F441600

General Info

Members Datasets Scaffolds Average Seq Length
428 227 428 163

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100299929|Ga0070680_1002999293
Length 166
Sequence MNAEIVPMTKNHWPSVREIYLAGIATGNATFESQAPEWDEWDAKHLGFARLVAMDDREVKGWAALSAVSTRKVYRGVAENSVYVAPAAQGLGLGRLLLERLIAESEANGIWTLQNSIFPENIASIRLHRSCGFREVGKRERIAQLNGVWRSTIFMERRSPVVGTDS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
119 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
120 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
121 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
122 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
123 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
124 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
125 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
220 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
221 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
222 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
223 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 0
Rhizoplane 10.75
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 3.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10012329 3300003316 Bacteria 44821
2 rootH1_10156588 3300003316 Bacteria 1418
3 rootH1_10156588 3300003323 Bacteria 1300
4 rootL2_10000665 3300003322 Bacteria 16298
5 rootL2_10189630 3300003322 Bacteria 1414
6 rootL2_10195467 3300003322 Bacteria 1368
7 rootH1_10011437 3300003323 Bacteria 74019
8 Ga0065715_10200879 3300005293 Bacteria 1362
9 Ga0065707_10157467 3300005295 Unclassified 1595
10 Ga0070658_10349519 3300005327 Bacteria 1265
11 Ga0070690_100011449 3300005330 Bacteria 5188
12 Ga0068869_100242311 3300005334 Bacteria 1437
13 Ga0070680_100019999 3300005336 Bacteria 5307
14 Ga0070680_100161874 3300005336 Bacteria 1881
15 Ga0070680_100299929 3300005336 Bacteria 1362
16 Ga0068868_100389924 3300005338 Unclassified 1200
17 Ga0068868_100626978 3300005338 Unclassified 955
18 Ga0070660_100156831 3300005339 Unclassified 1832
19 Ga0070687_100161595 3300005343 Bacteria 1325
20 Ga0070692_10108070 3300005345 Bacteria 1535
21 Ga0070692_10201745 3300005345 Bacteria 1165
22 Ga0070671_100055366 3300005355 Bacteria 3300
23 Ga0070709_10015557 3300005434 Bacteria 4332
24 Ga0070709_10027684 3300005434 Bacteria 3372
25 Ga0070714_100036852 3300005435 Bacteria 4105
26 Ga0070714_100056406 3300005435 Bacteria 3360
27 Ga0070714_100073037 3300005435 Bacteria 2971
28 Ga0070714_100192080 3300005435 Bacteria 1864
29 Ga0070714_100240772 3300005435 Bacteria 1670
30 Ga0070714_101533607 3300005435 Bacteria 651
31 Ga0070713_100028856 3300005436 Bacteria 4385
32 Ga0070713_100144771 3300005436 Bacteria 2108
33 Ga0070710_10002388 3300005437 Bacteria 8886
34 Ga0070710_10009344 3300005437 Bacteria 4795
35 Ga0070701_10128058 3300005438 Bacteria 1439
36 Ga0070711_100078990 3300005439 Bacteria 2339
37 Ga0070711_100186920 3300005439 Bacteria 1589
38 Ga0070711_100409115 3300005439 Bacteria 1103
39 Ga0070694_100125914 3300005444 Bacteria 1844
40 Ga0070681_10120433 3300005458 Bacteria 2559
41 Ga0070681_10256273 3300005458 Bacteria 1661
42 Ga0068867_100089645 3300005459 Bacteria 2332
43 Ga0070707_100000457 3300005468 Bacteria 40464
44 Ga0070707_100257499 3300005468 Bacteria 1698
45 Ga0070679_100079334 3300005530 Bacteria 3272
46 Ga0070679_100109728 3300005530 Bacteria 2745
47 Ga0070679_100694030 3300005530 Bacteria 961
48 Ga0070684_100253566 3300005535 Bacteria 1608
49 Ga0070684_100260960 3300005535 Bacteria 1585
50 Ga0068853_100526587 3300005539 Bacteria 1118
51 Ga0070672_100122527 3300005543 Bacteria 2130
52 Ga0070686_100799459 3300005544 Unclassified 760
53 Ga0070693_100215234 3300005547 Bacteria 1256
54 Ga0070665_100510968 3300005548 Bacteria 1213
55 Ga0070704_100228188 3300005549 Bacteria 1517
56 Ga0068855_100029009 3300005563 Bacteria 6618
57 Ga0068855_100233751 3300005563 Bacteria 2057
58 Ga0070664_100191800 3300005564 Unclassified 1821
59 Ga0070664_100444041 3300005564 Bacteria 1190
60 Ga0068854_100375397 3300005578 Bacteria 1170
61 Ga0068854_100537666 3300005578 Unclassified 989
62 Ga0068856_100073233 3300005614 Bacteria 3392
63 Ga0068856_100199317 3300005614 Bacteria 2016
64 Ga0068856_100272205 3300005614 Bacteria 1709
65 Ga0068856_100622593 3300005614 Bacteria 1100
66 Ga0068856_100836682 3300005614 Bacteria 940
67 Ga0070702_100094924 3300005615 Bacteria 1817
68 Ga0068861_100367710 3300005719 Unclassified 1266
69 Ga0068870_10122681 3300005840 Unclassified 1499
70 Ga0068863_100173649 3300005841 Bacteria 2068
71 Ga0070717_10011887 3300006028 Bacteria 6624
72 Ga0070717_10474223 3300006028 Bacteria 1129
73 Ga0070715_10000676 3300006163 Bacteria 9140
74 Ga0070716_100017986 3300006173 Bacteria 3675
75 Ga0070716_100103457 3300006173 Bacteria 1751
76 Ga0070712_100227235 3300006175 Bacteria 1480
77 Ga0070712_100596064 3300006175 Bacteria 935
78 Ga0075366_10029942 3300006195 Bacteria 3199
79 Ga0097621_100275327 3300006237 Bacteria 1480
80 Ga0068871_100080201 3300006358 Bacteria 2702
81 Ga0075428_100785643 3300006844 Bacteria 1012
82 Ga0075433_10726841 3300006852 Bacteria 869
83 Ga0075435_100242655 3300007076 Bacteria 1533
84 Ga0105240_10193795 3300009093 Bacteria 2388
85 Ga0111539_10320308 3300009094 Bacteria 1804
86 Ga0111539_10322942 3300009094 Bacteria 1796
87 Ga0111539_10587038 3300009094 Bacteria 1298
88 Ga0105245_10197958 3300009098 Bacteria 1928
89 Ga0105245_10293450 3300009098 Bacteria 1593
90 Ga0105245_10922181 3300009098 Bacteria 916
91 Ga0105247_10068342 3300009101 Bacteria 2215
92 Ga0114129_10004956 3300009147 Bacteria 18775
93 Ga0114129_10572035 3300009147 Bacteria 1467
94 Ga0114129_10622371 3300009147 Unclassified 1396
95 Ga0105241_10072935 3300009174 Bacteria 2669
96 Ga0105241_10149072 3300009174 Bacteria 1912
97 Ga0105242_10477033 3300009176 Bacteria 1181
98 Ga0105248_10836028 3300009177 Unclassified 1039
99 Ga0105237_10053098 3300009545 Bacteria 4066
100 Ga0105239_10013103 3300010375 Bacteria 9215
101 Ga0105239_10225673 3300010375 Bacteria 2101
102 Ga0105239_10490103 3300010375 Unclassified 1397
103 Ga0105239_12270857 3300010375 Bacteria 631
104 Ga0157369_10063335 3300013105 Bacteria 3984
105 Ga0157369_10128821 3300013105 Bacteria 2682
