F441608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 428 | 362 | 176 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100338183|Ga0070674_1003381832 |
| Length | 231 |
| Sequence | MIQKQNATPDLFPESEKPVEIIPARKLSAKVAALYVAPLDHFQTRAVQELQLGFDGIDGDFHAGATRRSGGREPWYPRGTEMRNERQISIVAADELAIVAGRMGLAEIKPEWIGANLLIEGVPHLSMLPSGTLLFFKGGVTIKVDAQNGPCRLAGRSVAENAGMADRETGALAFTKAAKRLRGLVAWVEKPGCITTGDFRARAGAVDLSSLSIAEGRGCAAKATQPDLKTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 8 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 13 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 14 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 15 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 16 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 17 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 18 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 19 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 20 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 21 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 22 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 23 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 24 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 25 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 26 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 27 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 28 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 29 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 30 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 31 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 32 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 33 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 34 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 35 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 36 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 37 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 38 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 39 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 40 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 41 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 42 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 43 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 44 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 45 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 46 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 47 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 48 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 49 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 50 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 51 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 52 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 53 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 54 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 55 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 56 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 57 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 58 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 59 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 60 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 61 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 62 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 63 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 64 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 65 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 66 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 67 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 68 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 69 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 70 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 71 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 72 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 73 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 74 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 75 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 76 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 77 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 78 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 79 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 80 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 81 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 82 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 83 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 84 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 85 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 86 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 87 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 88 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 89 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 90 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 91 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 92 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 93 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 94 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 95 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 96 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 97 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 98 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 99 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 100 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 101 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 102 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 103 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 104 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 105 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 106 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 107 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 108 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 