F441601

General Info

Members Datasets Scaffolds Average Seq Length
428 221 856 269

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100541370|Ga0070680_1005413701
Length 278
Sequence MAMVSGLIRVMERAARKAGGRLRRDFGEVEHLQVSRKGPADFVSKADQAAERTLWDELRAARPDWGFLMEEGGEIPGEAGKPRFIIDPLDGTSNFLHGIPHFAISIAAQEPALDGKGPDGSGWGDVVAGVVYQPITDQTFWAEKNRGAWLQDARLRVSGRRQLSEALIATGSPYHGHGDFDEWSKILDAVGPQVAGIRRFGSAALDLAWVAAGRYDGFWESDLAPWDTAAGCMLVREAGGFVSDYRGRSLPICDKQIIAGNDPLHSRLHKIVAGLLKA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
199 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
205 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
206 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
207 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
208 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
209 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
210 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
211 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
212 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
213 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
214 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
215 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
216 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
217 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
218 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
219 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
220 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
221 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.03
Metatranscriptomes 0
Isolates 3.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 0.7
Rhizoplane 5.37
Rhizosphere 72.66
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100541370 3300005336 Bacteria 998
2 SwRhRL2b_contig_351495 2162886007 Bacteria 17555
3 SwRhRL2b_contig_382060 2162886007 Bacteria 8263
4 JGI24751J29686_10028598 3300002459 Bacteria 1157
5 Ga0055530_10031101 3300003791 Bacteria 1405
6 Ga0065704_10000272 3300005289 Bacteria 58483
7 Ga0065704_10070447 3300005289 Bacteria 24411
8 Ga0065707_10102912 3300005295 Bacteria 2778
9 Ga0065707_10115364 3300005295 Bacteria 2269
10 Ga0070658_10002758 3300005327 Bacteria 14622
11 Ga0070658_10003533 3300005327 Bacteria 12831
12 Ga0070658_10030009 3300005327 Bacteria 4369
13 Ga0070658_10153941 3300005327 Bacteria 1926
14 Ga0070658_10280760 3300005327 Bacteria 1417
15 Ga0070683_100160561 3300005329 Bacteria 2132
16 Ga0070670_100001762 3300005331 Bacteria 17610
17 Ga0070670_100051462 3300005331 Bacteria 3537
18 Ga0070670_100144070 3300005331 Bacteria 2061
19 Ga0070666_10000033 3300005335 Bacteria 121625
20 Ga0070666_10049116 3300005335 Bacteria 2835
21 Ga0070680_100001039 3300005336 Bacteria 19874
22 Ga0070682_100064093 3300005337 Bacteria 2332
23 Ga0070660_100010337 3300005339 Bacteria 6592
24 Ga0070660_100017544 3300005339 Bacteria 5219
25 Ga0070691_10031339 3300005341 Bacteria 2493
26 Ga0070661_100002136 3300005344 Bacteria 13619
27 Ga0070668_100002528 3300005347 Bacteria 13464
28 Ga0070668_100005027 3300005347 Bacteria 9796
29 Ga0070668_100105187 3300005347 Bacteria 2241
30 Ga0070668_100148823 3300005347 Bacteria 1892
31 Ga0070669_100000008 3300005353 Bacteria 226764
32 Ga0070669_100000419 3300005353 Bacteria 32460
33 Ga0070669_100000882 3300005353 Bacteria 21822
34 Ga0070669_100039675 3300005353 Bacteria 3422
35 Ga0070671_100000015 3300005355 Bacteria 166132
36 Ga0070671_100000054 3300005355 Bacteria 77908
37 Ga0070671_100003686 3300005355 Bacteria 12015
38 Ga0070671_100487319 3300005355 Bacteria 1060
39 Ga0070659_100008387 3300005366 Bacteria 7548
40 Ga0070659_100028679 3300005366 Bacteria 4301
41 Ga0070667_100002635 3300005367 Bacteria 15532
42 Ga0070667_100002900 3300005367 Bacteria 14733
43 Ga0070667_100010728 3300005367 Bacteria 7570
44 Ga0070667_100039892 3300005367 Bacteria 3936
45 Ga0070667_100359332 3300005367 Bacteria 1320
46 Ga0070714_100087937 3300005435 Bacteria 2718
47 Ga0070705_100048795 3300005440 Bacteria 2455
48 Ga0070663_100018874 3300005455 Bacteria 4533
49 Ga0070662_100001784 3300005457 Bacteria 13252
50 Ga0070662_100008789 3300005457 Bacteria 6588
51 Ga0070662_100122768 3300005457 Bacteria 1993
