 3300049582 Bacteria 2082
280 Ga0501068_0001798 3300049584 Bacteria 11402
281 Ga0501068_0087172 3300049584 Bacteria 1922
282 Ga0501069_0085625 3300049585 Bacteria 1779
283 Ga0501071_0000391 3300049587 Bacteria 21588
284 Ga0501071_0030721 3300049587 Bacteria 3801
285 Ga0501071_0052836 3300049587 Bacteria 2930
286 Ga0501071_0064628 3300049587 Bacteria 2655
287 Ga0501071_0112872 3300049587 Bacteria 2009
288 Ga0501071_0227877 3300049587 Bacteria 1403
289 Ga0501072_0000069 3300049588 Bacteria 74196
290 Ga0501072_0003779 3300049588 Bacteria 11432
291 Ga0501072_0016181 3300049588 Bacteria 5721
292 Ga0501072_0070103 3300049588 Bacteria 2768
293 Ga0501074_0009878 3300049590 Bacteria 6932
294 Ga0501074_0142890 3300049590 Bacteria 1711
295 Ga0501074_0181544 3300049590 Bacteria 1501
296 Ga0501075_0002755 3300049591 Bacteria 11774
297 Ga0501075_0012856 3300049591 Bacteria 5961
298 Ga0501075_0025843 3300049591 Bacteria 4316
299 Ga0501075_0034183 3300049591 Bacteria 3784
300 Ga0501075_0070756 3300049591 Bacteria 2636
301 Ga0501075_0072340 3300049591 Bacteria 2606
302 Ga0501076_0000140 3300049592 Bacteria 41122
303 Ga0501076_0005700 3300049592 Bacteria 8981
304 Ga0501076_0006219 3300049592 Bacteria 8643
305 Ga0501076_0006932 3300049592 Bacteria 8232
306 Ga0501076_0013719 3300049592 Bacteria 6080
307 Ga0501076_0118602 3300049592 Bacteria 2142
308 Ga0501076_0165531 3300049592 Bacteria 1802
309 Ga0501077_0000870 3300049593 Bacteria 18238
310 Ga0501077_0018577 3300049593 Bacteria 4397
311 Ga0501077_0032881 3300049593 Bacteria 3303
312 Ga0501079_0000060 3300049741 Bacteria 49239
313 Ga0501079_0003567 3300049741 Bacteria 11447
314 Ga0501079_0005077 3300049741 Bacteria 9775
315 Ga0501079_0063520 3300049741 Bacteria 2848
316 Ga0501079_0143805 3300049741 Bacteria 1858
317 Ga0501079_0218391 3300049741 Bacteria 1489
318 Ga0501080_0001483 3300049742 Bacteria 19784
319 Ga0501080_0043368 3300049742 Bacteria 4189
320 Ga0501080_0092366 3300049742 Bacteria 2811
321 Ga0501080_0256085 3300049742 Bacteria 1595
322 Ga0501081_0000047 3300049743 Bacteria 45820
323 Ga0501081_0001528 3300049743 Bacteria 14206
324 Ga0501081_0009962 3300049743 Bacteria 6195
325 Ga0501081_0013201 3300049743 Bacteria 5432
326 Ga0501081_0029255 3300049743 Bacteria 3723
327 Ga0501081_0037629 3300049743 Bacteria 3302
328 Ga0501081_0155823 3300049743 Bacteria 1643
329 Ga0501081_0247583 3300049743 Bacteria 1300
330 Ga0501083_0016323 3300049744 Bacteria 5200
331 Ga0501083_0040397 3300049744 Bacteria 3167
332 Ga0501035_0032443 3300049822 Bacteria 4751
333 Ga0501045_0000004 3300049824 Bacteria 86792
334 Ga0501045_0002446 3300049824 Bacteria 12622
335 Ga0501045_0002923 3300049824 Bacteria 11681
336 Ga0501045_0017999 3300049824 Bacteria 5017
337 Ga0501045_0182609 3300049824 Bacteria 1563
338 nmdc:mga03683_707_c1 3300050489 Bacteria 9578
339 nmdc:mga03n38_70769_c1 3300050490 Bacteria 1614
340 nmdc:mga05p37_10648_c1 3300050507 Bacteria 10911
341 nmdc:mga05p37_10895_c1 3300050507 Bacteria 10797
342 nmdc:mga05p37_141_c1 3300050507 Bacteria 67555
343 nmdc:mga05p37_179638_c1 3300050507 Bacteria 2576
344 nmdc:mga05p37_202847_c1 3300050507 Bacteria 2401
345 nmdc:mga05p37_28229_c1 3300050507 Bacteria 6841
346 nmdc:mga05p37_3984_c1 3300050507 Bacteria 17275
347 nmdc:mga05p37_43350_c1 3300050507 Bacteria 5535
348 nmdc:mga05p37_53009_c1 3300050507 Bacteria 4989
349 nmdc:mga05p37_590_c1 3300050507 Bacteria 40000
350 nmdc:mga05p37_78757_c1 3300050507 Bacteria 4058
351 nmdc:mga05p37_88349_c1 3300050507 Bacteria 3820
352 nmdc:mga05p37_89401_c1 3300050507 Bacteria 3795
353 nmdc:mga05p37_98083_c2 3300050507 Bacteria 2730
354 nmdc:mga09592_132190_c1 3300050508 Bacteria 2148
355 nmdc:mga09592_143404_c1 3300050508 Bacteria 2059
356 nmdc:mga09592_145030_c1 3300050508 Bacteria 2047
357 nmdc:mga09592_15975_c1 3300050508 Bacteria 6134
358 nmdc:mga09592_191213_c1 3300050508 Bacteria 1772
359 nmdc:mga09592_1912_c1 3300050508 Bacteria 16750
360 nmdc:mga09592_23258_c1 3300050508 Bacteria 5118
361 nmdc:mga09592_24477_c1 3300050508 Bacteria 4994
362 nmdc:mga09592_2782_c1 3300050508 Bacteria 14166
363 nmdc:mga09592_41228_c1 3300050508 Bacteria 3881
364 nmdc:mga09592_66_c1 3300050508 Bacteria 59617
365 nmdc:mga0qj67_108970_c1 3300050509 Bacteria 2235
366 nmdc:mga0qj67_124730_c1 3300050509 Bacteria 2084
367 nmdc:mga0qj67_1580_c1 3300050509 Bacteria 16011
368 nmdc:mga0qj67_296359_c1 3300050509 Bacteria 1311
369 nmdc:mga06r32_1360_c1 3300050510 Bacteria 22084
370 nmdc:mga06r32_2324_c1 3300050510 Bacteria 17027
371 nmdc:mga06r32_30678_c1 3300050510 Bacteria 5046
372 nmdc:mga06r32_310507_c1 3300050510 Bacteria 1563
373 nmdc:mga06r32_3135_c1 3300050510 Bacteria 14812
374 nmdc:mga06r32_37150_c1 3300050510 Bacteria 4607
375 nmdc:mga06r32_4554_c1 3300050510 Bacteria 12419
376 nmdc:mga06r32_5075_c1 3300050510 Bacteria 11855
377 nmdc:mga06r32_5485_c1 3300050510 Bacteria 11422
378 nmdc:mga06r32_91661_c1 3300050510 Bacteria 2970