109 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 110 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 111 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 112 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 113 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 114 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 115 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 116 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 117 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 118 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 119 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 120 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 121 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 122 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 123 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 124 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 125 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 126 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 127 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 128 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 129 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 130 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 131 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 132 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 133 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 134 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 135 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 136 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 137 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 138 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 139 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 140 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 141 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 142 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 143 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 144 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 145 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 146 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 147 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 148 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 149 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 150 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 151 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 152 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 153 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 154 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 155 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 156 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 157 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 158 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 159 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 160 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 161 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 162 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 163 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 164 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 165 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 166 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 167 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 168 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 169 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 170 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 171 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 172 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 173 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 174 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 175 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 176 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 177 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 178 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 179 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 180 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 181 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 182 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 183 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 184 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 185 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 186 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 187 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 188 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 189 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 190 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 191 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 192 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 193 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 194 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 195 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 196 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 197 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 198 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 199 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 200 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 201 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 202 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 203 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 204 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 205 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 206 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 207 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 208 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 209 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 210 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 211 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 212 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 213 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 214 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 215 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 216 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 217 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 218 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 219 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 220 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 221 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 222 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 223 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 224 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 225 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 226 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 227 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 228 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 229 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 230 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 231 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 232 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 233 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 234 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 235 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 236 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 237 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 238 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 239 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 245 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 247 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 248 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 249 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 250 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 251 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 252 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 253 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 254 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 255 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 256 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 267 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 269 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 270 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 271 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 274 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 289 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 296 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 297 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 298 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 312 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 343 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 344 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 345 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 346 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 347 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 348 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 349 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 350 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 351 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 352 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 353 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 354 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 355 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 356 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 357 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 358 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 359 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 360 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 361 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 362 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 41.12 |
| Metatranscriptomes | 0 |
| Isolates | 58.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.88 |
| Nodule | 50.47 |
| Rhizoplane | 2.8 |
| Rhizosphere | 28.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1004419 | 3300002705 | Bacteria | 4284 |
| 2 | JGI25157J39369_1000162 | 3300002741 | Bacteria | 55941 |
| 3 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 4 | Ga0055542_1000986 | 3300003762 | Bacteria | 18435 |
| 5 | Ga0055529_1002120 | 3300003763 | Bacteria | 4190 |
| 6 | Ga0070658_10121469 | 3300005327 | Bacteria | 2171 |
| 7 | Ga0070660_100358514 | 3300005339 | Bacteria | 1201 |
| 8 | Ga0070661_100911560 | 3300005344 | Bacteria | 726 |
| 9 | Ga0070674_100048646 | 3300005356 | Bacteria | 2911 |
| 10 | Ga0070674_100338183 | 3300005356 | Bacteria | 1212 |
| 11 | Ga0070678_100580165 | 3300005456 | Bacteria | 999 |
| 12 | Ga0068853_100027297 | 3300005539 | Bacteria | 4796 |
| 13 | Ga0068853_100568027 | 3300005539 | Bacteria | 1075 |
| 14 | Ga0070665_100226586 | 3300005548 | Bacteria | 1869 |
| 15 | Ga0070665_100480186 | 3300005548 | Bacteria | 1254 |
| 16 | Ga0068856_100109505 | 3300005614 | Bacteria | 2759 |
| 17 | Ga0081539_10003450 | 3300005985 | Bacteria | 19403 |
| 18 | Ga0075365_10034011 | 3300006038 | Bacteria | 3289 |
| 19 | Ga0075365_10104589 | 3300006038 | Bacteria | 1941 |
| 20 | Ga0075368_10115664 | 3300006042 | Bacteria | 1108 |
| 21 | Ga0075363_100093712 | 3300006048 | Bacteria | 1655 |
| 22 | Ga0075364_10024071 | 3300006051 | Bacteria | 3861 |
| 23 | Ga0075367_10018980 | 3300006178 | Bacteria | 3804 |
| 24 | Ga0075367_10132029 | 3300006178 | Bacteria | 1544 |
| 25 | Ga0075369_10038628 | 3300006186 | Bacteria | 2037 |
| 26 | Ga0075369_10062043 | 3300006186 | Bacteria | 1632 |
| 27 | Ga0075366_10086290 | 3300006195 | Bacteria | 1878 |
| 28 | Ga0075366_10352625 | 3300006195 | Bacteria | 903 |
| 29 | Ga0075370_10076534 | 3300006353 | Bacteria | 1919 |
| 30 | Ga0105240_10137242 | 3300009093 | Bacteria | 2928 |