52 Ga0070681_10038927 3300005458 Bacteria 4767
53 Ga0070679_100015698 3300005530 Bacteria 7282
54 Ga0070679_100044309 3300005530 Bacteria 4432
55 Ga0070679_100046388 3300005530 Bacteria 4331
56 Ga0070679_100297606 3300005530 Bacteria 1564
57 Ga0068853_100000308 3300005539 Bacteria 34286
58 Ga0068853_100003578 3300005539 Bacteria 11898
59 Ga0070665_100000107 3300005548 Bacteria 156048
60 Ga0070665_100014004 3300005548 Bacteria 8065
61 Ga0070665_100031486 3300005548 Bacteria 5339
62 Ga0068855_100002587 3300005563 Bacteria 22297
63 Ga0068855_100023393 3300005563 Bacteria 7400
64 Ga0068855_100064782 3300005563 Bacteria 4262
65 Ga0068855_100448900 3300005563 Bacteria 1407
66 Ga0068855_100458279 3300005563 Bacteria 1391
67 Ga0070664_100001260 3300005564 Bacteria 20291
68 Ga0070664_100197212 3300005564 Bacteria 1795
69 Ga0068857_100016151 3300005577 Bacteria 6538
70 Ga0068857_100297860 3300005577 Bacteria 1486
71 Ga0068854_100000819 3300005578 Bacteria 18592
72 Ga0068854_100005829 3300005578 Bacteria 7801
73 Ga0068854_100041074 3300005578 Bacteria 3267
74 Ga0068856_100002779 3300005614 Bacteria 17922
75 Ga0068856_100028429 3300005614 Bacteria 5460
76 Ga0068852_100000761 3300005616 Bacteria 21244
77 Ga0068852_100067695 3300005616 Bacteria 3123
78 Ga0068859_100000236 3300005617 Bacteria 54634
79 Ga0068859_100012726 3300005617 Bacteria 8455
80 Ga0068864_100023168 3300005618 Bacteria 5213
81 Ga0068864_100136939 3300005618 Bacteria 2206
82 Ga0068864_100529778 3300005618 Bacteria 1137
83 Ga0068861_100002155 3300005719 Bacteria 12756
84 Ga0068863_100000072 3300005841 Bacteria 113996
85 Ga0068863_100007781 3300005841 Bacteria 10478
86 Ga0068863_100033217 3300005841 Bacteria 4916
87 Ga0068863_100172500 3300005841 Bacteria 2075
88 Ga0068858_100002064 3300005842 Bacteria 20445
89 Ga0068858_100029926 3300005842 Bacteria 5058
90 Ga0068858_100061791 3300005842 Bacteria 3463
91 Ga0068858_100206834 3300005842 Bacteria 1857
92 Ga0068860_100001133 3300005843 Bacteria 29286
93 Ga0068860_100015006 3300005843 Bacteria 7571
94 Ga0068860_100017545 3300005843 Bacteria 6975
95 Ga0068860_100024369 3300005843 Bacteria 5847
96 Ga0068860_100080894 3300005843 Bacteria 3089
97 Ga0068860_100216498 3300005843 Bacteria 1859
98 Ga0068862_100000169 3300005844 Bacteria 72633
99 Ga0068862_100009552 3300005844 Bacteria 8021
100 Ga0068862_100014636 3300005844 Bacteria 6516
101 Ga0068862_100053109 3300005844 Bacteria 3468
102 Ga0068862_100077104 3300005844 Bacteria 2885
103 Ga0075365_10000897 3300006038 Bacteria 12475
104 Ga0075368_10000066 3300006042 Bacteria 25572
105 Ga0075363_100002063 3300006048 Bacteria 8033
106 Ga0075364_10002279 3300006051 Bacteria 10746
107 Ga0075364_10078403 3300006051 Bacteria 2182
108 Ga0075432_10000702 3300006058 Bacteria 10327
109 Ga0075362_10000203 3300006177 Bacteria 16577
110 Ga0075362_10235697 3300006177 Bacteria 897
111 Ga0075367_10006966 3300006178 Bacteria 5757
112 Ga0075369_10004324 3300006186 Bacteria 5240
113 Ga0075366_10003956 3300006195 Bacteria 7907
114 Ga0075366_10072490 3300006195 Bacteria 2052
115 Ga0075370_10028889 3300006353 Bacteria 3085
116 Ga0097620_100000236 3300006931 Bacteria 54634
117 Ga0097620_100012726 3300006931 Bacteria 8455
118 Ga0079104_1026285 3300006946 Bacteria 1506
119 Ga0079104_1042313 3300006946 Bacteria 1056
120 Ga0105251_10002675 3300009011 Bacteria 13722
121 Ga0105251_10045445 3300009011 Bacteria 2117
122 Ga0105250_10004709 3300009092 Bacteria 6228
123 Ga0105240_10010715 3300009093 Bacteria 12862
124 Ga0105240_10026916 3300009093 Bacteria 7539
125 Ga0105240_10060781 3300009093 Bacteria 4710
126 Ga0105247_10000801 3300009101 Bacteria 24058
127 Ga0105247_10253894 3300009101 Bacteria 1203
128 Ga0105243_10047105 3300009148 Bacteria 3393
129 Ga0105248_10006586 3300009177 Bacteria 12737
130 Ga0105248_10035300 3300009177 Bacteria 5593
131 Ga0105248_10042808 3300009177 Bacteria 5078
132 Ga0105248_10264296 3300009177 Bacteria 1937
133 Ga0105248_10299346 3300009177 Bacteria 1811
134 Ga0105237_10013036 3300009545 Bacteria 8728
135 Ga0105237_10631313 3300009545 Bacteria 1078
136 Ga0105238_10079895 3300009551 Bacteria 3260
137 Ga0105249_10019092 3300009553 Bacteria 6116
138 Ga0105239_10000037 3300010375 Bacteria 206779