379 nmdc:mga08y16_118289_c1 3300050511 Bacteria 2758
380 nmdc:mga08y16_163096_c1 3300050511 Bacteria 2316
381 nmdc:mga08y16_290928_c1 3300050511 Bacteria 1684
382 nmdc:mga08y16_4496_c1 3300050511 Bacteria 14568
383 nmdc:mga08y16_56317_c1 3300050511 Bacteria 4110
384 nmdc:mga0n895_12043_c1 3300050512 Bacteria 7742
385 nmdc:mga0n895_17086_c1 3300050512 Bacteria 6680
386 nmdc:mga0n895_41594_c1 3300050512 Bacteria 4469
387 nmdc:mga0n895_5289_c1 3300050512 Bacteria 10751
388 nmdc:mga0n895_667_c1 3300050512 Bacteria 24029
389 nmdc:mga0n895_77342_c1 3300050512 Bacteria 3310
390 nmdc:mga0n895_89783_c1 3300050512 Bacteria 3074
391 nmdc:mga0rr50_6825_c1 3300050513 Bacteria 6995
392 nmdc:mga0rr50_84485_c1 3300050513 Bacteria 2458
393 nmdc:mga08x19_367_c1 3300050514 Bacteria 31883
394 nmdc:mga0a205_121352_c1 3300050515 Bacteria 2513
395 nmdc:mga0a205_1467_c1 3300050515 Bacteria 20121
396 nmdc:mga0a205_16321_c1 3300050515 Bacteria 6954
397 nmdc:mga0a205_34173_c1 3300050515 Bacteria 4878
398 nmdc:mga0a205_35649_c1 3300050515 Bacteria 4777
399 nmdc:mga0a205_3810_c1 3300050515 Bacteria 13516
400 nmdc:mga0a205_3942_c1 3300050515 Bacteria 13284
401 nmdc:mga0a205_9877_c1 3300050515 Bacteria 4824
402 Ga0495601_0057273 3300053077 Bacteria 2469
403 Ga0501084_0000507 3300054114 Bacteria 29821
404 Ga0501084_0007126 3300054114 Bacteria 9210
405 Ga0501084_0008785 3300054114 Bacteria 8358
406 Ga0501084_0021087 3300054114 Bacteria 5435
407 Ga0501084_0023228 3300054114 Bacteria 5177
408 Ga0501084_0031402 3300054114 Bacteria 4441
409 Ga0501084_0234166 3300054114 Bacteria 1550
410 Ga0501082_0000422 3300060353 Bacteria 37497
411 Ga0501082_0006080 3300060353 Bacteria 10478
412 Ga0501082_0023143 3300060353 Bacteria 5358
413 Ga0501082_0034256 3300060353 Bacteria 4379
414 Ga0501082_0037844 3300060353 Bacteria 4161
415 Ga0501082_0134208 3300060353 Bacteria 2148
416 Ga0501082_0204766 3300060353 Bacteria 1717
417 Ga0501082_0206736 3300060353 Bacteria 1708
418 Ga0530510_0000216 3300061734 Bacteria 35741
419 Ga0530510_0006906 3300061734 Bacteria 7916
420 Ga0530510_0023150 3300061734 Bacteria 4424
421 Ga0530510_0035069 3300061734 Bacteria 3615
422 Ga0530510_0037495 3300061734 Bacteria 3497
423 Ga0530510_0048997 3300061734 Bacteria 3053
424 Ga0530510_0093072 3300061734 Bacteria 2200
425 Ga0530510_0146650 3300061734 Bacteria 1741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_70769_c1 nmdc:mga03n38_70769_c1_26_1069 343
2 3300050507 nmdc:mga05p37_98083_c2 nmdc:mga05p37_98083_c2_22_1077 351
3 3300006871 Ga0075434_100047386 Ga0075434_1000473863 361
4 3300044712 Ga0453684_0418884 Ga0453684_0418884_344_1480 366
5 3300027907 Ga0207428_10001049 Ga0207428_100010499 367
6 3300028794 Ga0307515_10072272 Ga0307515_100722722 372
7 3300031456 Ga0307513_10083149 Ga0307513_100831494 374
8 3300005467 Ga0070706_100293767 Ga0070706_1002937671 377
9 3300005468 Ga0070707_100210867 Ga0070707_1002108672 377
10 3300005471 Ga0070698_100212574 Ga0070698_1002125742 377
11 3300005518 Ga0070699_100012203 Ga0070699_1000122032 377
12 3300025910 Ga0207684_10196240 Ga0207684_101962402 377
13 3300025922 Ga0207646_10012746 Ga0207646_100127462 377
14 3300005549 Ga0070704_100020574 Ga0070704_1000205744 378
15 3300009147 Ga0114129_10006949 Ga0114129_1000694912 378
16 3300049569 Ga0501032_0119094 Ga0501032_0119094_428_1660 378
17 3300049570 Ga0501033_0033235 Ga0501033_0033235_419_1651 378
18 3300049572 Ga0501036_0028511 Ga0501036_0028511_157_1389 378
19 3300049573 Ga0501037_0060578 Ga0501037_0060578_100_1332 378
20 3300049574 Ga0501038_0008917 Ga0501038_0008917_5982_7214 378
21 3300049575 Ga0501039_0048117 Ga0501039_0048117_763_1995 378
22 3300049576 Ga0501040_0002278 Ga0501040_0002278_5553_6785 378
23 3300049578 Ga0501042_0000424 Ga0501042_0000424_1463_2695 378
24 3300049579 Ga0501043_0004421 Ga0501043_0004421_4637_5869 378
25 3300049580 Ga0501046_0108186 Ga0501046_0108186_89_1321 378
26 3300049581 Ga0501047_0218846 Ga0501047_0218846_479_1711 378
27 3300049582 Ga0501048_0053290 Ga0501048_0053290_563_1795 378
28 3300049584 Ga0501068_0087172 Ga0501068_0087172_51_1283 378
29 3300049587 Ga0501071_0227877 Ga0501071_0227877_83_1315 378
30 3300049588 Ga0501072_0003779 Ga0501072_0003779_8447_9679 378
31 3300049590 Ga0501074_0009878 Ga0501074_0009878_3681_4913 378
32 3300049591 Ga0501075_0072340 Ga0501075_0072340_441_1673 378
33 3300049592 Ga0501076_0006932 Ga0501076_0006932_3607_4839 378
34 3300049741 Ga0501079_0003567 Ga0501079_0003567_4539_5771 378
35 3300049743 Ga0501081_0247583 Ga0501081_0247583_151_1287 378
36 3300049824 Ga0501045_0002923 Ga0501045_0002923_6918_8150 378
37 3300050507 nmdc:mga05p37_179638_c1 nmdc:mga05p37_179638_c1_762_1898 378
38 3300050508 nmdc:mga09592_15975_c1 nmdc:mga09592_15975_c1_1004_2140 378
39 3300050510 nmdc:mga06r32_91661_c1 nmdc:mga06r32_91661_c1_416_1552 378
40 3300054114 Ga0501084_0007126 Ga0501084_0007126_1731_2963 378