| 31 | Ga0105240_10305106 | 3300009093 | Bacteria | 1820 |
| 32 | Ga0105241_10540431 | 3300009174 | Bacteria | 1045 |
| 33 | Ga0105242_10810344 | 3300009176 | Bacteria | 928 |
| 34 | Ga0105237_10024483 | 3300009545 | Bacteria | 6175 |
| 35 | Ga0105237_10453509 | 3300009545 | Bacteria | 1288 |
| 36 | Ga0105237_10824679 | 3300009545 | Bacteria | 934 |
| 37 | Ga0105238_10033203 | 3300009551 | Bacteria | 5253 |
| 38 | Ga0105238_10476662 | 3300009551 | Bacteria | 1247 |
| 39 | Ga0105239_10047979 | 3300010375 | Bacteria | 4681 |
| 40 | Ga0105239_10101184 | 3300010375 | Bacteria | 3188 |
| 41 | Ga0105239_10505133 | 3300010375 | Bacteria | 1375 |
| 42 | Ga0157370_10756297 | 3300013104 | Bacteria | 885 |
| 43 | Ga0157369_10509352 | 3300013105 | Bacteria | 1245 |
| 44 | Ga0157374_10344888 | 3300013296 | Bacteria | 1479 |
| 45 | Ga0157380_10959890 | 3300014326 | Bacteria | 885 |
| 46 | Ga0182008_10016239 | 3300014497 | Bacteria | 3872 |
| 47 | Ga0157376_10450954 | 3300014969 | Bacteria | 1255 |
| 48 | Ga0182006_1043277 | 3300015261 | Bacteria | 1761 |
| 49 | Ga0182007_10184938 | 3300015262 | Bacteria | 722 |
| 50 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 51 | Ga0209677_109509 | 3300025253 | Bacteria | 1735 |
| 52 | Ga0209148_1000181 | 3300025254 | Bacteria | 124691 |
| 53 | Ga0209148_1007732 | 3300025254 | Bacteria | 2208 |
| 54 | Ga0209759_1000121 | 3300025256 | Bacteria | 138469 |
| 55 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 56 | Ga0209233_1009623 | 3300025261 | Bacteria | 2935 |
| 57 | Ga0209455_1000127 | 3300025272 | Bacteria | 162518 |
| 58 | Ga0209758_1027610 | 3300025297 | Bacteria | 2421 |
| 59 | Ga0207647_10018662 | 3300025904 | Bacteria | 4684 |
| 60 | Ga0207647_10077256 | 3300025904 | Bacteria | 2002 |
| 61 | Ga0207705_10086894 | 3300025909 | Bacteria | 2286 |
| 62 | Ga0207695_10313960 | 3300025913 | Bacteria | 1457 |
| 63 | Ga0207695_10383570 | 3300025913 | Bacteria | 1291 |
| 64 | Ga0207694_10003031 | 3300025924 | Bacteria | 13465 |
| 65 | Ga0207694_10333257 | 3300025924 | Bacteria | 1254 |
| 66 | Ga0207667_10198170 | 3300025949 | Bacteria | 2060 |
| 67 | Ga0207640_10674588 | 3300025981 | Bacteria | 883 |
| 68 | Ga0207639_10003685 | 3300026041 | Bacteria | 10298 |
| 69 | Ga0207678_10064613 | 3300026067 | Bacteria | 3144 |
| 70 | Ga0207683_10535665 | 3300026121 | Bacteria | 1082 |
| 71 | Ga0207698_10646927 | 3300026142 | Bacteria | 1047 |
| 72 | Ga0209813_10085130 | 3300027866 | Bacteria | 1052 |
| 73 | Ga0207428_10527118 | 3300027907 | Bacteria | 856 |
| 74 | Ga0268266_10013179 | 3300028379 | Bacteria | 7130 |
| 75 | Ga0316582_0016286 | 3300036647 | Bacteria | 4273 |
| 76 | Ga0316582_0268245 | 3300036647 | Bacteria | 1171 |
| 77 | Ga0395900_0083708 | 3300037418 | Bacteria | 3277 |
| 78 | Ga0395898_0556675 | 3300037466 | Bacteria | 1089 |
| 79 | Ga0395905_0015434 | 3300037471 | Bacteria | 7262 |
| 80 | Ga0395905_0055498 | 3300037471 | Bacteria | 3707 |
| 81 | Ga0395905_0119552 | 3300037471 | Bacteria | 2476 |
| 82 | Ga0395905_0209314 | 3300037471 | Bacteria | 1827 |
| 83 | Ga0395901_0096853 | 3300038443 | Bacteria | 3092 |
| 84 | Ga0395901_0134413 | 3300038443 | Bacteria | 2599 |
| 85 | Ga0395901_0169115 | 3300038443 | Bacteria | 2294 |
| 86 | Ga0395901_0259994 | 3300038443 | Bacteria | 1807 |
| 87 | Ga0395901_0316029 | 3300038443 | Bacteria | 1617 |
| 88 | Ga0439466_0070276 | 3300041411 | Bacteria | 1116 |
| 89 | Ga0451797_0475723 | 3300041453 | Bacteria | 935 |
| 90 | Ga0466972_0091842 | 3300044658 | Bacteria | 1439 |
| 91 | Ga0495638_0076062 | 3300046460 | Bacteria | 2045 |
| 92 | Ga0495668_0018238 | 3300046616 | Bacteria | 4056 |
| 93 | Ga0495625_0107896 | 3300046660 | Bacteria | 1905 |
| 94 | Ga0495625_0110335 | 3300046660 | Bacteria | 1881 |
| 95 | Ga0495625_0229481 | 3300046660 | Bacteria | 1213 |
| 96 | Ga0496103_0101455 | 3300048906 | Bacteria | 1822 |
| 97 | Ga0496104_0835392 | 3300048907 | Bacteria | 827 |
| 98 | Ga0496110_0177679 | 3300048913 | Bacteria | 1933 |
| 99 | Ga0496112_0071137 | 3300048915 | Bacteria | 3438 |
| 100 | Ga0496112_0253887 | 3300048915 | Bacteria | 1709 |
| 101 | Ga0496113_0295155 | 3300048916 | Bacteria | 1297 |
| 102 | Ga0496114_0185947 | 3300048917 | Bacteria | 1816 |
| 103 | Ga0496115_0072115 | 3300048918 | Bacteria | 2802 |
| 104 | Ga0496118_0180042 | 3300048921 | Bacteria | 1278 |
| 105 | Ga0496119_0019343 | 3300048922 | Bacteria | 5021 |
| 106 | Ga0496120_0003090 | 3300048923 | Bacteria | 15675 |
| 107 | Ga0496120_0020017 | 3300048923 | Bacteria | 4264 |
| 108 | Ga0496126_0208762 | 3300048929 | Bacteria | 1645 |
| 109 | Ga0496126_0255257 | 3300048929 | Bacteria | 1460 |
| 110 | Ga0501031_0030724 | 3300049568 | Bacteria | 3504 |
| 111 | Ga0501031_0030819 | 3300049568 | Bacteria | 3498 |
| 112 | Ga0501032_0000075 | 3300049569 | Bacteria | 84153 |
| 113 | Ga0501032_0015236 | 3300049569 | Bacteria | 5428 |
| 114 | Ga0501033_0000216 | 3300049570 | Bacteria | 55449 |
| 115 | Ga0501033_0012955 | 3300049570 | Bacteria | 6360 |
| 116 | Ga0501033_0085611 | 3300049570 | Bacteria | 2308 |
| 117 | Ga0501033_0230208 | 3300049570 | Bacteria | 1317 |
| 118 | Ga0501033_0354952 | 3300049570 | Bacteria | 1026 |
| 119 | Ga0501034_0000476 | 3300049571 | Bacteria | 65960 |
| 120 | Ga0501034_0582967 | 3300049571 | Bacteria | 1025 |
| 121 | Ga0501036_0000398 | 3300049572 | Bacteria | 30616 |
| 122 | Ga0501036_0187135 | 3300049572 | Bacteria | 1742 |
| 123 | Ga0501036_0610173 | 3300049572 | Bacteria | 905 |
| 124 | Ga0501037_0000021 | 3300049573 | Bacteria | 150037 |
| 125 | Ga0501038_0000032 | 3300049574 | Bacteria | 131432 |
| 126 | Ga0501038_0096322 | 3300049574 | Bacteria | 2471 |
| 127 | Ga0501038_0208661 | 3300049574 | Bacteria | 1564 |
| 128 | Ga0501038_0298996 | 3300049574 | Bacteria | 1263 |
| 129 | Ga0501039_0000025 | 3300049575 | Bacteria | 152236 |
| 130 | Ga0501040_0170121 | 3300049576 | Bacteria | 1543 |
| 131 | Ga0501042_0069249 | 3300049578 | Bacteria | 2523 |
| 132 | Ga0501042_0378250 | 3300049578 | Bacteria | 1025 |