139 Ga0105239_10205007 3300010375 Bacteria 2210
140 Ga0105246_10000315 3300011119 Bacteria 25642
141 Ga0157373_10011894 3300013100 Bacteria 6394
142 Ga0157373_10030450 3300013100 Bacteria 3884
143 Ga0157371_10000802 3300013102 Bacteria 36039
144 Ga0157371_10047974 3300013102 Bacteria 3036
145 Ga0157371_10109965 3300013102 Bacteria 1956
146 Ga0157370_10003507 3300013104 Bacteria 18393
147 Ga0157370_10038987 3300013104 Bacteria 4594
148 Ga0157369_10001462 3300013105 Bacteria 28951
149 Ga0163162_10016535 3300013306 Bacteria 7209
150 Ga0163162_10023679 3300013306 Bacteria 6062
151 Ga0163162_10095174 3300013306 Bacteria 3065
152 Ga0157372_10000426 3300013307 Bacteria 46310
153 Ga0163163_10059268 3300014325 Bacteria 3786
154 Ga0157380_10082897 3300014326 Bacteria 2626
155 Ga0157380_10162818 3300014326 Bacteria 1941
156 Ga0157379_10026851 3300014968 Bacteria 5125
157 Ga0163161_10022111 3300017792 Bacteria 4476
158 Ga0209050_1000217 3300025298 Bacteria 128833
159 Ga0207697_10000222 3300025315 Bacteria 30741
160 Ga0207656_10126569 3300025321 Bacteria 1194
161 Ga0207696_1001056 3300025711 Bacteria 16311
162 Ga0207713_1001885 3300025735 Bacteria 15929
163 Ga0207713_1018632 3300025735 Bacteria 3430
164 Ga0207680_10000320 3300025903 Bacteria 22959
165 Ga0207705_10000023 3300025909 Bacteria 301755
166 Ga0207705_10003603 3300025909 Bacteria 11792
167 Ga0207705_10018396 3300025909 Bacteria 4997
168 Ga0207705_10067395 3300025909 Bacteria 2590
169 Ga0207707_10113928 3300025912 Bacteria 2363
170 Ga0207695_10001017 3300025913 Bacteria 49429
171 Ga0207695_10097296 3300025913 Bacteria 2944
172 Ga0207671_10004808 3300025914 Bacteria 12723
173 Ga0207660_10013153 3300025917 Bacteria 5419
174 Ga0207657_10000453 3300025919 Bacteria 43584
175 Ga0207649_10000811 3300025920 Bacteria 20073
176 Ga0207652_10001831 3300025921 Bacteria 18431
177 Ga0207652_10004191 3300025921 Bacteria 11762
178 Ga0207652_10036333 3300025921 Bacteria 4165
179 Ga0207652_10137499 3300025921 Bacteria 2183
180 Ga0207652_10322681 3300025921 Bacteria 1394
181 Ga0207681_10000002 3300025923 Bacteria 985597
182 Ga0207681_10002226 3300025923 Bacteria 12338
183 Ga0207681_10002890 3300025923 Bacteria 10855
184 Ga0207681_10004072 3300025923 Bacteria 9057
185 Ga0207650_10015017 3300025925 Bacteria 5386
186 Ga0207650_10135272 3300025925 Bacteria 1933
187 Ga0207644_10000002 3300025931 Bacteria 942221
188 Ga0207644_10000003 3300025931 Bacteria 585905
189 Ga0207644_10009774 3300025931 Bacteria 6306
190 Ga0207644_10035357 3300025931 Bacteria 3500
191 Ga0207644_10099210 3300025931 Bacteria 2185
192 Ga0207690_10002152 3300025932 Bacteria 12054
193 Ga0207706_10000420 3300025933 Bacteria 45587
194 Ga0207706_10028354 3300025933 Bacteria 5001
195 Ga0207706_10213110 3300025933 Bacteria 1692
196 Ga0207670_10286084 3300025936 Bacteria 1286
197 Ga0207711_10025561 3300025941 Bacteria 4953
198 Ga0207711_10133614 3300025941 Bacteria 2226
199 Ga0207711_10531249 3300025941 Bacteria 1097
200 Ga0207679_10004032 3300025945 Bacteria 9120
201 Ga0207679_10022506 3300025945 Bacteria 4294
202 Ga0207667_10002181 3300025949 Bacteria 24562
203 Ga0207667_10011373 3300025949 Bacteria 10350
204 Ga0207667_10031449 3300025949 Bacteria 5730
205 Ga0207667_10035595 3300025949 Bacteria 5341
206 Ga0207712_10013314 3300025961 Bacteria 5274
207 Ga0207668_10000476 3300025972 Bacteria 25131
208 Ga0207668_10366703 3300025972 Bacteria 1208
209 Ga0207640_10000394 3300025981 Bacteria 27805
210 Ga0207640_10018514 3300025981 Bacteria 4095
211 Ga0207640_10139464 3300025981 Bacteria 1765
212 Ga0207658_10010000 3300025986 Bacteria 6447
213 Ga0207658_10012932 3300025986 Bacteria 5700
214 Ga0207658_10015198 3300025986 Bacteria 5280
215 Ga0207658_10035757 3300025986 Bacteria 3558
216 Ga0207658_10036087 3300025986 Bacteria 3544
217 Ga0207703_10001872 3300026035 Bacteria 18718
218 Ga0207703_10009303 3300026035 Bacteria 7723
219 Ga0207703_10193936 3300026035 Bacteria 1801
220 Ga0207639_10001180 3300026041 Bacteria 17752
221 Ga0207639_10004971 3300026041 Bacteria 8956
222 Ga0207702_10005487 3300026078 Bacteria 11088
223 Ga0207702_10008233 3300026078 Bacteria 8815
224 Ga0207641_10000084 3300026088 Bacteria 133555