41 3300060353 Ga0501082_0006080 Ga0501082_0006080_8575_9807 378
42 3300061734 Ga0530510_0006906 Ga0530510_0006906_607_1839 378
43 3300005843 Ga0068860_100014432 Ga0068860_1000144328 379
44 3300009177 Ga0105248_10108298 Ga0105248_101082982 379
45 3300025972 Ga0207668_10028956 Ga0207668_100289564 379
46 3300005842 Ga0068858_100018450 Ga0068858_1000184503 382
47 3300025922 Ga0207646_10388871 Ga0207646_103888711 382
48 3300025934 Ga0207686_10008264 Ga0207686_100082643 382
49 3300026035 Ga0207703_10018488 Ga0207703_100184884 382
50 3300049593 Ga0501077_0032881 Ga0501077_0032881_157_1389 382
51 3300061734 Ga0530510_0023150 Ga0530510_0023150_2289_3527 382
52 3300006847 Ga0075431_100134314 Ga0075431_1001343142 383
53 3300009147 Ga0114129_10135959 Ga0114129_101359591 383
54 3300035695 Ga0373927_0116767 Ga0373927_0116767_62_1285 383
55 3300009176 Ga0105242_10000761 Ga0105242_1000076117 384
56 3300025941 Ga0207711_10049364 Ga0207711_100493643 384
57 3300005546 Ga0070696_100197214 Ga0070696_1001972141 385
58 3300050512 nmdc:mga0n895_89783_c1 nmdc:mga0n895_89783_c1_504_1739 387
59 3300009147 Ga0114129_10040324 Ga0114129_100403243 390
60 3300050507 nmdc:mga05p37_590_c1 nmdc:mga05p37_590_c1_2961_4136 390
61 3300050508 nmdc:mga09592_1912_c1 nmdc:mga09592_1912_c1_6457_7632 390
62 3300050510 nmdc:mga06r32_30678_c1 nmdc:mga06r32_30678_c1_2184_3359 390
63 3300006844 Ga0075428_100365603 Ga0075428_1003656032 391
64 3300006847 Ga0075431_100433953 Ga0075431_1004339531 391
65 3300045051 Ga0451576_0114148 Ga0451576_0114148_614_1825 391
66 3300049568 Ga0501031_0014480 Ga0501031_0014480_2348_3586 391
67 3300049570 Ga0501033_0016683 Ga0501033_0016683_206_1444 391
68 3300049572 Ga0501036_0000094 Ga0501036_0000094_48143_49381 391
69 3300049573 Ga0501037_0012375 Ga0501037_0012375_845_2083 391
70 3300049574 Ga0501038_0001660 Ga0501038_0001660_6063_7301 391
71 3300049575 Ga0501039_0001935 Ga0501039_0001935_6818_8056 391
72 3300049576 Ga0501040_0000163 Ga0501040_0000163_944_2182 391
73 3300049577 Ga0501041_0000062 Ga0501041_0000062_4344_5582 391
74 3300049578 Ga0501042_0000141 Ga0501042_0000141_7063_8301 391
75 3300049580 Ga0501046_0002744 Ga0501046_0002744_9689_10927 391
76 3300049582 Ga0501048_0014617 Ga0501048_0014617_3747_4985 391
77 3300049584 Ga0501068_0001798 Ga0501068_0001798_6126_7364 391
78 3300049587 Ga0501071_0000391 Ga0501071_0000391_4059_5297 391
79 3300049588 Ga0501072_0000069 Ga0501072_0000069_10334_11572 391
80 3300049592 Ga0501076_0000140 Ga0501076_0000140_17509_18747 391
81 3300049593 Ga0501077_0000870 Ga0501077_0000870_16591_17829 391
82 3300049741 Ga0501079_0000060 Ga0501079_0000060_16395_17633 391
83 3300049742 Ga0501080_0001483 Ga0501080_0001483_10914_12152 391
84 3300049743 Ga0501081_0000047 Ga0501081_0000047_17417_18655 391
85 3300049744 Ga0501083_0040397 Ga0501083_0040397_1596_2834 391
86 3300049822 Ga0501035_0032443 Ga0501035_0032443_2335_3573 391
87 3300049824 Ga0501045_0000004 Ga0501045_0000004_7811_9049 391
88 3300050507 nmdc:mga05p37_202847_c1 nmdc:mga05p37_202847_c1_406_1617 391
89 3300050508 nmdc:mga09592_191213_c1 nmdc:mga09592_191213_c1_546_1757 391
90 3300050509 nmdc:mga0qj67_296359_c1 nmdc:mga0qj67_296359_c1_16_1227 391
91 3300050510 nmdc:mga06r32_310507_c1 nmdc:mga06r32_310507_c1_337_1548 391
92 3300054114 Ga0501084_0000507 Ga0501084_0000507_22226_23464 391
93 3300060353 Ga0501082_0000422 Ga0501082_0000422_20987_22225 391
94 3300006852 Ga0075433_10018223 Ga0075433_100182234 392
95 3300006871 Ga0075434_100008611 Ga0075434_1000086112 392
96 3300006844 Ga0075428_100031753 Ga0075428_1000317535 394
97 3300006880 Ga0075429_100034004 Ga0075429_1000340043 394
98 3300009147 Ga0114129_10000383 Ga0114129_1000038338 394
99 3300009147 Ga0114129_10074495 Ga0114129_100744953 394
100 3300050507 nmdc:mga05p37_141_c1 nmdc:mga05p37_141_c1_19038_20267 394
101 3300050508 nmdc:mga09592_24477_c1 nmdc:mga09592_24477_c1_1215_2444 394
102 3300050510 nmdc:mga06r32_1360_c1 nmdc:mga06r32_1360_c1_20191_21420 396
103 3300005518 Ga0070699_100029770 Ga0070699_1000297703 398
104 3300006177 Ga0075362_10000550 Ga0075362_100005507 398
105 3300006177 Ga0075362_10023505 Ga0075362_100235052 398
106 3300006852 Ga0075433_10034878 Ga0075433_100348786 398
107 3300006880 Ga0075429_100001056 Ga0075429_1000010564 398
108 3300025922 Ga0207646_10031885 Ga0207646_100318852 398
109 3300050489 nmdc:mga03683_707_c1 nmdc:mga03683_707_c1_1872_3080 398
110 3300050507 nmdc:mga05p37_78757_c1 nmdc:mga05p37_78757_c1_455_1690 398
111 3300050513 nmdc:mga0rr50_6825_c1 nmdc:mga0rr50_6825_c1_941_2176 398
112 3300050515 nmdc:mga0a205_9877_c1 nmdc:mga0a205_9877_c1_1923_3158 398
113 3300060353 Ga0501082_0204766 Ga0501082_0204766_476_1684 398
114 3300005445 Ga0070708_100128037 Ga0070708_1001280372 399
115 3300005467 Ga0070706_100171292 Ga0070706_1001712922 399
116 3300005468 Ga0070707_100022319 Ga0070707_1000223195 399
117 3300005471 Ga0070698_100076475 Ga0070698_1000764753 399