106 Ga0157378_10119715 3300013297 Bacteria 2425
107 Ga0157378_10232009 3300013297 Bacteria 1759
108 Ga0163162_10455206 3300013306 Unclassified 1412
109 Ga0157372_10549702 3300013307 Bacteria 1346
110 Ga0157372_12170941 3300013307 Bacteria 638
111 Ga0157380_10298215 3300014326 Bacteria 1483
112 Ga0182008_10040286 3300014497 Bacteria 2333
113 Ga0182008_10137429 3300014497 Unclassified 1221
114 Ga0157376_10035382 3300014969 Bacteria 4040
115 Ga0209646_1001349 3300025246 Bacteria 6775
116 Ga0207692_10005571 3300025898 Bacteria 5055
117 Ga0207692_10094172 3300025898 Bacteria 1630
118 Ga0207710_10059370 3300025900 Bacteria 1731
119 Ga0207685_10000478 3300025905 Bacteria 6755
120 Ga0207699_10018052 3300025906 Bacteria 3730
121 Ga0207699_10171059 3300025906 Bacteria 1453
122 Ga0207654_10065365 3300025911 Bacteria 2141
123 Ga0207654_10187633 3300025911 Unclassified 1353
124 Ga0207707_10426593 3300025912 Bacteria 1136
125 Ga0207671_10315521 3300025914 Bacteria 1236
126 Ga0207693_10000282 3300025915 Bacteria 47278
127 Ga0207693_10003548 3300025915 Bacteria 13323
128 Ga0207693_10095454 3300025915 Bacteria 2331
129 Ga0207693_10613846 3300025915 Bacteria 846
130 Ga0207663_10020012 3300025916 Bacteria 3783
131 Ga0207663_10308423 3300025916 Bacteria 1185
132 Ga0207657_10000847 3300025919 Bacteria 32287
133 Ga0207652_10031526 3300025921 Bacteria 4453
134 Ga0207652_10981266 3300025921 Unclassified 743
135 Ga0207646_10001031 3300025922 Bacteria 35603
136 Ga0207646_10406900 3300025922 Bacteria 1229
137 Ga0207646_10683486 3300025922 Bacteria 918
138 Ga0207681_10069161 3300025923 Bacteria 2455
139 Ga0207687_10428730 3300025927 Bacteria 1093
140 Ga0207687_10967204 3300025927 Unclassified 730
141 Ga0207700_10054170 3300025928 Bacteria 3009
142 Ga0207700_10086176 3300025928 Bacteria 2467
143 Ga0207664_10016140 3300025929 Bacteria 5442
144 Ga0207664_10064755 3300025929 Bacteria 2925
145 Ga0207664_10215587 3300025929 Bacteria 1663
146 Ga0207644_10967834 3300025931 Unclassified 714
147 Ga0207665_10000835 3300025939 Bacteria 20809
148 Ga0207665_10041158 3300025939 Bacteria 3085
149 Ga0207689_10188978 3300025942 Bacteria 1699
150 Ga0207661_10355252 3300025944 Bacteria 1323
151 Ga0207661_10583689 3300025944 Unclassified 1025
152 Ga0207667_10039751 3300025949 Bacteria 5011
153 Ga0207667_10881449 3300025949 Unclassified 888
154 Ga0207712_10139232 3300025961 Bacteria 1860
155 Ga0207640_10419807 3300025981 Bacteria 1094
156 Ga0207677_10480530 3300026023 Unclassified 1070
157 Ga0207677_10866049 3300026023 Unclassified 813
158 Ga0207639_11749406 3300026041 Bacteria 582
159 Ga0207708_10006841 3300026075 Bacteria 8434
160 Ga0207702_10070486 3300026078 Unclassified 3007
161 Ga0207702_10356134 3300026078 Bacteria 1402
162 Ga0207702_10775279 3300026078 Bacteria 947
163 Ga0207648_10295988 3300026089 Bacteria 1450
164 Ga0207674_10041853 3300026116 Bacteria 4736
165 Ga0207675_100170791 3300026118 Bacteria 2078
166 Ga0207675_100354439 3300026118 Bacteria 1438
167 Ga0207428_10693575 3300027907 Unclassified 729
168 Ga0268264_10301733 3300028381 Bacteria 1508
169 Ga0307513_10269524 3300031456 Bacteria 1487
170 Ga0307513_10387242 3300031456 Bacteria 1136
171 Ga0307509_10212456 3300031507 Bacteria 1758
172 Ga0307509_10745517 3300031507 Bacteria 645
173 Ga0373944_0203349 3300035089 Unclassified 718
174 Ga0373949_0088268 3300035090 Bacteria 835
175 Ga0373943_0008419 3300035170 Bacteria 4626
176 Ga0373961_0094464 3300035241 Bacteria 960
177 Ga0373924_0206006 3300035410 Bacteria 868
178 Ga0373931_0062174 3300035691 Bacteria 2015
179 Ga0373935_0033052 3300035692 Bacteria 3218
180 Ga0373933_0093961 3300035724 Bacteria 1854
181 Ga0373947_0000995 3300035725 Bacteria 17314
182 Ga0373947_0182430 3300035725 Unclassified 1367
183 Ga0373937_0000364 3300036401 Bacteria 42155
184 Ga0373937_0916164 3300036401 Unclassified 825
185 Ga0395899_0179316 3300037312 Unclassified 1488
186 Ga0395900_0108275 3300037418 Bacteria 2855
187 Ga0395898_1962100 3300037466 Bacteria 505
188 Ga0395905_0993925 3300037471 Bacteria 742
189 Ga0439436_0042862 3300041404 Bacteria 1293
190 Ga0439439_0001053 3300041406 Bacteria 5238
191 Ga0439439_0169389 3300041406 Bacteria 626
192 Ga0451798_1034019 3300041458 Bacteria 1406
193 Ga0451802_1968786 3300041460 Bacteria 1170
194 Ga0451845_0141715 3300041501 Unclassified 664
195 Ga0451853_3027060 3300041512 Bacteria 655
196 Ga0439457_080694 3300042014 Bacteria 747
197 Ga0439462_0037102 3300042015 Bacteria 1297
198 Ga0439462_0053367 3300042015 Bacteria 1088
199 Ga0450893_0148261 3300042532 Bacteria 505
200 Ga0466969_0000127 3300044656 Bacteria 41196
201 Ga0466969_0000542 3300044656 Bacteria 20684
202 Ga0466972_0000080 3300044658 Bacteria 89226
203 Ga0466972_0035113 3300044658 Bacteria 2454
204 Ga0466965_0090958 3300044683 Bacteria 1552
205 Ga0466965_0407568 3300044683 Unclassified 752
206 Ga0466966_0119437 3300044684 Unclassified 1620
207 Ga0466966_0145998 3300044684 Bacteria 1444
208 Ga0466961_0004696 3300044693 Bacteria 8587
209 Ga0466961_0058673 3300044693 Bacteria 2448
210 Ga0466961_0132329 3300044693 Bacteria 1563
211 Ga0466961_0141432 3300044693 Bacteria 1506
212 Ga0466963_0011364 3300044694 Bacteria 5418
213 Ga0466963_0018657 3300044694 Bacteria 4341
214 Ga0466963_0020746 3300044694 Bacteria 4135
215 Ga0466963_0023871 3300044694 Bacteria 3888
216 Ga0466963_0029232 3300044694 Bacteria 3545
217 Ga0466963_0034930 3300044694 Bacteria 3273
218 Ga0466963_0042132 3300044694 Bacteria 2997
219 Ga0466963_0124057 3300044694 Unclassified 1779
220 Ga0466963_0570025 3300044694 Unclassified 799
221 Ga0466964_0013190 3300044706 Bacteria 3133
222 Ga0466964_0022503 3300044706 Bacteria 2446
223 Ga0466964_0032807 3300044706 Bacteria 2065
224 Ga0466964_0175459 3300044706 Bacteria 1012
225 Ga0466971_0001047 3300044719 Bacteria 11468
226 Ga0466971_0081682 3300044719 Bacteria 1475
227 Ga0466968_0002057 3300044735 Bacteria 7324
228 Ga0466968_0003914 3300044735 Bacteria 5527
229 Ga0466968_0023219 3300044735 Bacteria 2525
230 Ga0466968_0034565 3300044735 Unclassified 2110
231 Ga0466968_0053503 3300044735 Bacteria 1729
232 Ga0466970_0025787 3300044765 Bacteria 3079
233 Ga0466970_0123690 3300044765 Bacteria 1418
234 Ga0466957_0003320 3300044842 Bacteria 8819