225 Ga0207641_10003617 3300026088 Bacteria 13640
226 Ga0207641_10004716 3300026088 Bacteria 11757
227 Ga0207641_10075974 3300026088 Bacteria 2903
228 Ga0207641_10177195 3300026088 Bacteria 1950
229 Ga0207676_10020786 3300026095 Bacteria 4807
230 Ga0207676_10424146 3300026095 Bacteria 1248
231 Ga0207676_10533074 3300026095 Bacteria 1119
232 Ga0207674_10017729 3300026116 Bacteria 7760
233 Ga0207674_10307044 3300026116 Bacteria 1535
234 Ga0207674_10353695 3300026116 Bacteria 1420
235 Ga0207675_100000679 3300026118 Bacteria 33420
236 Ga0207698_10000141 3300026142 Bacteria 45510
237 Ga0209281_1022238 3300027111 Bacteria 1216
238 Ga0209813_10000142 3300027866 Bacteria 25031
239 Ga0268266_10000354 3300028379 Bacteria 70983
240 Ga0268266_10033300 3300028379 Bacteria 4381
241 Ga0268265_10000497 3300028380 Bacteria 40721
242 Ga0268265_10015205 3300028380 Bacteria 5261
243 Ga0268265_10017126 3300028380 Bacteria 4993
244 Ga0268265_10030265 3300028380 Bacteria 3896
245 Ga0268265_10154186 3300028380 Bacteria 1941
246 Ga0268265_10272750 3300028380 Bacteria 1510
247 Ga0268264_10000010 3300028381 Bacteria 596543
248 Ga0268264_10002419 3300028381 Bacteria 16426
249 Ga0268264_10004524 3300028381 Bacteria 11851
250 Ga0268264_10085428 3300028381 Bacteria 2708
251 Ga0268264_10181852 3300028381 Bacteria 1910
252 Ga0265331_10093741 3300031250 Bacteria 1386
253 Ga0307408_100018505 3300031548 Bacteria 4677
254 Ga0307408_100208838 3300031548 Bacteria 1585
255 Ga0316579_10079203 3300031691 Bacteria 1563
256 Ga0307405_10021792 3300031731 Bacteria 3609
257 Ga0307405_10093746 3300031731 Bacteria 1995
258 Ga0307405_10331781 3300031731 Bacteria 1166
259 Ga0307405_10565278 3300031731 Bacteria 923
260 Ga0307413_10019736 3300031824 Bacteria 3569
261 Ga0307413_10035128 3300031824 Bacteria 2872
262 Ga0307410_10116855 3300031852 Bacteria 1939
263 Ga0307406_10089646 3300031901 Bacteria 2067
264 Ga0307407_10099717 3300031903 Bacteria 1800
265 Ga0307412_10006701 3300031911 Bacteria 6530
266 Ga0307412_10028938 3300031911 Bacteria 3473
267 Ga0307412_10133664 3300031911 Bacteria 1806
268 Ga0307412_10369546 3300031911 Bacteria 1157
269 Ga0307409_100128605 3300031995 Bacteria 2160
270 Ga0307416_100059571 3300032002 Bacteria 3103
271 Ga0307416_100483998 3300032002 Bacteria 1298
272 Ga0307414_10000696 3300032004 Bacteria 17248
273 Ga0307414_10137809 3300032004 Bacteria 1905
274 Ga0307414_10161354 3300032004 Bacteria 1781
275 Ga0307414_10167821 3300032004 Bacteria 1751
276 Ga0307414_10168890 3300032004 Bacteria 1746
277 Ga0307411_10012193 3300032005 Bacteria 4677
278 Ga0307411_10074760 3300032005 Bacteria 2310
279 Ga0307415_100018018 3300032126 Bacteria 4251
280 Ga0307415_100044784 3300032126 Bacteria 2961
281 Ga0316583_10016875 3300032133 Bacteria 2626
282 Ga0316582_0048855 3300036647 Bacteria 2676
283 Ga0436365_0052761 3300039437 Bacteria 1016
284 Ga0451853_0097154 3300041512 Bacteria 1173
285 Ga0450912_002105 3300042116 Bacteria 1305
286 Ga0451576_0000007 3300045051 Bacteria 782228
287 Ga0451576_0375990 3300045051 Bacteria 1489
288 Ga0495627_000159 3300046453 Bacteria 76595
289 Ga0495638_0143999 3300046460 Bacteria 1388
290 Ga0495650_0001292 3300046471 Bacteria 25491
291 Ga0495596_0000133 3300046500 Bacteria 51283
292 Ga0495596_0000868 3300046500 Bacteria 18199
293 Ga0495607_0003515 3300046501 Bacteria 11972
294 Ga0495607_0066405 3300046501 Bacteria 2030
295 Ga0495606_0039060 3300046507 Bacteria 3205
296 Ga0495610_0000044 3300046512 Bacteria 156847
297 Ga0495610_0000883 3300046512 Bacteria 27894
298 Ga0495610_0004014 3300046512 Bacteria 11107
299 Ga0495620_0019690 3300046515 Bacteria 3313
300 Ga0495631_0030469 3300046518 Bacteria 2447
301 Ga0495632_0000272 3300046519 Bacteria 51232
302 Ga0495643_0000448 3300046522 Bacteria 53058
303 Ga0495643_0031411 3300046522 Bacteria 2954
304 Ga0495643_0069928 3300046522 Bacteria 1844
305 Ga0495643_0073220 3300046522 Bacteria 1795
306 Ga0495654_0109718 3300046530 Bacteria 1260
307 Ga0495609_0031983 3300046538 Bacteria 2391
308 Ga0495621_0037458 3300046539 Bacteria 1687
309 Ga0495622_0161075 3300046557 Bacteria 1012
310 Ga0495633_0069257 3300046558 Bacteria 1647
311 Ga0495625_0007823 3300046660 Bacteria 9214
312 Ga0495625_0014805 3300046660 Bacteria 6208