118 3300005536 Ga0070697_100021738 Ga0070697_1000217382 399
119 iso_pu_bacteria 2929199973 2929205940 400
120 iso_pu_bacteria 8055909800 8055912307 400
121 3300009094 Ga0111539_10017094 Ga0111539_100170948 401
122 3300009147 Ga0114129_10629457 Ga0114129_106294572 401
123 3300045051 Ga0451576_0069126 Ga0451576_0069126_1117_2325 401
124 3300049585 Ga0501069_0085625 Ga0501069_0085625_450_1670 401
125 3300050508 nmdc:mga09592_143404_c1 nmdc:mga09592_143404_c1_348_1562 401
126 3300050511 nmdc:mga08y16_118289_c1 nmdc:mga08y16_118289_c1_852_2066 401
127 3300005617 Ga0068859_100230529 Ga0068859_1002305292 402
128 3300006852 Ga0075433_10094382 Ga0075433_100943823 402
129 3300006871 Ga0075434_100199011 Ga0075434_1001990112 402
130 3300006931 Ga0097620_100230545 Ga0097620_1002305452 402
131 3300046476 Ga0495662_0020723 Ga0495662_0020723_882_2099 402
132 3300046517 Ga0495630_0013500 Ga0495630_0013500_529_1746 402
133 3300046535 Ga0495586_0068059 Ga0495586_0068059_711_1928 402
134 3300046642 Ga0495634_0130220 Ga0495634_0130220_129_1346 402
135 3300046663 Ga0495635_0143434 Ga0495635_0143434_369_1586 402
136 3300046690 Ga0495624_0073469 Ga0495624_0073469_606_1823 402
137 3300050507 nmdc:mga05p37_88349_c1 nmdc:mga05p37_88349_c1_2401_3609 402
138 3300050512 nmdc:mga0n895_41594_c1 nmdc:mga0n895_41594_c1_212_1420 402
139 3300050512 nmdc:mga0n895_77342_c1 nmdc:mga0n895_77342_c1_1654_2865 402
140 3300050513 nmdc:mga0rr50_84485_c1 nmdc:mga0rr50_84485_c1_978_2186 402
141 3300050515 nmdc:mga0a205_34173_c1 nmdc:mga0a205_34173_c1_1645_2853 402
142 3300053077 Ga0495601_0057273 Ga0495601_0057273_139_1356 402
143 3300005983 Ga0081540_1021441 Ga0081540_10214414 403
144 3300009147 Ga0114129_10014487 Ga0114129_1001448710 403
145 3300044673 Ga0453683_0052965 Ga0453683_0052965_1304_2515 403
146 3300050508 nmdc:mga09592_23258_c1 nmdc:mga09592_23258_c1_268_1521 403
147 3300050512 nmdc:mga0n895_5289_c1 nmdc:mga0n895_5289_c1_2692_3945 403
148 3300050515 nmdc:mga0a205_3810_c1 nmdc:mga0a205_3810_c1_8016_9269 403
149 3300061734 Ga0530510_0146650 Ga0530510_0146650_486_1700 403
150 3300005536 Ga0070697_100011641 Ga0070697_1000116412 404
151 3300006844 Ga0075428_100000367 Ga0075428_10000036727 405
152 3300006846 Ga0075430_100000036 Ga0075430_10000003636 405
153 3300006847 Ga0075431_100005295 Ga0075431_1000052958 405
154 3300006880 Ga0075429_100000001 Ga0075429_10000000180 405
155 3300009147 Ga0114129_10050641 Ga0114129_100506413 405
156 3300009147 Ga0114129_10081369 Ga0114129_100813693 405
157 3300050507 nmdc:mga05p37_89401_c1 nmdc:mga05p37_89401_c1_1016_2233 405
158 3300050508 nmdc:mga09592_66_c1 nmdc:mga09592_66_c1_30245_31510 405
159 3300050510 nmdc:mga06r32_3135_c1 nmdc:mga06r32_3135_c1_4145_5410 405
160 3300026089 Ga0207648_10080970 Ga0207648_100809702 406
161 3300031548 Ga0307408_100065280 Ga0307408_1000652802 407
162 3300049576 Ga0501040_0099425 Ga0501040_0099425_93_1346 407
163 3300009147 Ga0114129_10054182 Ga0114129_100541826 408
164 3300049591 Ga0501075_0025843 Ga0501075_0025843_737_1963 408
165 3300050507 nmdc:mga05p37_43350_c1 nmdc:mga05p37_43350_c1_571_1797 408
166 3300049575 Ga0501039_0029090 Ga0501039_0029090_2994_4226 409
167 3300049578 Ga0501042_0013344 Ga0501042_0013344_3371_4603 409
168 3300049580 Ga0501046_0015294 Ga0501046_0015294_337_1569 409
169 3300049582 Ga0501048_0071386 Ga0501048_0071386_1171_2403 409
170 3300049582 Ga0501048_0096784 Ga0501048_0096784_161_1402 409
171 3300049587 Ga0501071_0052836 Ga0501071_0052836_1644_2876 409
172 3300049591 Ga0501075_0034183 Ga0501075_0034183_1964_3193 409
173 3300049592 Ga0501076_0013719 Ga0501076_0013719_2994_4226 409
174 3300049741 Ga0501079_0218391 Ga0501079_0218391_77_1306 409
175 3300049742 Ga0501080_0256085 Ga0501080_0256085_18_1247 409
176 3300049743 Ga0501081_0029255 Ga0501081_0029255_1825_3057 409
177 3300054114 Ga0501084_0031402 Ga0501084_0031402_2994_4226 409
178 3300054114 Ga0501084_0234166 Ga0501084_0234166_158_1387 409
179 3300061734 Ga0530510_0048997 Ga0530510_0048997_1395_2624 409
180 3300005844 Ga0068862_100100930 Ga0068862_1001009303 410
181 3300025923 Ga0207681_10061711 Ga0207681_100617112 410
182 3300046472 Ga0495580_0005148 Ga0495580_0005148_9338_10570 410
183 3300050511 nmdc:mga08y16_290928_c1 nmdc:mga08y16_290928_c1_436_1671 410
184 3300005334 Ga0068869_100196422 Ga0068869_1001964221 411
185 3300035241 Ga0373961_0026473 Ga0373961_0026473_40_1308 411
186 3300048905 Ga0496102_0385716 Ga0496102_0385716_54_1292 411
187 3300049587 Ga0501071_0064628 Ga0501071_0064628_1272_2516 411
188 3300049591 Ga0501075_0070756 Ga0501075_0070756_680_1924 411
189 3300049741 Ga0501079_0063520 Ga0501079_0063520_150_1397 411
190 3300049742 Ga0501080_0043368 Ga0501080_0043368_250_1497 411
191 3300049742 Ga0501080_0092366 Ga0501080_0092366_1031_2266 411
192 3300049743 Ga0501081_0037629 Ga0501081_0037629_1303_2550 411
193 3300050507 nmdc:mga05p37_3984_c1 nmdc:mga05p37_3984_c1_4446_5684 411