235 Ga0466957_0052205 3300044842 Bacteria 2489
236 Ga0466957_0142911 3300044842 Bacteria 1543
237 Ga0466957_0225213 3300044842 Bacteria 1239
238 Ga0466957_0528701 3300044842 Bacteria 820
239 Ga0466957_0546968 3300044842 Bacteria 807
240 Ga0466960_0136174 3300044901 Bacteria 1301
241 Ga0466959_0000014 3300045049 Bacteria 150962
242 Ga0466959_0001373 3300045049 Bacteria 14860
243 Ga0466959_0087179 3300045049 Unclassified 2245
244 Ga0466959_0164974 3300045049 Bacteria 1556
245 Ga0466959_0215740 3300045049 Bacteria 1332
246 Ga0466959_0287135 3300045049 Bacteria 1128
247 Ga0466958_0000730 3300045836 Bacteria 14377
248 Ga0466958_0012562 3300045836 Bacteria 4801
249 Ga0466958_0013203 3300045836 Bacteria 4698
250 Ga0466958_0248418 3300045836 Bacteria 1137
251 Ga0466958_0557390 3300045836 Unclassified 745
252 Ga0466967_0020378 3300045976 Bacteria 5358
253 Ga0466967_0025350 3300045976 Bacteria 4888
254 Ga0466967_0026279 3300045976 Bacteria 4819
255 Ga0466967_0049803 3300045976 Bacteria 3666
256 Ga0466967_0061052 3300045976 Bacteria 3343
257 Ga0466967_0070790 3300045976 Bacteria 3120
258 Ga0466967_0234165 3300045976 Unclassified 1749
259 Ga0466967_0288995 3300045976 Unclassified 1574
260 Ga0495617_153126 3300046452 Unclassified 733
261 Ga0495592_0000050 3300046454 Bacteria 111971
262 Ga0495592_0257857 3300046454 Unclassified 1150
263 Ga0495592_0276931 3300046454 Unclassified 1098
264 Ga0495603_0007004 3300046455 Bacteria 6768
265 Ga0495603_0198754 3300046455 Bacteria 1159
266 Ga0495629_0087421 3300046459 Unclassified 2175
267 Ga0495629_0278271 3300046459 Unclassified 1149
268 Ga0495641_0021764 3300046461 Bacteria 3219
269 Ga0495651_0000028 3300046462 Bacteria 105473
270 Ga0495651_0084238 3300046462 Bacteria 2396
271 Ga0495653_0020152 3300046463 Bacteria 5406
272 Ga0495653_0043500 3300046463 Bacteria 3491
273 Ga0495580_0065629 3300046472 Bacteria 2542
274 Ga0495582_0001425 3300046473 Bacteria 13480
275 Ga0495582_0071744 3300046473 Unclassified 1916
276 Ga0495582_0148481 3300046473 Bacteria 1330
277 Ga0495639_0001265 3300046475 Bacteria 11381
278 Ga0495662_0021479 3300046476 Bacteria 3119
279 Ga0495662_0050659 3300046476 Bacteria 2004
280 Ga0495662_0219563 3300046476 Bacteria 937
281 Ga0495664_0081771 3300046477 Bacteria 1936
282 Ga0495585_0055531 3300046492 Bacteria 2188
283 Ga0495594_0266522 3300046499 Unclassified 976
284 Ga0495608_0004916 3300046511 Bacteria 9574
285 Ga0495608_0086404 3300046511 Bacteria 2032
286 Ga0495608_0436274 3300046511 Bacteria 798
287 Ga0495608_0479345 3300046511 Bacteria 755
288 Ga0495618_0001433 3300046514 Bacteria 16025
289 Ga0495618_0035750 3300046514 Bacteria 3118
290 Ga0495618_0155001 3300046514 Bacteria 1462
291 Ga0495628_0000060 3300046516 Bacteria 87173
292 Ga0495628_0040550 3300046516 Bacteria 3720
293 Ga0495628_0253088 3300046516 Unclassified 1314
294 Ga0495630_0033260 3300046517 Bacteria 3844
295 Ga0495630_0066274 3300046517 Bacteria 2713
296 Ga0495632_0259873 3300046519 Bacteria 777
297 Ga0495666_0000912 3300046526 Bacteria 13858
298 Ga0495652_0000512 3300046529 Bacteria 45282
299 Ga0495652_0136792 3300046529 Bacteria 1932
300 Ga0495652_0306510 3300046529 Bacteria 1152
301 Ga0495665_0002396 3300046531 Bacteria 10132
302 Ga0495665_0035481 3300046531 Bacteria 2664
303 Ga0495640_0014095 3300046533 Bacteria 6060
304 Ga0495640_0094044 3300046533 Bacteria 1974
305 Ga0495587_0000062 3300046536 Bacteria 91862
306 Ga0495645_0000028 3300046543 Bacteria 113461
307 Ga0495645_0065883 3300046543 Bacteria 2620
308 Ga0495645_0215222 3300046543 Unclassified 1295
309 Ga0495667_0059731 3300046559 Bacteria 2502
310 Ga0495656_0019024 3300046615 Bacteria 2645
311 Ga0495634_0022839 3300046642 Bacteria 4404
312 Ga0495634_0382742 3300046642 Unclassified 838
313 Ga0495635_0034324 3300046663 Bacteria 3518
314 Ga0495659_0039736 3300046664 Bacteria 1674
315 Ga0495661_0217270 3300046665 Bacteria 992
316 Ga0495588_0071623 3300046674 Bacteria 1803
317 Ga0495657_0073692 3300046675 Bacteria 2223
318 Ga0495599_0000059 3300046678 Bacteria 75747
319 Ga0495599_0036390 3300046678 Bacteria 3091
320 Ga0495599_0130962 3300046678 Unclassified 1558
321 Ga0495623_0000082 3300046679 Bacteria 56315
322 Ga0495623_0333608 3300046679 Bacteria 830
323 Ga0495647_0000635 3300046681 Bacteria 10377
324 Ga0495647_0144128 3300046681 Bacteria 1017
325 Ga0495658_0004445 3300046683 Bacteria 6899
326 Ga0495613_0063430 3300046689 Bacteria 2703
327 Ga0495613_0074140 3300046689 Bacteria 2478
328 Ga0495613_0201062 3300046689 Bacteria 1405
329 Ga0495624_0042304 3300046690 Bacteria 2911
330 Ga0495624_0085707 3300046690 Bacteria 1946
331 Ga0495624_0287041 3300046690 Unclassified 993
332 Ga0495600_0018644 3300046809 Bacteria 4423
333 Ga0495600_0139599 3300046809 Bacteria 1573
334 Ga0495581_0000981 3300047315 Bacteria 15325
335 Ga0495581_0033812 3300047315 Bacteria 2959
336 Ga0495581_0540287 3300047315 Bacteria 677
337 Ga0495604_0000242 3300047317 Bacteria 48737
338 Ga0495604_0272646 3300047317 Bacteria 1146
339 Ga0495604_0523338 3300047317 Unclassified 767
340 Ga0495674_0056127 3300047319 Bacteria 3451
341 Ga0495674_0106332 3300047319 Bacteria 2383
342 Ga0495674_0198615 3300047319 Unclassified 1664
343 Ga0495676_0012366 3300047321 Bacteria 7691
344 Ga0495676_0132414 3300047321 Bacteria 1798
345 Ga0495680_0002795 3300047322 Bacteria 17584
346 Ga0495680_0132617 3300047322 Unclassified 1829
347 Ga0495675_0000020 3300047444 Bacteria 111526
348 Ga0495677_0010540 3300047445 Bacteria 3392
349 Ga0495679_032942 3300047446 Bacteria 1658
350 Ga0495684_0027952 3300047471 Bacteria 4332
351 Ga0495684_0130776 3300047471 Bacteria 1885
352 Ga0495593_0000688 3300047673 Bacteria 19498
353 Ga0495602_0000600 3300048088 Bacteria 33812
354 Ga0495614_0000811 3300048089 Bacteria 13202
355 Ga0496100_0037218 3300048903 Bacteria 3074
356 Ga0496100_0151016 3300048903 Bacteria 1657
357 Ga0496101_0010628 3300048904 Bacteria 6082
358 Ga0496101_0097378 3300048904 Bacteria 2197
359 Ga0496101_0221164 3300048904 Bacteria 1469
360 Ga0496102_0017048 3300048905 Bacteria 6357
361 Ga0496102_0028803 3300048905 Bacteria 4965
362 Ga0496102_0701628 3300048905 Bacteria 935
363 Ga0496104_0004281 3300048907 Bacteria 12408
364 Ga0496104_0122159 3300048907 Bacteria 2500