313 Ga0495671_0025929 3300046692 Bacteria 3043
314 Ga0495681_0000014 3300047470 Bacteria 184395
315 Ga0495615_0000168 3300048090 Bacteria 16242
316 Ga0495626_0003135 3300048091 Bacteria 10826
317 Ga0496100_0007811 3300048903 Bacteria 5933
318 Ga0496100_0138432 3300048903 Bacteria 1722
319 Ga0496101_0030000 3300048904 Bacteria 3807
320 Ga0496102_0000865 3300048905 Bacteria 28942
321 Ga0496103_0000038 3300048906 Bacteria 178822
322 Ga0496103_0014945 3300048906 Bacteria 4614
323 Ga0496104_0000123 3300048907 Bacteria 71754
324 Ga0496104_0012826 3300048907 Bacteria 7548
325 Ga0496104_0070467 3300048907 Bacteria 3323
326 Ga0496105_0000165 3300048908 Bacteria 43988
327 Ga0496105_0002963 3300048908 Bacteria 12460
328 Ga0496106_0000675 3300048909 Bacteria 24457
329 Ga0496107_0000841 3300048910 Bacteria 17964
330 Ga0496107_0009387 3300048910 Bacteria 6784
331 Ga0496109_0096907 3300048912 Bacteria 2733
332 Ga0496109_0104748 3300048912 Bacteria 2626
333 Ga0496110_0146433 3300048913 Bacteria 2136
334 Ga0496111_0112066 3300048914 Bacteria 2010
335 Ga0496111_0200039 3300048914 Bacteria 1485
336 Ga0496112_0011118 3300048915 Bacteria 8204
337 Ga0496113_0000130 3300048916 Bacteria 32692
338 Ga0496113_0004313 3300048916 Bacteria 8713
339 Ga0496114_0165376 3300048917 Bacteria 1926
340 Ga0496116_0000039 3300048919 Bacteria 349134
341 Ga0496116_0026567 3300048919 Bacteria 4231
342 Ga0496116_0212297 3300048919 Bacteria 1001
343 Ga0496117_0003052 3300048920 Bacteria 20068
344 Ga0496117_0012176 3300048920 Bacteria 7616
345 Ga0496117_0147991 3300048920 Bacteria 1394
346 Ga0496117_0168598 3300048920 Bacteria 1273
347 Ga0496118_0006710 3300048921 Bacteria 12541
348 Ga0496118_0019578 3300048921 Bacteria 6042
349 Ga0496118_0070513 3300048921 Bacteria 2523
350 Ga0496119_0001044 3300048922 Bacteria 35405
351 Ga0496120_0001980 3300048923 Bacteria 22318
352 Ga0496120_0030509 3300048923 Bacteria 3276
353 Ga0496121_0000022 3300048924 Bacteria 472849
354 Ga0496121_0000136 3300048924 Bacteria 165350
355 Ga0496121_0009176 3300048924 Bacteria 11433
356 Ga0496121_0017382 3300048924 Bacteria 7350
357 Ga0496121_0049324 3300048924 Bacteria 3570
358 Ga0496121_0068450 3300048924 Bacteria 2872
359 Ga0496121_0081371 3300048924 Bacteria 2563
360 Ga0496122_0000841 3300048925 Bacteria 58100
361 Ga0496122_0001814 3300048925 Bacteria 32677
362 Ga0496122_0015061 3300048925 Bacteria 7422
363 Ga0496123_0001492 3300048926 Bacteria 32495
364 Ga0496123_0001895 3300048926 Bacteria 27301
365 Ga0496123_0002030 3300048926 Bacteria 26140
366 Ga0496124_0002406 3300048927 Bacteria 24542
367 Ga0496124_0021907 3300048927 Bacteria 5878
368 Ga0496124_0072908 3300048927 Bacteria 2842
369 Ga0496125_0001376 3300048928 Bacteria 35709
370 Ga0496125_0067516 3300048928 Bacteria 2817
371 Ga0496125_0069105 3300048928 Bacteria 2773
372 Ga0496125_0071605 3300048928 Bacteria 2707
373 Ga0496126_0000041 3300048929 Bacteria 340389
374 Ga0496126_0000066 3300048929 Bacteria 252188
375 Ga0496126_0062672 3300048929 Bacteria 3336
376 Ga0496126_0100557 3300048929 Bacteria 2530
377 Ga0501034_0257404 3300049571 Bacteria 1689
378 Ga0501042_0268943 3300049578 Bacteria 1231
379 Ga0501047_0157606 3300049581 Bacteria 2143
380 Ga0501047_0259592 3300049581 Bacteria 1585
381 Ga0501047_0278475 3300049581 Bacteria 1518
382 Ga0501044_0188400 3300049823 Bacteria 2027
383 Ga0501044_0496443 3300049823 Bacteria 1122
384 nmdc:mga03683_6157_c1 3300050489 Bacteria 4096
385 nmdc:mga03n38_17135_c1 3300050490 Bacteria 2832
386 nmdc:mga00v17_20665_c1 3300050491 Bacteria 1530
387 nmdc:mga00v17_5693_c1 3300050491 Bacteria 6580
388 nmdc:mga0yw44_177244_c1 3300050492 Bacteria 1402
389 nmdc:mga0k408_148339_c1 3300050493 Bacteria 1396
390 nmdc:mga0k408_8127_c1 3300050493 Bacteria 5622
391 nmdc:mga06z11_218_c1 3300050494 Bacteria 22852
392 nmdc:mga04h51_76_c1 3300050495 Bacteria 31783
393 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
394 nmdc:mga0sz30_5071_c2 3300050516 Bacteria 4255
395 nmdc:mga0sz30_85_c1 3300050516 Bacteria 36243
396 Ga0500643_000001 3300053087 Bacteria 1440111
397 Ga0500643_008894 3300053087 Bacteria 3893
398 Ga0500643_011609 3300053087 Bacteria 3201
399 Ga0500650_0084620 3300053098 Bacteria 1484