194 3300060353 Ga0501082_0037844 Ga0501082_0037844_2876_4123 411
195 3300060353 Ga0501082_0134208 Ga0501082_0134208_701_1945 411
196 3300060353 Ga0501082_0206736 Ga0501082_0206736_283_1521 411
197 3300005471 Ga0070698_100034823 Ga0070698_1000348233 412
198 3300005549 Ga0070704_100000528 Ga0070704_1000005283 412
199 3300006844 Ga0075428_100058488 Ga0075428_1000584883 412
200 3300006847 Ga0075431_100016278 Ga0075431_1000162785 412
201 3300006871 Ga0075434_100008750 Ga0075434_1000087505 412
202 3300006880 Ga0075429_100002334 Ga0075429_1000023344 412
203 3300006881 Ga0068865_100151482 Ga0068865_1001514822 412
204 3300007076 Ga0075435_100011162 Ga0075435_1000111625 412
205 3300025938 Ga0207704_10139409 Ga0207704_101394091 412
206 3300042013 Ga0439456_005721 Ga0439456_005721_647_1888 412
207 3300049743 Ga0501081_0001528 Ga0501081_0001528_12345_13583 412
208 3300050512 nmdc:mga0n895_12043_c1 nmdc:mga0n895_12043_c1_2565_3803 412
209 3300050515 nmdc:mga0a205_3942_c1 nmdc:mga0a205_3942_c1_4011_5249 412
210 3300054114 Ga0501084_0023228 Ga0501084_0023228_2553_3791 412
211 3300025910 Ga0207684_10236563 Ga0207684_102365632 413
212 3300061734 Ga0530510_0000216 Ga0530510_0000216_22506_23774 415
213 3300005457 Ga0070662_100172801 Ga0070662_1001728012 416
214 3300006844 Ga0075428_100210101 Ga0075428_1002101012 416
215 3300006852 Ga0075433_10005364 Ga0075433_100053649 416
216 3300009094 Ga0111539_10008443 Ga0111539_100084432 416
217 3300025933 Ga0207706_10030517 Ga0207706_100305175 416
218 3300027907 Ga0207428_10002070 Ga0207428_1000207012 416
219 3300037312 Ga0395899_0007332 Ga0395899_0007332_3677_4942 416
220 3300037418 Ga0395900_0030228 Ga0395900_0030228_3968_5233 416
221 3300037466 Ga0395898_0039128 Ga0395898_0039128_1692_2957 416
222 3300038443 Ga0395901_0005260 Ga0395901_0005260_10918_12183 416
223 3300042876 Ga0451577_0012743 Ga0451577_0012743_4392_5642 416
224 3300044712 Ga0453684_0008187 Ga0453684_0008187_16117_17367 416
225 3300045051 Ga0451576_0036385 Ga0451576_0036385_274_1524 416
226 3300049577 Ga0501041_0117189 Ga0501041_0117189_392_1642 416
227 3300049587 Ga0501071_0030721 Ga0501071_0030721_1661_2938 416
228 3300049592 Ga0501076_0006219 Ga0501076_0006219_4216_5466 416
229 3300049592 Ga0501076_0118602 Ga0501076_0118602_494_1771 416
230 3300049824 Ga0501045_0017999 Ga0501045_0017999_2875_4152 416
231 3300050511 nmdc:mga08y16_56317_c1 nmdc:mga08y16_56317_c1_1821_3071 416
232 3300050515 nmdc:mga0a205_121352_c1 nmdc:mga0a205_121352_c1_973_2223 416
233 3300005985 Ga0081539_10000271 Ga0081539_1000027112 417
234 3300006844 Ga0075428_100003078 Ga0075428_1000030786 417
235 3300006846 Ga0075430_100000034 Ga0075430_1000000344 417
236 3300006847 Ga0075431_100011834 Ga0075431_1000118341 417
237 3300006847 Ga0075431_100022483 Ga0075431_1000224834 417
238 3300006852 Ga0075433_10004051 Ga0075433_100040518 417
239 3300006852 Ga0075433_10013843 Ga0075433_100138434 417
240 3300006880 Ga0075429_100002691 Ga0075429_10000269110 417
241 3300006880 Ga0075429_100148668 Ga0075429_1001486682 417
242 3300009094 Ga0111539_10000939 Ga0111539_100009393 417
243 3300009147 Ga0114129_10004221 Ga0114129_1000422121 417
244 3300009147 Ga0114129_10010980 Ga0114129_1001098011 417
245 3300009147 Ga0114129_10010996 Ga0114129_1001099610 417
246 3300042001 Ga0439441_008931 Ga0439441_008931_243_1499 417
247 3300049588 Ga0501072_0070103 Ga0501072_0070103_453_1718 417
248 3300049593 Ga0501077_0018577 Ga0501077_0018577_1633_2898 417
249 3300049743 Ga0501081_0009962 Ga0501081_0009962_3198_4463 417
250 3300050507 nmdc:mga05p37_10895_c1 nmdc:mga05p37_10895_c1_7779_9032 417
251 3300050507 nmdc:mga05p37_28229_c1 nmdc:mga05p37_28229_c1_233_1486 417
252 3300050508 nmdc:mga09592_132190_c1 nmdc:mga09592_132190_c1_53_1306 417
253 3300050508 nmdc:mga09592_145030_c1 nmdc:mga09592_145030_c1_224_1477 417
254 3300050509 nmdc:mga0qj67_1580_c1 nmdc:mga0qj67_1580_c1_4647_5900 417
255 3300050510 nmdc:mga06r32_2324_c1 nmdc:mga06r32_2324_c1_8920_10173 417
256 3300050510 nmdc:mga06r32_5075_c1 nmdc:mga06r32_5075_c1_7701_8954 417
257 3300050511 nmdc:mga08y16_4496_c1 nmdc:mga08y16_4496_c1_6251_7507 417
258 3300050512 nmdc:mga0n895_17086_c1 nmdc:mga0n895_17086_c1_2068_3321 417
259 3300050515 nmdc:mga0a205_1467_c1 nmdc:mga0a205_1467_c1_5236_6489 417
260 3300060353 Ga0501082_0023143 Ga0501082_0023143_3975_5240 417
261 3300061734 Ga0530510_0035069 Ga0530510_0035069_336_1601 417
262 3300005467 Ga0070706_100195707 Ga0070706_1001957072 418
263 3300006846 Ga0075430_100008304 Ga0075430_1000083042 418
264 3300006846 Ga0075430_100010413 Ga0075430_1000104132 418
265 3300006847 Ga0075431_100004963 Ga0075431_10000496315 418
266 3300006847 Ga0075431_100272085 Ga0075431_1002720852 418
267 3300006852 Ga0075433_10004993 Ga0075433_100049933 418
268 3300006880 Ga0075429_100002639 Ga0075429_1000026397 418
269 3300006914 Ga0075436_100021544 Ga0075436_1000215442 418
270 3300007076 Ga0075435_100023910 Ga0075435_1000239104 418