365 Ga0496104_0404973 3300048907 Bacteria 1276
366 Ga0496104_0428596 3300048907 Bacteria 1234
367 Ga0496105_0010217 3300048908 Bacteria 7377
368 Ga0496105_0024854 3300048908 Bacteria 4868
369 Ga0496105_0040669 3300048908 Bacteria 3833
370 Ga0496105_0396763 3300048908 Bacteria 1096
371 Ga0496106_0008122 3300048909 Bacteria 7751
372 Ga0496106_0124187 3300048909 Bacteria 2020
373 Ga0496106_0236846 3300048909 Unclassified 1458
374 Ga0496107_0017449 3300048910 Bacteria 5050
375 Ga0496107_0459419 3300048910 Bacteria 945
376 Ga0496108_0037944 3300048911 Bacteria 4014
377 Ga0496108_0049342 3300048911 Bacteria 3520
378 Ga0496108_0116868 3300048911 Bacteria 2285
379 Ga0496108_0318693 3300048911 Bacteria 1355
380 Ga0496108_0521366 3300048911 Bacteria 1037
381 Ga0496108_0710729 3300048911 Bacteria 871
382 Ga0496109_0021484 3300048912 Bacteria 5708
383 Ga0496109_0090580 3300048912 Bacteria 2828
384 Ga0496109_0460108 3300048912 Bacteria 1201
385 Ga0496109_0603313 3300048912 Bacteria 1034
386 Ga0496109_0754803 3300048912 Bacteria 910
387 Ga0496110_0063418 3300048913 Bacteria 3265
388 Ga0496111_0003260 3300048914 Bacteria 10027
389 Ga0496111_0092840 3300048914 Bacteria 2213
390 Ga0496111_0626935 3300048914 Bacteria 786
391 Ga0496112_0206079 3300048915 Bacteria 1924
392 Ga0496113_0271909 3300048916 Bacteria 1354
393 Ga0496114_0034046 3300048917 Bacteria 4201
394 Ga0496114_0174390 3300048917 Bacteria 1875
395 Ga0496115_0106250 3300048918 Bacteria 2304
396 Ga0496115_0128812 3300048918 Bacteria 2085
397 Ga0496115_0262054 3300048918 Bacteria 1421
398 Ga0496115_0925971 3300048918 Unclassified 670
399 nmdc:mga0k408_32253_c1 3300050493 Bacteria 2993
400 nmdc:mga05p37_1879559_c1 3300050507 Unclassified 573
401 nmdc:mga05p37_478955_c1 3300050507 Bacteria 1434
402 nmdc:mga05p37_827_c1 3300050507 Bacteria 34726
403 nmdc:mga08y16_582504_c1 3300050511 Bacteria 1129
404 nmdc:mga0rr50_205384_c1 3300050513 Bacteria 1621
405 Ga0495601_0041224 3300053077 Bacteria 2893
406 Ga0495601_0094024 3300053077 Bacteria 1931
407 Ga0495612_0028146 3300053078 Bacteria 2262
408 Ga0495612_0180751 3300053078 Unclassified 926
409 Ga0495595_0006432 3300053084 Bacteria 4792
410 Ga0495595_0070671 3300053084 Bacteria 1649
411 Ga0495619_0000316 3300053085 Bacteria 33863
412 Ga0495619_0233726 3300053085 Unclassified 1274
413 Ga0495619_0327534 3300053085 Unclassified 1060
414 Ga0500578_0033639 3300053086 Bacteria 3294
415 Ga0500644_0034071 3300053088 Bacteria 1641
416 Ga0500583_0000001 3300053092 Bacteria 241642
417 Ga0500583_0001510 3300053092 Bacteria 6700
418 Ga0500583_0282003 3300053092 Unclassified 816
419 Ga0500566_0253268 3300053094 Unclassified 855
420 Ga0500650_0027471 3300053098 Bacteria 2562
421 Ga0500556_0072417 3300053104 Unclassified 1290
422 Ga0500594_0051955 3300053118 Bacteria 1157
423 Ga0500658_0060814 3300053134 Bacteria 1570
424 Ga0500589_135900 3300053147 Unclassified 1020
425 Ga0500636_0154133 3300053177 Bacteria 1259
426 Ga0466962_0001544 3300061719 Bacteria 10757
427 Ga0466962_0031990 3300061719 Bacteria 2519
428 Ga0466962_0244646 3300061719 Bacteria 881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041404 Ga0439436_0042862 Ga0439436_0042862_44_454 135
2 3300041406 Ga0439439_0169389 Ga0439439_0169389_27_437 135
3 3300042532 Ga0450893_0148261 Ga0450893_0148261_77_487 135
4 3300044901 Ga0466960_0136174 Ga0466960_0136174_870_1283 136
5 3300009147 Ga0114129_10622371 Ga0114129_106223711 139
6 3300050507 nmdc:mga05p37_1879559_c1 nmdc:mga05p37_1879559_c1_28_528 139
7 3300009094 Ga0111539_10587038 Ga0111539_105870381 146
8 3300037312 Ga0395899_0179316 Ga0395899_0179316_27_470 147
9 3300044694 Ga0466963_0042132 Ga0466963_0042132_2443_2889 148
10 3300044694 Ga0466963_0570025 Ga0466963_0570025_341_787 148
11 3300045976 Ga0466967_0049803 Ga0466967_0049803_14_460 148
12 3300048918 Ga0496115_0925971 Ga0496115_0925971_22_468 148
13 3300014497 Ga0182008_10137429 Ga0182008_101374292 149
14 3300003323 rootH1_10011437 rootH1_1001143715 155
15 3300031456 Ga0307513_10387242 Ga0307513_103872421 155
16 3300041458 Ga0451798_1034019 Ga0451798_1034019_60_530 155
17 3300042014 Ga0439457_080694 Ga0439457_080694_119_589 155
18 3300053088 Ga0500644_0034071 Ga0500644_0034071_357_827 155
19 3300053098 Ga0500650_0027471 Ga0500650_0027471_1891_2361 155
20 3300053134 Ga0500658_0060814 Ga0500658_0060814_657_1127 155
21 3300053147 Ga0500589_135900 Ga0500589_135900_186_656 155
22 3300009174 Ga0105241_10072935 Ga0105241_100729353 156
23 3300009545 Ga0105237_10053098 Ga0105237_100530982 156
24 3300010375 Ga0105239_10013103 Ga0105239_100131034 156
25 3300013307 Ga0157372_12170941 Ga0157372_121709411 156
26 3300026041 Ga0207639_11749406 Ga0207639_117494061 156
27 3300027907 Ga0207428_10693575 Ga0207428_106935751 156
28 3300031456 Ga0307513_10269524 Ga0307513_102695242 156
29 3300031507 Ga0307509_10212456 Ga0307509_102124562 156
30 3300031507 Ga0307509_10745517 Ga0307509_107455171 156
31 3300041460 Ga0451802_1968786 Ga0451802_1968786_499_972 156
32 3300041512 Ga0451853_3027060 Ga0451853_3027060_37_510 156
33 3300042015 Ga0439462_0053367 Ga0439462_0053367_552_1028 156
34 3300044658 Ga0466972_0000080 Ga0466972_0000080_80317_80790 156
35 3300044658 Ga0466972_0035113 Ga0466972_0035113_177_650 156
36 3300044693 Ga0466961_0132329 Ga0466961_0132329_818_1291 156
37 3300044719 Ga0466971_0081682 Ga0466971_0081682_873_1346 156
38 3300045049 Ga0466959_0000014 Ga0466959_0000014_96581_97054 156
39 3300046519 Ga0495632_0259873 Ga0495632_0259873_227_700 156
40 3300050493 nmdc:mga0k408_32253_c1 nmdc:mga0k408_32253_c1_1202_1675 156
41 3300050507 nmdc:mga05p37_827_c1 nmdc:mga05p37_827_c1_12728_13201 156
42 3300053086 Ga0500578_0033639 Ga0500578_0033639_482_955 156
43 3300053092 Ga0500583_0000001 Ga0500583_0000001_87414_87887 156
44 3300053092 Ga0500583_0001510 Ga0500583_0001510_4418_4891 156
45 3300053092 Ga0500583_0282003 Ga0500583_0282003_327_803 156
46 3300053104 Ga0500556_0072417 Ga0500556_0072417_221_694 156
47 3300053118 Ga0500594_0051955 Ga0500594_0051955_364_837 156
48 3300053177 Ga0500636_0154133 Ga0500636_0154133_646_1119 156
49 3300061719 Ga0466962_0244646 Ga0466962_0244646_48_521 156
50 3300025915 Ga0207693_10613846 Ga0207693_106138461 157