| 133 | Ga0501043_0000570 | 3300049579 | Bacteria | 32944 |
| 134 | Ga0501043_0141549 | 3300049579 | Bacteria | 1883 |
| 135 | Ga0501043_0180767 | 3300049579 | Bacteria | 1643 |
| 136 | Ga0501043_0220262 | 3300049579 | Bacteria | 1468 |
| 137 | Ga0501046_0044413 | 3300049580 | Bacteria | 3534 |
| 138 | Ga0501046_0046069 | 3300049580 | Bacteria | 3462 |
| 139 | Ga0501046_0205071 | 3300049580 | Bacteria | 1466 |
| 140 | Ga0501047_0003462 | 3300049581 | Bacteria | 14913 |
| 141 | Ga0501047_0109312 | 3300049581 | Bacteria | 2647 |
| 142 | Ga0501048_0090353 | 3300049582 | Bacteria | 2160 |
| 143 | Ga0501067_0123962 | 3300049583 | Bacteria | 1438 |
| 144 | Ga0501068_0055943 | 3300049584 | Bacteria | 2391 |
| 145 | Ga0501070_0000264 | 3300049586 | Bacteria | 49510 |
| 146 | Ga0501070_0020934 | 3300049586 | Bacteria | 5487 |
| 147 | Ga0501070_0276253 | 3300049586 | Bacteria | 1371 |
| 148 | Ga0501070_0280879 | 3300049586 | Bacteria | 1358 |
| 149 | Ga0501071_0085317 | 3300049587 | Bacteria | 2315 |
| 150 | Ga0501074_0007044 | 3300049590 | Bacteria | 8121 |
| 151 | Ga0501079_0381724 | 3300049741 | Bacteria | 1105 |
| 152 | Ga0501080_0003495 | 3300049742 | Bacteria | 13843 |
| 153 | Ga0501080_0258029 | 3300049742 | Bacteria | 1588 |
| 154 | Ga0501035_0000085 | 3300049822 | Bacteria | 116189 |
| 155 | Ga0501035_0002015 | 3300049822 | Bacteria | 20268 |
| 156 | Ga0501035_0316739 | 3300049822 | Bacteria | 1311 |
| 157 | Ga0501044_0010392 | 3300049823 | Bacteria | 10099 |
| 158 | Ga0501044_0032428 | 3300049823 | Bacteria | 5492 |
| 159 | Ga0501044_0042087 | 3300049823 | Bacteria | 4754 |
| 160 | Ga0501044_0411472 | 3300049823 | Bacteria | 1263 |
| 161 | Ga0501044_0839531 | 3300049823 | Bacteria | 796 |
| 162 | nmdc:mga03n38_9312_c1 | 3300050490 | Bacteria | 3567 |
| 163 | nmdc:mga00v17_117693_c1 | 3300050491 | Bacteria | 1690 |
| 164 | nmdc:mga0yw44_32317_c1 | 3300050492 | Bacteria | 3049 |
| 165 | nmdc:mga0yw44_379344_c1 | 3300050492 | Bacteria | 954 |
| 166 | nmdc:mga0yw44_455090_c1 | 3300050492 | Bacteria | 867 |
| 167 | nmdc:mga0yw44_574172_c1 | 3300050492 | Bacteria | 766 |
| 168 | nmdc:mga04h51_193746_c1 | 3300050495 | Bacteria | 796 |
| 169 | Ga0500643_009681 | 3300053087 | Bacteria | 3659 |
| 170 | Ga0500595_073615 | 3300053119 | Bacteria | 1010 |
| 171 | Ga0500658_0103214 | 3300053134 | Bacteria | 1247 |
| 172 | Ga0500568_0000093 | 3300053139 | Bacteria | 83403 |
| 173 | Ga0500604_0008368 | 3300053151 | Bacteria | 2744 |
| 174 | Ga0500620_004709 | 3300053155 | Bacteria | 3078 |
| 175 | Ga0500627_0122175 | 3300053158 | Bacteria | 1175 |
| 176 | Ga0500627_0172406 | 3300053158 | Bacteria | 974 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2844002411 | 2844007419 | 190 |
| 2 | iso_pu_bacteria | 2888350351 | 2888355763 | 194 |
| 3 | iso_pu_bacteria | 2889010040 | 2889010700 | 194 |
| 4 | iso_pu_bacteria | 2889016732 | 2889017603 | 194 |
| 5 | iso_pu_bacteria | 2906354277 | 2906360843 | 194 |
| 6 | iso_pu_bacteria | 2922130491 | 2922134340 | 194 |
| 7 | iso_pu_bacteria | 2922185730 | 2922187927 | 194 |
| 8 | iso_pu_bacteria | 2958100919 | 2958105748 | 194 |
| 9 | iso_pu_bacteria | 2958172287 | 2958173535 | 194 |
| 10 | iso_pu_bacteria | 2965102966 | 2965108797 | 194 |
| 11 | iso_pu_bacteria | 2965119406 | 2965122057 | 194 |
| 12 | iso_pu_bacteria | 2977971508 | 2977974523 | 194 |
| 13 | iso_pu_bacteria | 2979710463 | 2979717540 | 194 |
| 14 | iso_pu_bacteria | 2979742915 | 2979749647 | 194 |
| 15 | iso_pu_bacteria | 2987652177 | 2987654656 | 194 |
| 16 | iso_pu_bacteria | 2847670302 | 2847675617 | 195 |
| 17 | iso_pu_bacteria | 2856314179 | 2856319504 | 195 |
| 18 | iso_pu_bacteria | 2878035449 | 2878040739 | 195 |
| 19 | iso_pu_bacteria | 2906414383 | 2906420224 | 195 |
| 20 | 3300036647 | Ga0316582_0016286 | Ga0316582_0016286_643_1233 | 196 |
| 21 | iso_pu_bacteria | 2765235802 | 2765464593 | 198 |
| 22 | iso_pu_bacteria | 2767802442 | 2770195467 | 198 |
| 23 | iso_pu_bacteria | 2840764183 | 2840767382 | 198 |
| 24 | iso_pu_bacteria | 2894652903 | 2894655968 | 198 |
| 25 | iso_pu_bacteria | 2904578770 | 2904580552 | 198 |
| 26 | iso_pu_bacteria | 2919119836 | 2919121701 | 198 |
| 27 | iso_pu_bacteria | 3004334049 | 3004334348 | 199 |
| 28 | iso_pu_bacteria | 8004395343 | 8004396334 | 199 |
| 29 | iso_pu_bacteria | 2856349417 | 2856352438 | 200 |
| 30 | iso_pu_bacteria | 2881155292 | 2881155311 | 200 |
| 31 | iso_pu_bacteria | 2881853255 | 2881853704 | 200 |
| 32 | iso_pu_bacteria | 2885342637 | 2885347529 | 200 |
| 33 | iso_pu_bacteria | 2885350715 | 2885356701 | 200 |
| 34 | iso_pu_bacteria | 2961127735 | 2961131607 | 200 |
| 35 | iso_pu_bacteria | 8004640170 | 8004640815 | 200 |
| 36 | 3300049568 | Ga0501031_0030724 | Ga0501031_0030724_1973_2650 | 201 |
| 37 | 3300049569 | Ga0501032_0000075 | Ga0501032_0000075_49236_49913 | 201 |
| 38 | 3300049570 | Ga0501033_0000216 | Ga0501033_0000216_50799_51476 | 201 |
| 39 | 3300049570 | Ga0501033_0012955 | Ga0501033_0012955_1616_2239 | 201 |
| 40 | 3300049570 | Ga0501033_0230208 | Ga0501033_0230208_193_807 | 201 |
| 41 | 3300049571 | Ga0501034_0000476 | Ga0501034_0000476_16048_16725 | 201 |
| 42 | 3300049572 | Ga0501036_0000398 | Ga0501036_0000398_891_1568 | 201 |
| 43 | 3300049572 | Ga0501036_0610173 | Ga0501036_0610173_275_889 | 201 |
| 44 | 3300049573 | Ga0501037_0000021 | Ga0501037_0000021_99799_100476 | 201 |
| 45 | 3300049574 | Ga0501038_0000032 | Ga0501038_0000032_81520_82197 | 201 |
| 46 | 3300049574 | Ga0501038_0096322 | Ga0501038_0096322_107_721 | 201 |
| 47 | 3300049574 | Ga0501038_0208661 | Ga0501038_0208661_480_1103 | 201 |
| 48 | 3300049575 | Ga0501039_0000025 | Ga0501039_0000025_95789_96466 | 201 |
| 49 | 3300049578 | Ga0501042_0378250 | Ga0501042_0378250_220_897 | 201 |
| 50 | 3300049579 | Ga0501043_0000570 | Ga0501043_0000570_16048_16725 | 201 |
| 51 | 3300049579 | Ga0501043_0180767 | Ga0501043_0180767_818_1441 | 201 |
| 52 | 3300049579 | Ga0501043_0220262 | Ga0501043_0220262_664_1278 | 201 |
| 53 | 3300049580 | Ga0501046_0046069 | Ga0501046_0046069_105_782 | 201 |