400 Ga0500556_0000040 3300053104 Bacteria 137489
401 Ga0500608_023441 3300053122 Bacteria 2873
402 Ga0500618_000600 3300053125 Bacteria 22142
403 Ga0500618_013747 3300053125 Bacteria 2084
404 Ga0500642_0000003 3300053130 Bacteria 544899
405 Ga0500564_084007 3300053138 Bacteria 1424
406 Ga0500588_0035748 3300053146 Bacteria 1464
407 Ga0500590_000253 3300053148 Bacteria 16547
408 Ga0500616_0008166 3300053153 Bacteria 6536
409 Ga0500624_000358 3300053157 Bacteria 14804
410 Ga0500645_001317 3300053730 Bacteria 12876
411 Ga0500645_012520 3300053730 Bacteria 2739
412 2511125775 2510917021 Bacteria 5705459
413 2643949139 2643221588 Bacteria 3692460
414 2738711757 2738541275 Bacteria 4830863
415 2738850182 2738541301 Bacteria 4834102
416 2738865911 2738541304 Bacteria 4833665
417 2739298429 2738543022 Bacteria 4835059
418 2739360107 2738543033 Bacteria 4833336
419 2819550607 2818991438 Bacteria 5793701
420 2848299798 2848297114 Bacteria 3608511
421 2882807942 2882806704 Bacteria 3007728
422 2896184721 2896184354 Bacteria 3258548
423 2896255364 2896253425 Bacteria 3418029
424 2919139974 2919138771 Bacteria 5281312
425 2928101590 2928100450 Bacteria 4837635
426 2928959681 2928959182 Bacteria 4725774
427 3000866257 3000865235 Bacteria 3106258
428 8054305711 8054302542 Bacteria 5698134
429 Ga0070680_100541370
430 SwRhRL2b_contig_351495
431 SwRhRL2b_contig_382060
432 JGI24751J29686_10028598
433 Ga0055530_10031101
434 Ga0065704_10000272
435 Ga0065704_10070447
436 Ga0065707_10102912
437 Ga0065707_10115364
438 Ga0070658_10002758
439 Ga0070658_10003533
440 Ga0070658_10030009
441 Ga0070658_10153941
442 Ga0070658_10280760
443 Ga0070683_100160561
444 Ga0070670_100001762
445 Ga0070670_100051462
446 Ga0070670_100144070
447 Ga0070666_10000033
448 Ga0070666_10049116
449 Ga0070680_100001039
450 Ga0070682_100064093
451 Ga0070660_100010337
452 Ga0070660_100017544
453 Ga0070691_10031339
454 Ga0070661_100002136
455 Ga0070668_100002528
456 Ga0070668_100005027
457 Ga0070668_100105187
458 Ga0070668_100148823
459 Ga0070669_100000008
460 Ga0070669_100000419
461 Ga0070669_100000882
462 Ga0070669_100039675
463 Ga0070671_100000015
464 Ga0070671_100000054
465 Ga0070671_100003686
466 Ga0070671_100487319
467 Ga0070659_100008387
468 Ga0070659_100028679
469 Ga0070667_100002635
470 Ga0070667_100002900
471 Ga0070667_100010728
472 Ga0070667_100039892
473 Ga0070667_100359332
474 Ga0070714_100087937
475 Ga0070705_100048795
476 Ga0070663_100018874
477 Ga0070662_100001784
478 Ga0070662_100008789
479 Ga0070662_100122768
480 Ga0070681_10038927
481 Ga0070679_100015698
482 Ga0070679_100044309
483 Ga0070679_100046388
484 Ga0070679_100297606
485 Ga0068853_100000308
486 Ga0068853_100003578
487 Ga0070665_100000107
488 Ga0070665_100014004
489 Ga0070665_100031486
490 Ga0068855_100002587
491 Ga0068855_100023393
492 Ga0068855_100064782
493 Ga0068855_100448900
494 Ga0068855_100458279
495 Ga0070664_100001260
496 Ga0070664_100197212
497 Ga0068857_100016151
498 Ga0068857_100297860
499 Ga0068854_100000819
500 Ga0068854_100005829
501 Ga0068854_100041074
502 Ga0068856_100002779
503 Ga0068856_100028429
504 Ga0068852_100000761
505 Ga0068852_100067695
506 Ga0068859_100000236
507 Ga0068859_100012726
508 Ga0068864_100023168
509 Ga0068864_100136939
510 Ga0068864_100529778
511 Ga0068861_100002155
512 Ga0068863_100000072
513 Ga0068863_100007781
514 Ga0068863_100033217
515 Ga0068863_100172500
516 Ga0068858_100002064
517 Ga0068858_100029926
518 Ga0068858_100061791
519 Ga0068858_100206834
520 Ga0068860_100001133
521 Ga0068860_100015006
522 Ga0068860_100017545
523 Ga0068860_100024369
524 Ga0068860_100080894
525 Ga0068860_100216498
526 Ga0068862_100000169
527 Ga0068862_100009552
528 Ga0068862_100014636
529 Ga0068862_100053109
530 Ga0068862_100077104
531 Ga0075365_10000897
532 Ga0075368_10000066
533 Ga0075363_100002063
534 Ga0075364_10002279
535 Ga0075364_10078403
536 Ga0075432_10000702
537 Ga0075362_10000203
538 Ga0075362_10235697
539 Ga0075367_10006966
540 Ga0075369_10004324
541 Ga0075366_10003956
542 Ga0075366_10072490
543 Ga0075370_10028889
544 Ga0097620_100000236
545 Ga0097620_100012726
546 Ga0079104_1026285
547 Ga0079104_1042313
548 Ga0105251_10002675
549 Ga0105251_10045445