271 3300009147 Ga0114129_10048550 Ga0114129_100485504 418
272 3300009147 Ga0114129_10069011 Ga0114129_100690113 418
273 3300031903 Ga0307407_10011699 Ga0307407_100116992 418
274 3300032002 Ga0307416_100408409 Ga0307416_1004084091 418
275 3300037471 Ga0395905_0174102 Ga0395905_0174102_423_1679 418
276 3300049592 Ga0501076_0165531 Ga0501076_0165531_380_1654 418
277 3300049741 Ga0501079_0143805 Ga0501079_0143805_291_1565 418
278 3300050507 nmdc:mga05p37_10648_c1 nmdc:mga05p37_10648_c1_8487_9743 418
279 3300050507 nmdc:mga05p37_53009_c1 nmdc:mga05p37_53009_c1_3474_4730 418
280 3300050508 nmdc:mga09592_2782_c1 nmdc:mga09592_2782_c1_4156_5412 418
281 3300050509 nmdc:mga0qj67_108970_c1 nmdc:mga0qj67_108970_c1_687_1943 418
282 3300050509 nmdc:mga0qj67_124730_c1 nmdc:mga0qj67_124730_c1_371_1627 418
283 3300050510 nmdc:mga06r32_37150_c1 nmdc:mga06r32_37150_c1_894_2150 418
284 3300050510 nmdc:mga06r32_4554_c1 nmdc:mga06r32_4554_c1_5207_6463 418
285 3300050512 nmdc:mga0n895_667_c1 nmdc:mga0n895_667_c1_22003_23259 418
286 3300050514 nmdc:mga08x19_367_c1 nmdc:mga08x19_367_c1_28267_29523 418
287 3300050515 nmdc:mga0a205_16321_c1 nmdc:mga0a205_16321_c1_1691_2947 418
288 3300005549 Ga0070704_100088685 Ga0070704_1000886852 419
289 3300005981 Ga0081538_10027233 Ga0081538_100272334 419
290 3300035691 Ga0373931_0099630 Ga0373931_0099630_78_1337 419
291 3300049824 Ga0501045_0182609 Ga0501045_0182609_188_1474 419
292 3300003503 JGI26141J51220_1000358 JGI26141J51220_10003583 420
293 3300005328 Ga0070676_10000929 Ga0070676_1000092916 420
294 3300005331 Ga0070670_100040498 Ga0070670_1000404983 420
295 3300005334 Ga0068869_100002616 Ga0068869_1000026164 420
296 3300005336 Ga0070680_100019470 Ga0070680_1000194704 420
297 3300005336 Ga0070680_100066832 Ga0070680_1000668322 420
298 3300005337 Ga0070682_100002851 Ga0070682_10000285110 420
299 3300005339 Ga0070660_100000970 Ga0070660_10000097015 420
300 3300005340 Ga0070689_100048350 Ga0070689_1000483502 420
301 3300005341 Ga0070691_10001273 Ga0070691_100012737 420
302 3300005344 Ga0070661_100004743 Ga0070661_10000474310 420
303 3300005345 Ga0070692_10008016 Ga0070692_100080162 420
304 3300005364 Ga0070673_100010542 Ga0070673_1000105429 420
305 3300005366 Ga0070659_100000818 Ga0070659_10000081813 420
306 3300005406 Ga0070703_10002634 Ga0070703_100026344 420
307 3300005438 Ga0070701_10052164 Ga0070701_100521642 420
308 3300005440 Ga0070705_100001408 Ga0070705_1000014086 420
309 3300005440 Ga0070705_100009258 Ga0070705_1000092582 420
310 3300005441 Ga0070700_100084403 Ga0070700_1000844032 420
311 3300005444 Ga0070694_100011016 Ga0070694_1000110164 420
312 3300005455 Ga0070663_100001424 Ga0070663_1000014243 420
313 3300005457 Ga0070662_100005438 Ga0070662_1000054386 420
314 3300005457 Ga0070662_100126074 Ga0070662_1001260741 420
315 3300005458 Ga0070681_10077136 Ga0070681_100771363 420
316 3300005459 Ga0068867_100021346 Ga0068867_1000213464 420
317 3300005468 Ga0070707_100102264 Ga0070707_1001022642 420
318 3300005471 Ga0070698_100013819 Ga0070698_1000138193 420
319 3300005530 Ga0070679_100004451 Ga0070679_10000445119 420
320 3300005536 Ga0070697_100002828 Ga0070697_10000282811 420
321 3300005539 Ga0068853_100003042 Ga0068853_10000304214 420
322 3300005545 Ga0070695_100005633 Ga0070695_1000056332 420
323 3300005545 Ga0070695_100007566 Ga0070695_1000075663 420
324 3300005545 Ga0070695_100027140 Ga0070695_1000271402 420
325 3300005546 Ga0070696_100021441 Ga0070696_1000214414 420
326 3300005546 Ga0070696_100160010 Ga0070696_1001600101 420
327 3300005547 Ga0070693_100000604 Ga0070693_10000060419 420
328 3300005549 Ga0070704_100001625 Ga0070704_10000162511 420
329 3300005563 Ga0068855_100004425 Ga0068855_10000442521 420
330 3300005564 Ga0070664_100048211 Ga0070664_1000482112 420
331 3300005577 Ga0068857_100252090 Ga0068857_1002520902 420
332 3300005578 Ga0068854_100027569 Ga0068854_1000275692 420
333 3300005614 Ga0068856_100002103 Ga0068856_1000021034 420
334 3300005616 Ga0068852_100193240 Ga0068852_1001932402 420
335 3300005617 Ga0068859_100021420 Ga0068859_1000214204 420
336 3300005840 Ga0068870_10000542 Ga0068870_100005422 420
337 3300005840 Ga0068870_10032965 Ga0068870_100329652 420
338 3300005842 Ga0068858_100041616 Ga0068858_1000416164 420
339 3300005843 Ga0068860_100009397 Ga0068860_1000093976 420
340 3300005844 Ga0068862_100004918 Ga0068862_10000491813 420
341 3300005844 Ga0068862_100123368 Ga0068862_1001233682 420
342 3300005937 Ga0081455_10000060 Ga0081455_1000006075 420
343 3300006847 Ga0075431_100016368 Ga0075431_1000163682 420
344 3300006871 Ga0075434_100034755 Ga0075434_1000347552 420
345 3300006880 Ga0075429_100018153 Ga0075429_1000181535 420
346 3300006914 Ga0075436_100150047 Ga0075436_1001500472 420
347 3300006931 Ga0097620_100021418 Ga0097620_1000214185 420
348 3300007076 Ga0075435_100058071 Ga0075435_1000580712 420
349 3300009148 Ga0105243_10005129 Ga0105243_100051292 420