| 54 | 3300049580 | Ga0501046_0205071 | Ga0501046_0205071_300_914 | 201 |
| 55 | 3300049581 | Ga0501047_0003462 | Ga0501047_0003462_470_1093 | 201 |
| 56 | 3300049584 | Ga0501068_0055943 | Ga0501068_0055943_1519_2142 | 201 |
| 57 | 3300049586 | Ga0501070_0000264 | Ga0501070_0000264_38622_39245 | 201 |
| 58 | 3300049586 | Ga0501070_0020934 | Ga0501070_0020934_2588_3202 | 201 |
| 59 | 3300049590 | Ga0501074_0007044 | Ga0501074_0007044_827_1450 | 201 |
| 60 | 3300049741 | Ga0501079_0381724 | Ga0501079_0381724_379_1002 | 201 |
| 61 | 3300049742 | Ga0501080_0003495 | Ga0501080_0003495_12707_13330 | 201 |
| 62 | 3300049822 | Ga0501035_0000085 | Ga0501035_0000085_61831_62508 | 201 |
| 63 | 3300049822 | Ga0501035_0002015 | Ga0501035_0002015_3995_4618 | 201 |
| 64 | 3300049823 | Ga0501044_0010392 | Ga0501044_0010392_6180_6857 | 201 |
| 65 | 3300049823 | Ga0501044_0032428 | Ga0501044_0032428_3931_4545 | 201 |
| 66 | iso_pu_bacteria | 2503198000 | 2503201538 | 201 |
| 67 | iso_pu_bacteria | 2508501123 | 2509113140 | 201 |
| 68 | iso_pu_bacteria | 2508501127 | 2509143300 | 201 |
| 69 | iso_pu_bacteria | 2509276018 | 2509367817 | 201 |
| 70 | iso_pu_bacteria | 2510065059 | 2510315495 | 201 |
| 71 | iso_pu_bacteria | 2512875016 | 2512931492 | 201 |
| 72 | iso_pu_bacteria | 2512875024 | 2512959323 | 201 |
| 73 | iso_pu_bacteria | 2513237090 | 2513612729 | 201 |
| 74 | iso_pu_bacteria | 2513237164 | 2514033630 | 201 |
| 75 | iso_pu_bacteria | 2513237305 | 2514420885 | 201 |
| 76 | iso_pu_bacteria | 2513237351 | 2514589264 | 201 |
| 77 | iso_pu_bacteria | 2597489875 | 2597813223 | 201 |
| 78 | iso_pu_bacteria | 2599185301 | 2599936747 | 201 |
| 79 | iso_pu_bacteria | 2643221595 | 2643984403 | 201 |
| 80 | iso_pu_bacteria | 2643221623 | 2644129380 | 201 |
| 81 | iso_pu_bacteria | 2643221627 | 2644153260 | 201 |
| 82 | iso_pu_bacteria | 2687453392 | 2688598450 | 201 |
| 83 | iso_pu_bacteria | 2721755686 | 2723575383 | 201 |
| 84 | iso_pu_bacteria | 2738543024 | 2739307170 | 201 |
| 85 | iso_pu_bacteria | 2756170246 | 2756675462 | 201 |
| 86 | iso_pu_bacteria | 2791355123 | 2792749245 | 201 |
| 87 | iso_pu_bacteria | 2841734538 | 2841739200 | 201 |
| 88 | iso_pu_bacteria | 2844009547 | 2844013708 | 201 |
| 89 | iso_pu_bacteria | 2856328259 | 2856334570 | 201 |
| 90 | iso_pu_bacteria | 2856334872 | 2856340885 | 201 |
| 91 | iso_pu_bacteria | 2856342000 | 2856344939 | 201 |
| 92 | iso_pu_bacteria | 2869234852 | 2869237206 | 201 |
| 93 | iso_pu_bacteria | 2869242130 | 2869244700 | 201 |
| 94 | iso_pu_bacteria | 2869249662 | 2869253108 | 201 |
| 95 | iso_pu_bacteria | 2869256925 | 2869260292 | 201 |
| 96 | iso_pu_bacteria | 2869264136 | 2869268594 | 201 |
| 97 | iso_pu_bacteria | 2869271264 | 2869272231 | 201 |
| 98 | iso_pu_bacteria | 2869278585 | 2869284938 | 201 |
| 99 | iso_pu_bacteria | 2871435913 | 2871442677 | 201 |
| 100 | iso_pu_bacteria | 2871451962 | 2871457894 | 201 |
| 101 | iso_pu_bacteria | 2871459585 | 2871462734 | 201 |
| 102 | iso_pu_bacteria | 2871481445 | 2871486605 | 201 |
| 103 | iso_pu_bacteria | 2874109183 | 2874112351 | 201 |
| 104 | iso_pu_bacteria | 2874116593 | 2874122673 | 201 |
| 105 | iso_pu_bacteria | 2874123672 | 2874130603 | 201 |
| 106 | iso_pu_bacteria | 2874131515 | 2874132091 | 201 |
| 107 | iso_pu_bacteria | 2874168670 | 2874169864 | 201 |
| 108 | iso_pu_bacteria | 2876363079 | 2876368473 | 201 |
| 109 | iso_pu_bacteria | 2876386047 | 2876386709 | 201 |
| 110 | iso_pu_bacteria | 2876392853 | 2876398446 | 201 |
| 111 | iso_pu_bacteria | 2876399893 | 2876400208 | 201 |
| 112 | iso_pu_bacteria | 2876420981 | 2876422999 | 201 |
| 113 | iso_pu_bacteria | 2878774303 | 2878777090 | 201 |
| 114 | iso_pu_bacteria | 2881147464 | 2881151337 | 201 |
| 115 | iso_pu_bacteria | 2881161766 | 2881167536 | 201 |
| 116 | iso_pu_bacteria | 2882632389 | 2882636279 | 201 |
| 117 | iso_pu_bacteria | 2888343758 | 2888346826 | 201 |
| 118 | iso_pu_bacteria | 2903448605 | 2903451322 | 201 |
| 119 | iso_pu_bacteria | 2903513507 | 2903517871 | 201 |
| 120 | iso_pu_bacteria | 2903521522 | 2903527472 | 201 |
| 121 | iso_pu_bacteria | 2903528002 | 2903533926 | 201 |
| 122 | iso_pu_bacteria | 2904659560 | 2904665001 | 201 |
| 123 | iso_pu_bacteria | 2906363423 | 2906366769 | 201 |
| 124 | iso_pu_bacteria | 2906370794 | 2906372610 | 201 |
| 125 | iso_pu_bacteria | 2906378014 | 2906385074 | 201 |
| 126 | iso_pu_bacteria | 2906386501 | 2906387988 | 201 |
| 127 | iso_pu_bacteria | 2906401398 | 2906405395 | 201 |
| 128 | iso_pu_bacteria | 2906408224 | 2906408909 | 201 |
| 129 | iso_pu_bacteria | 2906427513 | 2906431108 | 201 |
| 130 | iso_pu_bacteria | 2922151315 | 2922152076 | 201 |
| 131 | iso_pu_bacteria | 2922172374 | 2922178289 | 201 |
| 132 | iso_pu_bacteria | 2922178524 | 2922182844 | 201 |
| 133 | iso_pu_bacteria | 2924733363 | 2924736435 | 201 |
| 134 | iso_pu_bacteria | 2924741084 | 2924743492 | 201 |
| 135 | iso_pu_bacteria | 2924748358 | 2924750107 | 201 |
| 136 | iso_pu_bacteria | 2937836603 | 2937839389 | 201 |
| 137 | iso_pu_bacteria | 2937843397 | 2937848038 | 201 |
| 138 | iso_pu_bacteria | 2937848649 | 2937853179 | 201 |
| 139 | iso_pu_bacteria | 2937861824 | 2937866280 | 201 |
| 140 | iso_pu_bacteria | 2937877337 | 2937882117 | 201 |
| 141 | iso_pu_bacteria | 2958034702 | 2958040640 | 201 |
| 142 | iso_pu_bacteria | 2958041894 | 2958056722 | 201 |
| 143 | iso_pu_bacteria | 2958064165 | 2958064370 | 201 |
| 144 | iso_pu_bacteria | 2958071322 | 2958078194 | 201 |
| 145 | iso_pu_bacteria | 2958084443 | 2958089239 | 201 |
| 146 | iso_pu_bacteria | 2958137437 | 2958138003 | 201 |
| 147 | iso_pu_bacteria | 2961114664 | 2961120000 | 201 |
| 148 | iso_pu_bacteria | 2961183825 | 2961185947 | 201 |
| 149 | iso_pu_bacteria | 2963644680 | 2963647720 | 201 |
| 150 | iso_pu_bacteria | 2965025482 | 2965031748 | 201 |
| 151 | iso_pu_bacteria | 2965032056 | 2965038124 | 201 |
| 152 | iso_pu_bacteria | 2965040258 | 2965045716 | 201 |
| 153 | iso_pu_bacteria | 2965089291 | 2965094790 | 201 |