550 Ga0105250_10004709
551 Ga0105240_10010715
552 Ga0105240_10026916
553 Ga0105240_10060781
554 Ga0105247_10000801
555 Ga0105247_10253894
556 Ga0105243_10047105
557 Ga0105248_10006586
558 Ga0105248_10035300
559 Ga0105248_10042808
560 Ga0105248_10264296
561 Ga0105248_10299346
562 Ga0105237_10013036
563 Ga0105237_10631313
564 Ga0105238_10079895
565 Ga0105249_10019092
566 Ga0105239_10000037
567 Ga0105239_10205007
568 Ga0105246_10000315
569 Ga0157373_10011894
570 Ga0157373_10030450
571 Ga0157371_10000802
572 Ga0157371_10047974
573 Ga0157371_10109965
574 Ga0157370_10003507
575 Ga0157370_10038987
576 Ga0157369_10001462
577 Ga0163162_10016535
578 Ga0163162_10023679
579 Ga0163162_10095174
580 Ga0157372_10000426
581 Ga0163163_10059268
582 Ga0157380_10082897
583 Ga0157380_10162818
584 Ga0157379_10026851
585 Ga0163161_10022111
586 Ga0209050_1000217
587 Ga0207697_10000222
588 Ga0207656_10126569
589 Ga0207696_1001056
590 Ga0207713_1001885
591 Ga0207713_1018632
592 Ga0207680_10000320
593 Ga0207705_10000023
594 Ga0207705_10003603
595 Ga0207705_10018396
596 Ga0207705_10067395
597 Ga0207707_10113928
598 Ga0207695_10001017
599 Ga0207695_10097296
600 Ga0207671_10004808
601 Ga0207660_10013153
602 Ga0207657_10000453
603 Ga0207649_10000811
604 Ga0207652_10001831
605 Ga0207652_10004191
606 Ga0207652_10036333
607 Ga0207652_10137499
608 Ga0207652_10322681
609 Ga0207681_10000002
610 Ga0207681_10002226
611 Ga0207681_10002890
612 Ga0207681_10004072
613 Ga0207650_10015017
614 Ga0207650_10135272
615 Ga0207644_10000002
616 Ga0207644_10000003
617 Ga0207644_10009774
618 Ga0207644_10035357
619 Ga0207644_10099210
620 Ga0207690_10002152
621 Ga0207706_10000420
622 Ga0207706_10028354
623 Ga0207706_10213110
624 Ga0207670_10286084
625 Ga0207711_10025561
626 Ga0207711_10133614
627 Ga0207711_10531249
628 Ga0207679_10004032
629 Ga0207679_10022506
630 Ga0207667_10002181
631 Ga0207667_10011373
632 Ga0207667_10031449
633 Ga0207667_10035595
634 Ga0207712_10013314
635 Ga0207668_10000476
636 Ga0207668_10366703
637 Ga0207640_10000394
638 Ga0207640_10018514
639 Ga0207640_10139464
640 Ga0207658_10010000
641 Ga0207658_10012932
642 Ga0207658_10015198
643 Ga0207658_10035757
644 Ga0207658_10036087
645 Ga0207703_10001872
646 Ga0207703_10009303
647 Ga0207703_10193936
648 Ga0207639_10001180
649 Ga0207639_10004971
650 Ga0207702_10005487
651 Ga0207702_10008233
652 Ga0207641_10000084
653 Ga0207641_10003617
654 Ga0207641_10004716
655 Ga0207641_10075974
656 Ga0207641_10177195
657 Ga0207676_10020786
658 Ga0207676_10424146
659 Ga0207676_10533074
660 Ga0207674_10017729
661 Ga0207674_10307044
662 Ga0207674_10353695
663 Ga0207675_100000679
664 Ga0207698_10000141
665 Ga0209281_1022238
666 Ga0209813_10000142
667 Ga0268266_10000354
668 Ga0268266_10033300
669 Ga0268265_10000497
670 Ga0268265_10015205
671 Ga0268265_10017126
672 Ga0268265_10030265
673 Ga0268265_10154186
674 Ga0268265_10272750
675 Ga0268264_10000010
676 Ga0268264_10002419
677 Ga0268264_10004524
678 Ga0268264_10085428
679 Ga0268264_10181852
680 Ga0265331_10093741
681 Ga0307408_100018505
682 Ga0307408_100208838
683 Ga0316579_10079203
684 Ga0307405_10021792
685 Ga0307405_10093746
686 Ga0307405_10331781
687 Ga0307405_10565278
688 Ga0307413_10019736
689 Ga0307413_10035128
690 Ga0307410_10116855
691 Ga0307406_10089646
692 Ga0307407_10099717
693 Ga0307412_10006701
694 Ga0307412_10028938
695 Ga0307412_10133664
696 Ga0307412_10369546
697 Ga0307409_100128605
698 Ga0307416_100059571
699 Ga0307416_100483998
700 Ga0307414_10000696
701 Ga0307414_10137809
702 Ga0307414_10161354
703 Ga0307414_10167821
704 Ga0307414_10168890
705 Ga0307411_10012193
706 Ga0307411_10074760
707 Ga0307415_100018018
708 Ga0307415_100044784
709 Ga0316583_10016875
710 Ga0316582_0048855
711 Ga0436365_0052761
712 Ga0451853_0097154
713 Ga0450912_002105
714 Ga0451576_0000007
715 Ga0451576_0375990
716 Ga0495627_000159
717 Ga0495638_0143999
718 Ga0495650_0001292
719 Ga0495596_0000133
720 Ga0495596_0000868
721 Ga0495607_0003515
722 Ga0495607_0066405
723 Ga0495606_0039060
724 Ga0495610_0000044
725 Ga0495610_0000883
726 Ga0495610_0004014
727 Ga0495620_0019690
728 Ga0495631_0030469
729 Ga0495632_0000272
730 Ga0495643_0000448
731 Ga0495643_0031411
732 Ga0495643_0069928