350 3300009174 Ga0105241_10001791 Ga0105241_1000179119 420
351 3300009176 Ga0105242_10040751 Ga0105242_100407513 420
352 3300009553 Ga0105249_10073599 Ga0105249_100735994 420
353 3300011119 Ga0105246_10028078 Ga0105246_100280783 420
354 3300013100 Ga0157373_10001444 Ga0157373_1000144419 420
355 3300013105 Ga0157369_10029073 Ga0157369_100290732 420
356 3300013307 Ga0157372_10001335 Ga0157372_1000133513 420
357 3300013307 Ga0157372_10030918 Ga0157372_100309183 420
358 3300025885 Ga0207653_10002762 Ga0207653_100027624 420
359 3300025907 Ga0207645_10001090 Ga0207645_1000109024 420
360 3300025908 Ga0207643_10000057 Ga0207643_1000005781 420
361 3300025910 Ga0207684_10005716 Ga0207684_100057162 420
362 3300025912 Ga0207707_10001689 Ga0207707_1000168925 420
363 3300025917 Ga0207660_10001714 Ga0207660_100017144 420
364 3300025919 Ga0207657_10001291 Ga0207657_1000129124 420
365 3300025921 Ga0207652_10001723 Ga0207652_1000172324 420
366 3300025922 Ga0207646_10024873 Ga0207646_100248733 420
367 3300025925 Ga0207650_10022059 Ga0207650_100220594 420
368 3300025933 Ga0207706_10007276 Ga0207706_100072769 420
369 3300025933 Ga0207706_10145410 Ga0207706_101454103 420
370 3300025942 Ga0207689_10001050 Ga0207689_1000105013 420
371 3300025945 Ga0207679_10005417 Ga0207679_1000541710 420
372 3300025949 Ga0207667_10003708 Ga0207667_1000370820 420
373 3300025960 Ga0207651_10075930 Ga0207651_100759302 420
374 3300025981 Ga0207640_10077234 Ga0207640_100772342 420
375 3300026041 Ga0207639_10004062 Ga0207639_100040623 420
376 3300026067 Ga0207678_10004163 Ga0207678_1000416313 420
377 3300026075 Ga0207708_10122026 Ga0207708_101220262 420
378 3300026116 Ga0207674_10002538 Ga0207674_100025389 420
379 3300026116 Ga0207674_10008145 Ga0207674_100081452 420
380 3300026118 Ga0207675_100016827 Ga0207675_1000168276 420
381 3300026142 Ga0207698_10136000 Ga0207698_101360002 420
382 3300027526 Ga0209968_1000240 Ga0209968_10002408 420
383 3300027665 Ga0209983_1000855 Ga0209983_10008554 420
384 3300027682 Ga0209971_1000376 Ga0209971_10003768 420
385 3300027695 Ga0209966_1000586 Ga0209966_100058610 420
386 3300027717 Ga0209998_10000117 Ga0209998_1000011716 420
387 3300027876 Ga0209974_10002797 Ga0209974_100027975 420
388 3300028380 Ga0268265_10004815 Ga0268265_1000481513 420
389 3300028380 Ga0268265_10033813 Ga0268265_100338132 420
390 3300034817 Ga0373948_0009506 Ga0373948_0009506_242_1510 420
391 3300042157 Ga0439458_0001784 Ga0439458_0001784_3415_4683 420
392 3300042461 Ga0439460_0001583 Ga0439460_0001583_2870_4132 420
393 3300042876 Ga0451577_0026336 Ga0451577_0026336_1996_3264 420
394 3300044712 Ga0453684_0160155 Ga0453684_0160155_275_1543 420
395 3300045051 Ga0451576_0027219 Ga0451576_0027219_4428_5690 420
396 3300045051 Ga0451576_0071880 Ga0451576_0071880_1834_3102 420
397 3300045051 Ga0451576_0095008 Ga0451576_0095008_856_2118 420
398 3300047318 Ga0495636_0004675 Ga0495636_0004675_1424_2686 420
399 3300048913 Ga0496110_0116944 Ga0496110_0116944_82_1350 420
400 3300048915 Ga0496112_0110515 Ga0496112_0110515_72_1340 420
401 3300049575 Ga0501039_0040484 Ga0501039_0040484_1972_3234 420
402 3300049577 Ga0501041_0020075 Ga0501041_0020075_204_1508 420
403 3300049578 Ga0501042_0195435 Ga0501042_0195435_30_1292 420
404 3300049580 Ga0501046_0001548 Ga0501046_0001548_16911_18215 420
405 3300049581 Ga0501047_0227170 Ga0501047_0227170_148_1452 420
406 3300049582 Ga0501048_0086625 Ga0501048_0086625_612_1916 420
407 3300049587 Ga0501071_0112872 Ga0501071_0112872_127_1431 420
408 3300049588 Ga0501072_0016181 Ga0501072_0016181_1224_2486 420
409 3300049590 Ga0501074_0142890 Ga0501074_0142890_288_1592 420
410 3300049590 Ga0501074_0181544 Ga0501074_0181544_150_1412 420
411 3300049591 Ga0501075_0002755 Ga0501075_0002755_8600_9904 420
412 3300049591 Ga0501075_0012856 Ga0501075_0012856_1919_3181 420
413 3300049592 Ga0501076_0005700 Ga0501076_0005700_4138_5400 420
414 3300049741 Ga0501079_0005077 Ga0501079_0005077_6148_7452 420
415 3300049743 Ga0501081_0013201 Ga0501081_0013201_2042_3304 420
416 3300049743 Ga0501081_0155823 Ga0501081_0155823_62_1366 420
417 3300049744 Ga0501083_0016323 Ga0501083_0016323_11_1315 420
418 3300049824 Ga0501045_0002446 Ga0501045_0002446_413_1717 420
419 3300050508 nmdc:mga09592_41228_c1 nmdc:mga09592_41228_c1_1427_2689 420
420 3300050510 nmdc:mga06r32_5485_c1 nmdc:mga06r32_5485_c1_6087_7349 420
421 3300050511 nmdc:mga08y16_163096_c1 nmdc:mga08y16_163096_c1_630_1892 420
422 3300050515 nmdc:mga0a205_35649_c1 nmdc:mga0a205_35649_c1_1354_2622 420
423 3300054114 Ga0501084_0008785 Ga0501084_0008785_6879_8141 420
424 3300054114 Ga0501084_0021087 Ga0501084_0021087_3490_4794 420
425 3300060353 Ga0501082_0034256 Ga0501082_0034256_806_2110 420
426 3300061734 Ga0530510_0037495 Ga0530510_0037495_671_1933 420
427 3300061734 Ga0530510_0093072 Ga0530510_0093072_909_2171 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