| 154 | iso_pu_bacteria | 2968083720 | 2968090352 | 201 |
| 155 | iso_pu_bacteria | 2968110612 | 2968116357 | 201 |
| 156 | iso_pu_bacteria | 2970510686 | 2970514625 | 201 |
| 157 | iso_pu_bacteria | 2970524798 | 2970528596 | 201 |
| 158 | iso_pu_bacteria | 2970532167 | 2970539673 | 201 |
| 159 | iso_pu_bacteria | 2970540015 | 2970544788 | 201 |
| 160 | iso_pu_bacteria | 2970547951 | 2970552019 | 201 |
| 161 | iso_pu_bacteria | 2970593180 | 2970599553 | 201 |
| 162 | iso_pu_bacteria | 2977864932 | 2977867083 | 201 |
| 163 | iso_pu_bacteria | 2977872689 | 2977877298 | 201 |
| 164 | iso_pu_bacteria | 2977898635 | 2977904958 | 201 |
| 165 | iso_pu_bacteria | 2977907340 | 2977911336 | 201 |
| 166 | iso_pu_bacteria | 2977915119 | 2977916775 | 201 |
| 167 | iso_pu_bacteria | 2977922695 | 2977924229 | 201 |
| 168 | iso_pu_bacteria | 2977950692 | 2977952284 | 201 |
| 169 | iso_pu_bacteria | 2977957713 | 2977957856 | 201 |
| 170 | iso_pu_bacteria | 2979764755 | 2979766233 | 201 |
| 171 | iso_pu_bacteria | 2979772303 | 2979774489 | 201 |
| 172 | iso_pu_bacteria | 2987645492 | 2987645779 | 201 |
| 173 | iso_pu_bacteria | 2987673487 | 2987676014 | 201 |
| 174 | iso_pu_bacteria | 2996310559 | 2996314071 | 201 |
| 175 | iso_pu_bacteria | 2996386984 | 2996391441 | 201 |
| 176 | iso_pu_bacteria | 3000135777 | 3000140654 | 201 |
| 177 | iso_pu_bacteria | 3004167301 | 3004168909 | 201 |
| 178 | iso_pu_bacteria | 3004195979 | 3004200569 | 201 |
| 179 | iso_pu_bacteria | 3004211236 | 3004215964 | 201 |
| 180 | iso_pu_bacteria | 3004218560 | 3004223714 | 201 |
| 181 | iso_pu_bacteria | 3004232784 | 3004235839 | 201 |
| 182 | iso_pu_bacteria | 3004239961 | 3004244922 | 201 |
| 183 | iso_pu_bacteria | 3004248173 | 3004254703 | 201 |
| 184 | iso_pu_bacteria | 3004268573 | 3004274949 | 201 |
| 185 | iso_pu_bacteria | 649633066 | 649872976 | 201 |
| 186 | iso_pu_bacteria | 8002285264 | 8002289039 | 201 |
| 187 | iso_pu_bacteria | 8004300914 | 8004301046 | 201 |
| 188 | iso_pu_bacteria | 8004361976 | 8004365137 | 201 |
| 189 | iso_pu_bacteria | 8004633249 | 8004634846 | 201 |
| 190 | iso_pu_bacteria | 8004695233 | 8004703600 | 201 |
| 191 | iso_pu_bacteria | 8004727605 | 8004731437 | 201 |
| 192 | iso_pu_bacteria | 8055617313 | 8055620779 | 201 |
| 193 | 3300046660 | Ga0495625_0110335 | Ga0495625_0110335_973_1581 | 202 |
| 194 | 3300049571 | Ga0501034_0582967 | Ga0501034_0582967_157_774 | 202 |
| 195 | 3300049823 | Ga0501044_0839531 | Ga0501044_0839531_112_729 | 202 |
| 196 | 3300027907 | Ga0207428_10527118 | Ga0207428_105271181 | 203 |
| 197 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015178 | 204 |
| 198 | 3300003762 | Ga0055542_1000986 | Ga0055542_100098616 | 204 |
| 199 | 3300003763 | Ga0055529_1002120 | Ga0055529_10021207 | 204 |
| 200 | 3300005327 | Ga0070658_10121469 | Ga0070658_101214692 | 204 |
| 201 | 3300005339 | Ga0070660_100358514 | Ga0070660_1003585141 | 204 |
| 202 | 3300005539 | Ga0068853_100027297 | Ga0068853_1000272973 | 204 |
| 203 | 3300005614 | Ga0068856_100109505 | Ga0068856_1001095053 | 204 |
| 204 | 3300005985 | Ga0081539_10003450 | Ga0081539_100034501 | 204 |
| 205 | 3300006038 | Ga0075365_10034011 | Ga0075365_100340114 | 204 |
| 206 | 3300006038 | Ga0075365_10104589 | Ga0075365_101045893 | 204 |
| 207 | 3300006051 | Ga0075364_10024071 | Ga0075364_100240714 | 204 |
| 208 | 3300006178 | Ga0075367_10132029 | Ga0075367_101320291 | 204 |
| 209 | 3300009176 | Ga0105242_10810344 | Ga0105242_108103441 | 204 |
| 210 | 3300009545 | Ga0105237_10024483 | Ga0105237_100244832 | 204 |
| 211 | 3300009545 | Ga0105237_10824679 | Ga0105237_108246791 | 204 |
| 212 | 3300009551 | Ga0105238_10033203 | Ga0105238_100332036 | 204 |
| 213 | 3300010375 | Ga0105239_10047979 | Ga0105239_100479797 | 204 |
| 214 | 3300010375 | Ga0105239_10101184 | Ga0105239_101011843 | 204 |
| 215 | 3300013105 | Ga0157369_10509352 | Ga0157369_105093522 | 204 |
| 216 | 3300014326 | Ga0157380_10959890 | Ga0157380_109598902 | 204 |
| 217 | 3300025253 | Ga0209677_109509 | Ga0209677_1095093 | 204 |
| 218 | 3300025254 | Ga0209148_1000181 | Ga0209148_1000181106 | 204 |
| 219 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010276 | 204 |
| 220 | 3300025272 | Ga0209455_1000127 | Ga0209455_1000127106 | 204 |
| 221 | 3300025297 | Ga0209758_1027610 | Ga0209758_10276102 | 204 |
| 222 | 3300025904 | Ga0207647_10018662 | Ga0207647_100186626 | 204 |
| 223 | 3300025904 | Ga0207647_10077256 | Ga0207647_100772562 | 204 |
| 224 | 3300025909 | Ga0207705_10086894 | Ga0207705_100868942 | 204 |
| 225 | 3300025913 | Ga0207695_10383570 | Ga0207695_103835702 | 204 |
| 226 | 3300025924 | Ga0207694_10003031 | Ga0207694_100030317 | 204 |
| 227 | 3300026041 | Ga0207639_10003685 | Ga0207639_100036853 | 204 |
| 228 | 3300026067 | Ga0207678_10064613 | Ga0207678_100646132 | 204 |
| 229 | 3300027866 | Ga0209813_10085130 | Ga0209813_100851302 | 204 |
| 230 | 3300028379 | Ga0268266_10013179 | Ga0268266_100131795 | 204 |
| 231 | 3300037471 | Ga0395905_0055498 | Ga0395905_0055498_2045_2671 | 204 |
| 232 | 3300038443 | Ga0395901_0096853 | Ga0395901_0096853_1785_2411 | 204 |
| 233 | 3300046460 | Ga0495638_0076062 | Ga0495638_0076062_933_1547 | 204 |
| 234 | 3300048922 | Ga0496119_0019343 | Ga0496119_0019343_1045_1671 | 204 |
| 235 | 3300048923 | Ga0496120_0003090 | Ga0496120_0003090_4004_4630 | 204 |
| 236 | 3300048929 | Ga0496126_0208762 | Ga0496126_0208762_337_960 | 204 |
| 237 | 3300049586 | Ga0501070_0276253 | Ga0501070_0276253_525_1151 | 204 |
| 238 | 3300049822 | Ga0501035_0316739 | Ga0501035_0316739_109_735 | 204 |
| 239 | 3300049823 | Ga0501044_0042087 | Ga0501044_0042087_3906_4532 | 204 |
| 240 | 3300050492 | nmdc:mga0yw44_455090_c1 | nmdc:mga0yw44_455090_c1_206_820 | 204 |
| 241 | 3300050492 | nmdc:mga0yw44_574172_c1 | nmdc:mga0yw44_574172_c1_138_752 | 204 |
| 242 | 3300050495 | nmdc:mga04h51_193746_c1 | nmdc:mga04h51_193746_c1_159_773 | 204 |
| 243 | 3300053158 | Ga0500627_0172406 | Ga0500627_0172406_333_947 | 204 |