51 iso_pu_bacteria 2738541278 2738725422 157
52 3300005327 Ga0070658_10349519 Ga0070658_103495192 160
53 3300005336 Ga0070680_100019999 Ga0070680_1000199993 160
54 3300005336 Ga0070680_100161874 Ga0070680_1001618742 160
55 3300005338 Ga0068868_100389924 Ga0068868_1003899242 160
56 3300005339 Ga0070660_100156831 Ga0070660_1001568314 160
57 3300005434 Ga0070709_10015557 Ga0070709_100155575 160
58 3300005434 Ga0070709_10027684 Ga0070709_100276843 160
59 3300005435 Ga0070714_100056406 Ga0070714_1000564063 160
60 3300005435 Ga0070714_100073037 Ga0070714_1000730374 160
61 3300005436 Ga0070713_100028856 Ga0070713_1000288563 160
62 3300005436 Ga0070713_100144771 Ga0070713_1001447713 160
63 3300005437 Ga0070710_10002388 Ga0070710_100023888 160
64 3300005437 Ga0070710_10009344 Ga0070710_100093444 160
65 3300005439 Ga0070711_100078990 Ga0070711_1000789902 160
66 3300005439 Ga0070711_100186920 Ga0070711_1001869202 160
67 3300005458 Ga0070681_10120433 Ga0070681_101204333 160
68 3300005458 Ga0070681_10256273 Ga0070681_102562733 160
69 3300005468 Ga0070707_100257499 Ga0070707_1002574993 160
70 3300005530 Ga0070679_100079334 Ga0070679_1000793343 160
71 3300005530 Ga0070679_100109728 Ga0070679_1001097282 160
72 3300005535 Ga0070684_100253566 Ga0070684_1002535661 160
73 3300005547 Ga0070693_100215234 Ga0070693_1002152341 160
74 3300005548 Ga0070665_100510968 Ga0070665_1005109682 160
75 3300005563 Ga0068855_100233751 Ga0068855_1002337513 160
76 3300005564 Ga0070664_100191800 Ga0070664_1001918002 160
77 3300005564 Ga0070664_100444041 Ga0070664_1004440412 160
78 3300005614 Ga0068856_100199317 Ga0068856_1001993172 160
79 3300005614 Ga0068856_100836682 Ga0068856_1008366822 160
80 3300005841 Ga0068863_100173649 Ga0068863_1001736493 160
81 3300006028 Ga0070717_10474223 Ga0070717_104742232 160
82 3300006163 Ga0070715_10000676 Ga0070715_100006764 160
83 3300006173 Ga0070716_100017986 Ga0070716_1000179865 160
84 3300006173 Ga0070716_100103457 Ga0070716_1001034572 160
85 3300006175 Ga0070712_100227235 Ga0070712_1002272352 160
86 3300009098 Ga0105245_10922181 Ga0105245_109221812 160
87 3300009101 Ga0105247_10068342 Ga0105247_100683423 160
88 3300010375 Ga0105239_10225673 Ga0105239_102256734 160
89 3300010375 Ga0105239_12270857 Ga0105239_122708572 160
90 3300013105 Ga0157369_10128821 Ga0157369_101288214 160
91 3300025898 Ga0207692_10005571 Ga0207692_100055715 160
92 3300025898 Ga0207692_10094172 Ga0207692_100941723 160
93 3300025900 Ga0207710_10059370 Ga0207710_100593703 160
94 3300025905 Ga0207685_10000478 Ga0207685_100004787 160
95 3300025906 Ga0207699_10018052 Ga0207699_100180525 160
96 3300025906 Ga0207699_10171059 Ga0207699_101710593 160
97 3300025912 Ga0207707_10426593 Ga0207707_104265932 160
98 3300025915 Ga0207693_10000282 Ga0207693_1000028254 160
99 3300025915 Ga0207693_10003548 Ga0207693_1000354815 160
100 3300025916 Ga0207663_10020012 Ga0207663_100200123 160
101 3300025916 Ga0207663_10308423 Ga0207663_103084232 160
102 3300025919 Ga0207657_10000847 Ga0207657_1000084727 160
103 3300025921 Ga0207652_10031526 Ga0207652_100315262 160
104 3300025921 Ga0207652_10981266 Ga0207652_109812662 160
105 3300025922 Ga0207646_10406900 Ga0207646_104069002 160
106 3300025927 Ga0207687_10428730 Ga0207687_104287302 160
107 3300025927 Ga0207687_10967204 Ga0207687_109672041 160
108 3300025928 Ga0207700_10054170 Ga0207700_100541703 160
109 3300025928 Ga0207700_10086176 Ga0207700_100861763 160
110 3300025929 Ga0207664_10016140 Ga0207664_100161404 160
111 3300025929 Ga0207664_10064755 Ga0207664_100647553 160
112 3300025931 Ga0207644_10967834 Ga0207644_109678342 160
113 3300025939 Ga0207665_10000835 Ga0207665_100008358 160
114 3300025939 Ga0207665_10041158 Ga0207665_100411584 160
115 3300025944 Ga0207661_10355252 Ga0207661_103552521 160
116 3300025949 Ga0207667_10881449 Ga0207667_108814492 160
117 3300026023 Ga0207677_10480530 Ga0207677_104805302 160
118 3300035090 Ga0373949_0088268 Ga0373949_0088268_258_761 160
119 3300035241 Ga0373961_0094464 Ga0373961_0094464_387_890 160
120 3300035410 Ga0373924_0206006 Ga0373924_0206006_48_551 160
121 3300035691 Ga0373931_0062174 Ga0373931_0062174_903_1385 160
122 3300037418 Ga0395900_0108275 Ga0395900_0108275_1167_1667 160
123 3300037466 Ga0395898_1962100 Ga0395898_1962100_10_492 160
124 3300037471 Ga0395905_0993925 Ga0395905_0993925_64_564 160
125 3300041406 Ga0439439_0001053 Ga0439439_0001053_1810_2298 160
126 3300042015 Ga0439462_0037102 Ga0439462_0037102_615_1103 160
127 3300044683 Ga0466965_0407568 Ga0466965_0407568_114_617 160
128 3300044694 Ga0466963_0020746 Ga0466963_0020746_100_603 160
129 3300044706 Ga0466964_0013190 Ga0466964_0013190_2464_2967 160
130 3300044735 Ga0466968_0002057 Ga0466968_0002057_6155_6637 160
131 3300044765 Ga0466970_0123690 Ga0466970_0123690_719_1201 160
132 3300045049 Ga0466959_0164974 Ga0466959_0164974_795_1277 160
133 3300045049 Ga0466959_0215740 Ga0466959_0215740_22_525 160
134 3300045976 Ga0466967_0234165 Ga0466967_0234165_944_1447 160
135 3300046516 Ga0495628_0040550 Ga0495628_0040550_906_1409 160
136 3300046529 Ga0495652_0306510 Ga0495652_0306510_543_1046 160
137 3300046543 Ga0495645_0065883 Ga0495645_0065883_883_1386 160
138 3300046678 Ga0495599_0036390 Ga0495599_0036390_2166_2669 160
139 3300046679 Ga0495623_0333608 Ga0495623_0333608_99_602 160
140 3300047317 Ga0495604_0272646 Ga0495604_0272646_52_555 160
141 3300048903 Ga0496100_0037218 Ga0496100_0037218_359_862 160
142 3300048904 Ga0496101_0097378 Ga0496101_0097378_542_1045 160
143 3300048904 Ga0496101_0221164 Ga0496101_0221164_967_1449 160
144 3300048905 Ga0496102_0017048 Ga0496102_0017048_2847_3329 160
145 3300048905 Ga0496102_0701628 Ga0496102_0701628_192_695 160
146 3300048907 Ga0496104_0404973 Ga0496104_0404973_579_1061 160
147 3300048907 Ga0496104_0428596 Ga0496104_0428596_444_947 160
148 3300048908 Ga0496105_0024854 Ga0496105_0024854_2824_3327 160
149 3300048908 Ga0496105_0396763 Ga0496105_0396763_412_915 160
150 3300048909 Ga0496106_0008122 Ga0496106_0008122_5021_5524 160
151 3300048909 Ga0496106_0124187 Ga0496106_0124187_747_1250 160
152 3300048910 Ga0496107_0017449 Ga0496107_0017449_2090_2572 160
153 3300048911 Ga0496108_0049342 Ga0496108_0049342_3012_3494 160