733 Ga0495643_0073220
734 Ga0495654_0109718
735 Ga0495609_0031983
736 Ga0495621_0037458
737 Ga0495622_0161075
738 Ga0495633_0069257
739 Ga0495625_0007823
740 Ga0495625_0014805
741 Ga0495671_0025929
742 Ga0495681_0000014
743 Ga0495615_0000168
744 Ga0495626_0003135
745 Ga0496100_0007811
746 Ga0496100_0138432
747 Ga0496101_0030000
748 Ga0496102_0000865
749 Ga0496103_0000038
750 Ga0496103_0014945
751 Ga0496104_0000123
752 Ga0496104_0012826
753 Ga0496104_0070467
754 Ga0496105_0000165
755 Ga0496105_0002963
756 Ga0496106_0000675
757 Ga0496107_0000841
758 Ga0496107_0009387
759 Ga0496109_0096907
760 Ga0496109_0104748
761 Ga0496110_0146433
762 Ga0496111_0112066
763 Ga0496111_0200039
764 Ga0496112_0011118
765 Ga0496113_0000130
766 Ga0496113_0004313
767 Ga0496114_0165376
768 Ga0496116_0000039
769 Ga0496116_0026567
770 Ga0496116_0212297
771 Ga0496117_0003052
772 Ga0496117_0012176
773 Ga0496117_0147991
774 Ga0496117_0168598
775 Ga0496118_0006710
776 Ga0496118_0019578
777 Ga0496118_0070513
778 Ga0496119_0001044
779 Ga0496120_0001980
780 Ga0496120_0030509
781 Ga0496121_0000022
782 Ga0496121_0000136
783 Ga0496121_0009176
784 Ga0496121_0017382
785 Ga0496121_0049324
786 Ga0496121_0068450
787 Ga0496121_0081371
788 Ga0496122_0000841
789 Ga0496122_0001814
790 Ga0496122_0015061
791 Ga0496123_0001492
792 Ga0496123_0001895
793 Ga0496123_0002030
794 Ga0496124_0002406
795 Ga0496124_0021907
796 Ga0496124_0072908
797 Ga0496125_0001376
798 Ga0496125_0067516
799 Ga0496125_0069105
800 Ga0496125_0071605
801 Ga0496126_0000041
802 Ga0496126_0000066
803 Ga0496126_0062672
804 Ga0496126_0100557
805 Ga0501034_0257404
806 Ga0501042_0268943
807 Ga0501047_0157606
808 Ga0501047_0259592
809 Ga0501047_0278475
810 Ga0501044_0188400
811 Ga0501044_0496443
812 nmdc:mga03683_6157_c1
813 nmdc:mga03n38_17135_c1
814 nmdc:mga00v17_20665_c1
815 nmdc:mga00v17_5693_c1
816 nmdc:mga0yw44_177244_c1
817 nmdc:mga0k408_148339_c1
818 nmdc:mga0k408_8127_c1
819 nmdc:mga06z11_218_c1
820 nmdc:mga04h51_76_c1
821 nmdc:mga07m45_38_c1
822 nmdc:mga0sz30_5071_c2
823 nmdc:mga0sz30_85_c1
824 Ga0500643_000001
825 Ga0500643_008894
826 Ga0500643_011609
827 Ga0500650_0084620
828 Ga0500556_0000040
829 Ga0500608_023441
830 Ga0500618_000600
831 Ga0500618_013747
832 Ga0500642_0000003
833 Ga0500564_084007
834 Ga0500588_0035748
835 Ga0500590_000253
836 Ga0500616_0008166
837 Ga0500624_000358
838 Ga0500645_001317
839 Ga0500645_012520
840 2511125775
841 2643949139
842 2738711757
843 2738850182
844 2738865911
845 2739298429
846 2739360107
847 2819550607
848 2848299798
849 2882807942
850 2896184721
851 2896255364
852 2919139974
853 2928101590
854 2928959681
855 3000866257
856 8054305711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

3

277

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9565 5 267
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9516 3 273
3luz-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9477 3 273
3luz-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement 0.9448 5 267
2pcr-assembly1.cif.gz_D crystal structure of myo-inositol-1(or 4)-monophosphatase (aq_1983) from aquifex aeolicus vf5 0.9215 9 272
ID Description Score Start End Superfamily
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9303 151 273 3.40.190.80
6ib8A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9234 151 272 3.40.190.80
3luzB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9221 151 273 3.40.190.80
af_A4HWI6_353_462_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9164 176 269 3.40.190.80
af_Q54U72_147_270_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9147 152 267 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A6L3ZQ44-F1-model_v4 deleted 0.9663 138 272
AF-A0A6L9MH47-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9656 2 270 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A528V7A3-F1-model_v4 Inositol monophosphatase 0.9615 120 210 GO:0006020
GO:0007165
GO:0008934
AF-A0A5E7YNW4-F1-model_v4 Acetyl-CoA carboxylase, biotin carboxylase subunit (Modular protein) (EC 6.3.4.14) 0.9571 1 271 GO:0004658
GO:0005524
GO:0008934
GO:0046854
GO:0046872
AF-A0A258IMJ4-F1-model_v4 Inositol monophosphatase 0.9553 147 269 GO:0006020
GO:0007165
GO:0008934
GO:0046872

Map