56

347

0.92

PF07690

MFS_1

Major Facilitator Superfamily

296

445

0.9

PF06779

MFS_4

Uncharacterised MFS-type transporter YbfB

58

431

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8928 22 409
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8913 23 408
7da5-assembly1.cif.gz_A cryo-em structure of the human mct1 d309n mutant in complex with basigin-2 in the inward-open conformation. 0.8683 22 409
7yr5-assembly1.cif.gz_A embigin facilitates monocarboxylate transporter 1 localization to plasma membrane and transition to a decoupling state 0.8541 23 408
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8386 26 411
ID Description Score Start End Superfamily
af_Q7RTY1_9_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9446 22 203 1.20.1250.20
af_A0A0R4IK09_14_317_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9429 25 204 1.20.1250.20
af_Q5NC32_11_193_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9365 22 204 1.20.1250.20
af_E7FGJ9_71_276_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9346 26 204 1.20.1250.20
af_Q8BGC3_15_203_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9275 22 204 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6L7PKC3-F1-model_v4 deleted 0.9772 21 414
AF-A0A2S6U202-F1-model_v4 Putative MFS-type transporter YhjX 0.9687 28 376 GO:0016020
GO:0022857
AF-A0A2E5L866-F1-model_v4 MFS transporter 0.9672 21 419 GO:0016020
GO:0022857
AF-A0A2P5VL68-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9633 21 410 GO:0016020
GO:0022857
AF-A0A7S8IRI3-F1-model_v4 MFS transporter 0.9626 28 420 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.59 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map