154 3300048911 Ga0496108_0116868 Ga0496108_0116868_597_1100 160
155 3300048911 Ga0496108_0318693 Ga0496108_0318693_18_500 160
156 3300048912 Ga0496109_0460108 Ga0496109_0460108_608_1090 160
157 3300048912 Ga0496109_0754803 Ga0496109_0754803_92_574 160
158 3300048913 Ga0496110_0063418 Ga0496110_0063418_326_829 160
159 3300048914 Ga0496111_0003260 Ga0496111_0003260_7049_7531 160
160 3300048914 Ga0496111_0092840 Ga0496111_0092840_797_1300 160
161 3300048915 Ga0496112_0206079 Ga0496112_0206079_1366_1848 160
162 3300048916 Ga0496113_0271909 Ga0496113_0271909_94_597 160
163 3300048917 Ga0496114_0034046 Ga0496114_0034046_471_974 160
164 3300048918 Ga0496115_0106250 Ga0496115_0106250_967_1449 160
165 3300061719 Ga0466962_0031990 Ga0466962_0031990_827_1330 160
166 3300003322 rootL2_10189630 rootL2_101896301 161
167 3300003322 rootL2_10195467 rootL2_101954671 161
168 3300005293 Ga0065715_10200879 Ga0065715_102008792 161
169 3300005295 Ga0065707_10157467 Ga0065707_101574671 161
170 3300005330 Ga0070690_100011449 Ga0070690_1000114493 161
171 3300005334 Ga0068869_100242311 Ga0068869_1002423112 161
172 3300005336 Ga0070680_100299929 Ga0070680_1002999293 161
173 3300005338 Ga0068868_100626978 Ga0068868_1006269782 161
174 3300005343 Ga0070687_100161595 Ga0070687_1001615953 161
175 3300005345 Ga0070692_10108070 Ga0070692_101080702 161
176 3300005345 Ga0070692_10201745 Ga0070692_102017451 161
177 3300005355 Ga0070671_100055366 Ga0070671_1000553664 161
178 3300005435 Ga0070714_100036852 Ga0070714_1000368524 161
179 3300005435 Ga0070714_100192080 Ga0070714_1001920802 161
180 3300005435 Ga0070714_100240772 Ga0070714_1002407723 161
181 3300005435 Ga0070714_101533607 Ga0070714_1015336071 161
182 3300005438 Ga0070701_10128058 Ga0070701_101280582 161
183 3300005439 Ga0070711_100409115 Ga0070711_1004091152 161
184 3300005444 Ga0070694_100125914 Ga0070694_1001259142 161
185 3300005459 Ga0068867_100089645 Ga0068867_1000896453 161
186 3300005468 Ga0070707_100000457 Ga0070707_10000045725 161
187 3300005530 Ga0070679_100694030 Ga0070679_1006940302 161
188 3300005535 Ga0070684_100260960 Ga0070684_1002609602 161
189 3300005539 Ga0068853_100526587 Ga0068853_1005265872 161
190 3300005543 Ga0070672_100122527 Ga0070672_1001225273 161
191 3300005544 Ga0070686_100799459 Ga0070686_1007994591 161
192 3300005549 Ga0070704_100228188 Ga0070704_1002281883 161
193 3300005563 Ga0068855_100029009 Ga0068855_1000290094 161
194 3300005578 Ga0068854_100375397 Ga0068854_1003753972 161
195 3300005578 Ga0068854_100537666 Ga0068854_1005376661 161
196 3300005614 Ga0068856_100272205 Ga0068856_1002722052 161
197 3300005614 Ga0068856_100622593 Ga0068856_1006225932 161
198 3300005615 Ga0070702_100094924 Ga0070702_1000949242 161
199 3300005719 Ga0068861_100367710 Ga0068861_1003677101 161
200 3300005840 Ga0068870_10122681 Ga0068870_101226812 161
201 3300006028 Ga0070717_10011887 Ga0070717_100118873 161
202 3300006175 Ga0070712_100596064 Ga0070712_1005960642 161
203 3300006195 Ga0075366_10029942 Ga0075366_100299423 161
204 3300006237 Ga0097621_100275327 Ga0097621_1002753272 161
205 3300006358 Ga0068871_100080201 Ga0068871_1000802012 161
206 3300006844 Ga0075428_100785643 Ga0075428_1007856432 161
207 3300006852 Ga0075433_10726841 Ga0075433_107268412 161
208 3300007076 Ga0075435_100242655 Ga0075435_1002426552 161
209 3300009093 Ga0105240_10193795 Ga0105240_101937952 161
210 3300009094 Ga0111539_10320308 Ga0111539_103203082 161
211 3300009094 Ga0111539_10322942 Ga0111539_103229422 161
212 3300009098 Ga0105245_10197958 Ga0105245_101979582 161
213 3300009098 Ga0105245_10293450 Ga0105245_102934502 161
214 3300009147 Ga0114129_10004956 Ga0114129_1000495611 161
215 3300009147 Ga0114129_10572035 Ga0114129_105720351 161
216 3300009174 Ga0105241_10149072 Ga0105241_101490722 161
217 3300009176 Ga0105242_10477033 Ga0105242_104770332 161
218 3300009177 Ga0105248_10836028 Ga0105248_108360282 161
219 3300010375 Ga0105239_10490103 Ga0105239_104901033 161
220 3300013105 Ga0157369_10063335 Ga0157369_100633354 161
221 3300013297 Ga0157378_10119715 Ga0157378_101197152 161
222 3300013297 Ga0157378_10232009 Ga0157378_102320091 161
223 3300013306 Ga0163162_10455206 Ga0163162_104552062 161
224 3300013307 Ga0157372_10549702 Ga0157372_105497022 161
225 3300014326 Ga0157380_10298215 Ga0157380_102982152 161
226 3300014497 Ga0182008_10040286 Ga0182008_100402862 161
227 3300014969 Ga0157376_10035382 Ga0157376_100353823 161
228 3300025246 Ga0209646_1001349 Ga0209646_10013493 161
229 3300025911 Ga0207654_10065365 Ga0207654_100653652 161
230 3300025911 Ga0207654_10187633 Ga0207654_101876331 161
231 3300025914 Ga0207671_10315521 Ga0207671_103155211 161
232 3300025915 Ga0207693_10095454 Ga0207693_100954543 161
233 3300025922 Ga0207646_10001031 Ga0207646_1000103113 161
234 3300025922 Ga0207646_10683486 Ga0207646_106834861 161
235 3300025923 Ga0207681_10069161 Ga0207681_100691612 161
236 3300025929 Ga0207664_10215587 Ga0207664_102155873 161
237 3300025942 Ga0207689_10188978 Ga0207689_101889783 161
238 3300025944 Ga0207661_10583689 Ga0207661_105836892 161
239 3300025949 Ga0207667_10039751 Ga0207667_100397514 161
240 3300025961 Ga0207712_10139232 Ga0207712_101392323 161
241 3300025981 Ga0207640_10419807 Ga0207640_104198072 161
242 3300026023 Ga0207677_10866049 Ga0207677_108660491 161
243 3300026075 Ga0207708_10006841 Ga0207708_100068418 161
244 3300026078 Ga0207702_10356134 Ga0207702_103561342 161
245 3300026078 Ga0207702_10775279 Ga0207702_107752792 161
246 3300026089 Ga0207648_10295988 Ga0207648_102959882 161
247 3300026116 Ga0207674_10041853 Ga0207674_100418535 161
248 3300026118 Ga0207675_100170791 Ga0207675_1001707913 161
249 3300026118 Ga0207675_100354439 Ga0207675_1003544392 161
250 3300028381 Ga0268264_10301733 Ga0268264_103017332 161
251 3300035089 Ga0373944_0203349 Ga0373944_0203349_102_599 161
252 3300035170 Ga0373943_0008419 Ga0373943_0008419_1673_2170 161
253 3300035692 Ga0373935_0033052 Ga0373935_0033052_1816_2313 161
254 3300035724 Ga0373933_0093961 Ga0373933_0093961_743_1228 161
255 3300035725 Ga0373947_0000995 Ga0373947_0000995_6703_7200 161
256 3300035725 Ga0373947_0182430 Ga0373947_0182430_249_755 161
257 3300036401 Ga0373937_0000364 Ga0373937_0000364_3901_4386 161
258 3300036401 Ga0373937_0916164 Ga0373937_0916164_197_703 161
259 3300041501 Ga0451845_0141715 Ga0451845_0141715_122_613 161
260 3300044656 Ga0466969_0000127 Ga0466969_0000127_22159_22653 161
261 3300044656 Ga0466969_0000542 Ga0466969_0000542_6541_7035 161
262 3300044683 Ga0466965_0090958 Ga0466965_0090958_280_783 161
263 3300044684 Ga0466966_0119437 Ga0466966_0119437_115_600 161
264 3300044684 Ga0466966_0145998 Ga0466966_0145998_26_529 161
265 3300044693 Ga0466961_0004696 Ga0466961_0004696_7580_8065 161
266 3300044693 Ga0466961_0058673 Ga0466961_0058673_1405_1899 161
267 3300044693 Ga0466961_0141432 Ga0466961_0141432_457_960 161
268 3300044694 Ga0466963_0011364 Ga0466963_0011364_2926_3429 161
269 3300044694 Ga0466963_0018657 Ga0466963_0018657_3540_4025 161
270 3300044694 Ga0466963_0023871 Ga0466963_0023871_1467_1961 161
271 3300044694 Ga0466963_0029232 Ga0466963_0029232_1771_2256 161
272 3300044694 Ga0466963_0034930 Ga0466963_0034930_18_524 161
273 3300044694 Ga0466963_0124057 Ga0466963_0124057_468_953 161
274 3300044706 Ga0466964_0022503 Ga0466964_0022503_485_970 161
275 3300044706 Ga0466964_0032807 Ga0466964_0032807_1205_1711 161
276 3300044706 Ga0466964_0175459 Ga0466964_0175459_128_631 161
277 3300044719 Ga0466971_0001047 Ga0466971_0001047_5349_5852 161
278 3300044735 Ga0466968_0003914 Ga0466968_0003914_14_508 161
279 3300044735 Ga0466968_0023219 Ga0466968_0023219_338_829 161
280 3300044735 Ga0466968_0034565 Ga0466968_0034565_412_897 161
281 3300044735 Ga0466968_0053503 Ga0466968_0053503_313_816 161
282 3300044765 Ga0466970_0025787 Ga0466970_0025787_269_763 161
283 3300044842 Ga0466957_0003320 Ga0466957_0003320_435_929 161
284 3300044842 Ga0466957_0052205 Ga0466957_0052205_37_543 161
285 3300044842 Ga0466957_0142911 Ga0466957_0142911_450_953 161
286 3300044842 Ga0466957_0225213 Ga0466957_0225213_425_928 161
287 3300044842 Ga0466957_0528701 Ga0466957_0528701_300_785 161
288 3300044842 Ga0466957_0546968 Ga0466957_0546968_292_777 161
289 3300045049 Ga0466959_0001373 Ga0466959_0001373_5193_5696 161
290 3300045049 Ga0466959_0087179 Ga0466959_0087179_849_1334 161
291 3300045049 Ga0466959_0287135 Ga0466959_0287135_71_565 161
292 3300045836 Ga0466958_0000730 Ga0466958_0000730_819_1322 161
293 3300045836 Ga0466958_0012562 Ga0466958_0012562_820_1323 161
294 3300045836 Ga0466958_0013203 Ga0466958_0013203_1916_2401 161
295 3300045836 Ga0466958_0248418 Ga0466958_0248418_193_687 161
296 3300045836 Ga0466958_0557390 Ga0466958_0557390_112_618 161
297 3300045976 Ga0466967_0020378 Ga0466967_0020378_134_619 161
298 3300045976 Ga0466967_0025350 Ga0466967_0025350_2118_2624 161
299 3300045976 Ga0466967_0026279 Ga0466967_0026279_3621_4106 161
300 3300045976 Ga0466967_0061052 Ga0466967_0061052_2301_2798 161
301 3300045976 Ga0466967_0070790 Ga0466967_0070790_1714_2217 161
302 3300045976 Ga0466967_0288995 Ga0466967_0288995_523_1029 161
303 3300046452 Ga0495617_153126 Ga0495617_153126_202_708 161
304 3300046454 Ga0495592_0000050 Ga0495592_0000050_69950_70435 161
305 3300046454 Ga0495592_0257857 Ga0495592_0257857_561_1067 161
306 3300046454 Ga0495592_0276931 Ga0495592_0276931_192_689 161
307 3300046455 Ga0495603_0007004 Ga0495603_0007004_4249_4734 161
308 3300046455 Ga0495603_0198754 Ga0495603_0198754_94_579 161
309 3300046459 Ga0495629_0087421 Ga0495629_0087421_1549_2055 161
310 3300046459 Ga0495629_0278271 Ga0495629_0278271_353_838 161
311 3300046461 Ga0495641_0021764 Ga0495641_0021764_1621_2118 161
312 3300046462 Ga0495651_0000028 Ga0495651_0000028_27717_28202 161
313 3300046462 Ga0495651_0084238 Ga0495651_0084238_1464_1961 161
314 3300046463 Ga0495653_0020152 Ga0495653_0020152_3866_4351 161
315 3300046463 Ga0495653_0043500 Ga0495653_0043500_1446_1943 161
316 3300046472 Ga0495580_0065629 Ga0495580_0065629_1988_2485 161
317 3300046473 Ga0495582_0001425 Ga0495582_0001425_7730_8227 161
318 3300046473 Ga0495582_0071744 Ga0495582_0071744_723_1208 161
319 3300046473 Ga0495582_0148481 Ga0495582_0148481_636_1142 161
320 3300046475 Ga0495639_0001265 Ga0495639_0001265_5825_6322 161
321 3300046476 Ga0495662_0021479 Ga0495662_0021479_2290_2796 161
322 3300046476 Ga0495662_0050659 Ga0495662_0050659_189_686 161
323 3300046476 Ga0495662_0219563 Ga0495662_0219563_305_790 161
324 3300046477 Ga0495664_0081771 Ga0495664_0081771_288_785 161
325 3300046492 Ga0495585_0055531 Ga0495585_0055531_454_960 161
326 3300046499 Ga0495594_0266522 Ga0495594_0266522_243_740 161
327 3300046511 Ga0495608_0004916 Ga0495608_0004916_2779_3264 161
328 3300046511 Ga0495608_0086404 Ga0495608_0086404_228_734 161
329 3300046511 Ga0495608_0436274 Ga0495608_0436274_265_771 161
330 3300046511 Ga0495608_0479345 Ga0495608_0479345_195_701 161
331 3300046514 Ga0495618_0001433 Ga0495618_0001433_3181_3666 161
332 3300046514 Ga0495618_0035750 Ga0495618_0035750_521_1018 161
333 3300046514 Ga0495618_0155001 Ga0495618_0155001_729_1214 161
334 3300046516 Ga0495628_0000060 Ga0495628_0000060_19961_20446 161
335 3300046516 Ga0495628_0253088 Ga0495628_0253088_227_724 161
336 3300046517 Ga0495630_0033260 Ga0495630_0033260_2622_3128 161
337 3300046517 Ga0495630_0066274 Ga0495630_0066274_116_613 161
338 3300046526 Ga0495666_0000912 Ga0495666_0000912_5375_5872 161
339 3300046529 Ga0495652_0000512 Ga0495652_0000512_15758_16243 161
340 3300046529 Ga0495652_0136792 Ga0495652_0136792_865_1362 161
341 3300046531 Ga0495665_0002396 Ga0495665_0002396_5777_6274 161
342 3300046531 Ga0495665_0035481 Ga0495665_0035481_34_540 161
343 3300046533 Ga0495640_0014095 Ga0495640_0014095_5022_5528 161
344 3300046533 Ga0495640_0094044 Ga0495640_0094044_31_528 161
345 3300046536 Ga0495587_0000062 Ga0495587_0000062_14107_14592 161
346 3300046543 Ga0495645_0000028 Ga0495645_0000028_6200_6685 161
347 3300046543 Ga0495645_0215222 Ga0495645_0215222_545_1042 161
348 3300046559 Ga0495667_0059731 Ga0495667_0059731_1971_2456 161
349 3300046615 Ga0495656_0019024 Ga0495656_0019024_1392_1898 161
350 3300046642 Ga0495634_0022839 Ga0495634_0022839_671_1168 161
351 3300046642 Ga0495634_0382742 Ga0495634_0382742_210_716 161
352 3300046663 Ga0495635_0034324 Ga0495635_0034324_2833_3330 161
353 3300046664 Ga0495659_0039736 Ga0495659_0039736_10_516 161
354 3300046665 Ga0495661_0217270 Ga0495661_0217270_142_648 161
355 3300046674 Ga0495588_0071623 Ga0495588_0071623_993_1478 161
356 3300046675 Ga0495657_0073692 Ga0495657_0073692_122_628 161
357 3300046678 Ga0495599_0000059 Ga0495599_0000059_66734_67219 161
358 3300046678 Ga0495599_0130962 Ga0495599_0130962_465_962 161
359 3300046679 Ga0495623_0000082 Ga0495623_0000082_14318_14803 161
360 3300046681 Ga0495647_0000635 Ga0495647_0000635_2464_2961 161
361 3300046681 Ga0495647_0144128 Ga0495647_0144128_422_928 161
362 3300046683 Ga0495658_0004445 Ga0495658_0004445_4529_5026 161
363 3300046689 Ga0495613_0063430 Ga0495613_0063430_1566_2072 161
364 3300046689 Ga0495613_0074140 Ga0495613_0074140_880_1377 161
365 3300046689 Ga0495613_0201062 Ga0495613_0201062_128_634 161
366 3300046690 Ga0495624_0042304 Ga0495624_0042304_58_555 161
367 3300046690 Ga0495624_0085707 Ga0495624_0085707_1229_1735 161
368 3300046690 Ga0495624_0287041 Ga0495624_0287041_304_810 161
369 3300046809 Ga0495600_0018644 Ga0495600_0018644_2874_3359 161
370 3300046809 Ga0495600_0139599 Ga0495600_0139599_1035_1541 161
371 3300047315 Ga0495581_0000981 Ga0495581_0000981_11820_12317 161
372 3300047315 Ga0495581_0033812 Ga0495581_0033812_2075_2581 161
373 3300047315 Ga0495581_0540287 Ga0495581_0540287_76_582 161
374 3300047317 Ga0495604_0000242 Ga0495604_0000242_25500_25985 161
375 3300047317 Ga0495604_0523338 Ga0495604_0523338_69_575 161
376 3300047319 Ga0495674_0056127 Ga0495674_0056127_2818_3324 161
377 3300047319 Ga0495674_0106332 Ga0495674_0106332_59_556 161
378 3300047319 Ga0495674_0198615 Ga0495674_0198615_59_556 161
379 3300047321 Ga0495676_0012366 Ga0495676_0012366_4550_5047 161
380 3300047321 Ga0495676_0132414 Ga0495676_0132414_653_1159 161
381 3300047322 Ga0495680_0002795 Ga0495680_0002795_11623_12108 161
382 3300047322 Ga0495680_0132617 Ga0495680_0132617_120_626 161
383 3300047444 Ga0495675_0000020 Ga0495675_0000020_41546_42031 161
384 3300047445 Ga0495677_0010540 Ga0495677_0010540_340_846 161
385 3300047446 Ga0495679_032942 Ga0495679_032942_847_1353 161
386 3300047471 Ga0495684_0027952 Ga0495684_0027952_1733_2239 161
387 3300047471 Ga0495684_0130776 Ga0495684_0130776_116_613 161
388 3300047673 Ga0495593_0000688 Ga0495593_0000688_5534_6031 161
389 3300048088 Ga0495602_0000600 Ga0495602_0000600_21737_22222 161
390 3300048089 Ga0495614_0000811 Ga0495614_0000811_8164_8661 161
391 3300048903 Ga0496100_0151016 Ga0496100_0151016_386_889 161
392 3300048904 Ga0496101_0010628 Ga0496101_0010628_3598_4101 161
393 3300048905 Ga0496102_0028803 Ga0496102_0028803_3525_4031 161
394 3300048907 Ga0496104_0004281 Ga0496104_0004281_2453_2959 161
395 3300048907 Ga0496104_0122159 Ga0496104_0122159_1275_1778 161
396 3300048908 Ga0496105_0010217 Ga0496105_0010217_4124_4630 161
397 3300048908 Ga0496105_0040669 Ga0496105_0040669_2861_3364 161
398 3300048909 Ga0496106_0236846 Ga0496106_0236846_854_1360 161
399 3300048910 Ga0496107_0459419 Ga0496107_0459419_139_642 161
400 3300048911 Ga0496108_0037944 Ga0496108_0037944_2481_2987 161
401 3300048911 Ga0496108_0521366 Ga0496108_0521366_512_1018 161
402 3300048911 Ga0496108_0710729 Ga0496108_0710729_277_780 161
403 3300048912 Ga0496109_0021484 Ga0496109_0021484_3956_4462 161
404 3300048912 Ga0496109_0090580 Ga0496109_0090580_1607_2113 161
405 3300048912 Ga0496109_0603313 Ga0496109_0603313_354_857 161
406 3300048914 Ga0496111_0626935 Ga0496111_0626935_291_776 161
407 3300048917 Ga0496114_0174390 Ga0496114_0174390_694_1197 161
408 3300048918 Ga0496115_0128812 Ga0496115_0128812_1171_1692 161
409 3300048918 Ga0496115_0262054 Ga0496115_0262054_791_1297 161
410 3300050507 nmdc:mga05p37_478955_c1 nmdc:mga05p37_478955_c1_625_1122 161
411 3300050511 nmdc:mga08y16_582504_c1 nmdc:mga08y16_582504_c1_115_615 161
412 3300050513 nmdc:mga0rr50_205384_c1 nmdc:mga0rr50_205384_c1_353_859 161
413 3300053077 Ga0495601_0041224 Ga0495601_0041224_19_504 161
414 3300053077 Ga0495601_0094024 Ga0495601_0094024_1319_1816 161
415 3300053078 Ga0495612_0028146 Ga0495612_0028146_1424_1921 161
416 3300053078 Ga0495612_0180751 Ga0495612_0180751_32_538 161
417 3300053084 Ga0495595_0006432 Ga0495595_0006432_3844_4350 161
418 3300053084 Ga0495595_0070671 Ga0495595_0070671_900_1385 161
419 3300053085 Ga0495619_0000316 Ga0495619_0000316_2361_2846 161
420 3300053085 Ga0495619_0233726 Ga0495619_0233726_118_624 161
421 3300053085 Ga0495619_0327534 Ga0495619_0327534_391_897 161
422 3300053094 Ga0500566_0253268 Ga0500566_0253268_150_647 161
423 3300061719 Ga0466962_0001544 Ga0466962_0001544_6131_6634 161
424 3300003316 rootH1_10012329 rootH1_1001232914 162
425 3300003316 rootH1_10156588 rootH1_101565882 162
426 3300003322 rootL2_10000665 rootL2_1000066513 162
427 3300005614 Ga0068856_100073233 Ga0068856_1000732332 162
428 3300026078 Ga0207702_10070486 Ga0207702_100704864 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

43

153

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

133

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

42

135

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9301 2 156
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9273 1 156
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.927 2 156
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9239 2 156
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.9223 2 158
ID Description Score Start End Superfamily
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9448 109 157 3.40.630.30
5dwmA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9283 2 158 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9217 2 156 3.40.630.30
af_A0A286YBP0_57_178_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9103 48 135 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9074 48 156 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7V9BFU2-F1-model_v4 N-acetyltransferase 0.9945 1 156 GO:0016747
AF-A0A538FGT3-F1-model_v4 N-acetyltransferase family protein 0.9941 4 133 GO:0016747
AF-A0A6I4I7J3-F1-model_v4 GNAT family N-acetyltransferase 0.9932 2 160 GO:0016747
GO:0046685
AF-A0A268HB43-F1-model_v4 N-acetyltransferase 0.9928 2 156 GO:0016747
AF-A0A0A3I3H9-F1-model_v4 Phosphinothricin acetyltransferase 0.9927 1 158 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map