| 244 | iso_pu_bacteria | 2856364286 | 2856369464 | 204 |
| 245 | iso_pu_bacteria | 2857349434 | 2857351149 | 204 |
| 246 | iso_pu_bacteria | 2869285874 | 2869286462 | 204 |
| 247 | iso_pu_bacteria | 2871429161 | 2871434615 | 204 |
| 248 | iso_pu_bacteria | 2874146452 | 2874149821 | 204 |
| 249 | iso_pu_bacteria | 2874155637 | 2874158079 | 204 |
| 250 | iso_pu_bacteria | 2876413966 | 2876416283 | 204 |
| 251 | iso_pu_bacteria | 2878745973 | 2878751748 | 204 |
| 252 | iso_pu_bacteria | 2903492973 | 2903504694 | 204 |
| 253 | iso_pu_bacteria | 2906308376 | 2906314146 | 204 |
| 254 | iso_pu_bacteria | 2906321335 | 2906327312 | 204 |
| 255 | iso_pu_bacteria | 2937813078 | 2937815743 | 204 |
| 256 | iso_pu_bacteria | 2958041894 | 2958057107 | 204 |
| 257 | iso_pu_bacteria | 2958130278 | 2958130865 | 204 |
| 258 | iso_pu_bacteria | 2958179912 | 2958184786 | 204 |
| 259 | iso_pu_bacteria | 2961077736 | 2961082953 | 204 |
| 260 | iso_pu_bacteria | 2968117919 | 2968120637 | 204 |
| 261 | iso_pu_bacteria | 2977843712 | 2977845979 | 204 |
| 262 | iso_pu_bacteria | 2977942078 | 2977942752 | 204 |
| 263 | iso_pu_bacteria | 2987636660 | 2987638333 | 204 |
| 264 | iso_pu_bacteria | 3004203850 | 3004205423 | 204 |
| 265 | iso_pu_bacteria | 8004387939 | 8004393636 | 204 |
| 266 | iso_pu_bacteria | 8004714634 | 8004720404 | 204 |
| 267 | 3300002705 | JGI25156J39149_1004419 | JGI25156J39149_10044192 | 205 |
| 268 | 3300002741 | JGI25157J39369_1000162 | JGI25157J39369_100016229 | 205 |
| 269 | 3300005344 | Ga0070661_100911560 | Ga0070661_1009115601 | 205 |
| 270 | 3300005356 | Ga0070674_100048646 | Ga0070674_1000486463 | 205 |
| 271 | 3300005356 | Ga0070674_100338183 | Ga0070674_1003381832 | 205 |
| 272 | 3300005456 | Ga0070678_100580165 | Ga0070678_1005801651 | 205 |
| 273 | 3300005539 | Ga0068853_100568027 | Ga0068853_1005680272 | 205 |
| 274 | 3300005548 | Ga0070665_100226586 | Ga0070665_1002265861 | 205 |
| 275 | 3300005548 | Ga0070665_100480186 | Ga0070665_1004801862 | 205 |
| 276 | 3300006042 | Ga0075368_10115664 | Ga0075368_101156641 | 205 |
| 277 | 3300006048 | Ga0075363_100093712 | Ga0075363_1000937123 | 205 |
| 278 | 3300006178 | Ga0075367_10018980 | Ga0075367_100189803 | 205 |
| 279 | 3300006186 | Ga0075369_10038628 | Ga0075369_100386282 | 205 |
| 280 | 3300006186 | Ga0075369_10062043 | Ga0075369_100620432 | 205 |
| 281 | 3300006195 | Ga0075366_10086290 | Ga0075366_100862902 | 205 |
| 282 | 3300006195 | Ga0075366_10352625 | Ga0075366_103526252 | 205 |
| 283 | 3300006353 | Ga0075370_10076534 | Ga0075370_100765343 | 205 |
| 284 | 3300009093 | Ga0105240_10137242 | Ga0105240_101372424 | 205 |
| 285 | 3300009093 | Ga0105240_10305106 | Ga0105240_103051063 | 205 |
| 286 | 3300009174 | Ga0105241_10540431 | Ga0105241_105404312 | 205 |
| 287 | 3300009545 | Ga0105237_10453509 | Ga0105237_104535092 | 205 |
| 288 | 3300009551 | Ga0105238_10476662 | Ga0105238_104766622 | 205 |
| 289 | 3300010375 | Ga0105239_10505133 | Ga0105239_105051332 | 205 |
| 290 | 3300013104 | Ga0157370_10756297 | Ga0157370_107562972 | 205 |
| 291 | 3300013296 | Ga0157374_10344888 | Ga0157374_103448882 | 205 |
| 292 | 3300014497 | Ga0182008_10016239 | Ga0182008_100162394 | 205 |
| 293 | 3300014969 | Ga0157376_10450954 | Ga0157376_104509542 | 205 |
| 294 | 3300015261 | Ga0182006_1043277 | Ga0182006_10432772 | 205 |
| 295 | 3300015262 | Ga0182007_10184938 | Ga0182007_101849381 | 205 |
| 296 | 3300025250 | Ga0209026_1000025 | Ga0209026_1000025137 | 205 |
| 297 | 3300025254 | Ga0209148_1007732 | Ga0209148_10077323 | 205 |
| 298 | 3300025256 | Ga0209759_1000121 | Ga0209759_100012195 | 205 |
| 299 | 3300025261 | Ga0209233_1009623 | Ga0209233_10096233 | 205 |
| 300 | 3300025913 | Ga0207695_10313960 | Ga0207695_103139601 | 205 |
| 301 | 3300025924 | Ga0207694_10333257 | Ga0207694_103332572 | 205 |
| 302 | 3300025949 | Ga0207667_10198170 | Ga0207667_101981702 | 205 |
| 303 | 3300025981 | Ga0207640_10674588 | Ga0207640_106745882 | 205 |
| 304 | 3300026121 | Ga0207683_10535665 | Ga0207683_105356652 | 205 |
| 305 | 3300026142 | Ga0207698_10646927 | Ga0207698_106469272 | 205 |
| 306 | 3300036647 | Ga0316582_0268245 | Ga0316582_0268245_38_655 | 205 |
| 307 | 3300037418 | Ga0395900_0083708 | Ga0395900_0083708_921_1550 | 205 |
| 308 | 3300037466 | Ga0395898_0556675 | Ga0395898_0556675_87_722 | 205 |
| 309 | 3300037471 | Ga0395905_0015434 | Ga0395905_0015434_5918_6547 | 205 |
| 310 | 3300037471 | Ga0395905_0119552 | Ga0395905_0119552_1000_1629 | 205 |
| 311 | 3300037471 | Ga0395905_0209314 | Ga0395905_0209314_564_1199 | 205 |
| 312 | 3300038443 | Ga0395901_0134413 | Ga0395901_0134413_717_1346 | 205 |
| 313 | 3300038443 | Ga0395901_0169115 | Ga0395901_0169115_561_1190 | 205 |
| 314 | 3300038443 | Ga0395901_0259994 | Ga0395901_0259994_883_1518 | 205 |
| 315 | 3300038443 | Ga0395901_0316029 | Ga0395901_0316029_647_1285 | 205 |
| 316 | 3300041411 | Ga0439466_0070276 | Ga0439466_0070276_277_894 | 205 |
| 317 | 3300041453 | Ga0451797_0475723 | Ga0451797_0475723_237_875 | 205 |
| 318 | 3300044658 | Ga0466972_0091842 | Ga0466972_0091842_672_1301 | 205 |
| 319 | 3300046616 | Ga0495668_0018238 | Ga0495668_0018238_2764_3381 | 205 |
| 320 | 3300046660 | Ga0495625_0107896 | Ga0495625_0107896_565_1203 | 205 |
| 321 | 3300046660 | Ga0495625_0229481 | Ga0495625_0229481_182_820 | 205 |
| 322 | 3300048906 | Ga0496103_0101455 | Ga0496103_0101455_719_1336 | 205 |
| 323 | 3300048907 | Ga0496104_0835392 | Ga0496104_0835392_128_745 | 205 |
| 324 | 3300048913 | Ga0496110_0177679 | Ga0496110_0177679_708_1346 | 205 |
| 325 | 3300048915 | Ga0496112_0071137 | Ga0496112_0071137_2119_2757 | 205 |
| 326 | 3300048915 | Ga0496112_0253887 | Ga0496112_0253887_566_1195 | 205 |
| 327 | 3300048916 | Ga0496113_0295155 | Ga0496113_0295155_443_1081 | 205 |
| 328 | 3300048917 | Ga0496114_0185947 | Ga0496114_0185947_394_1032 | 205 |
| 329 | 3300048918 | Ga0496115_0072115 | Ga0496115_0072115_1355_1972 | 205 |
| 330 | 3300048921 | Ga0496118_0180042 | Ga0496118_0180042_302_919 | 205 |
| 331 | 3300048923 | Ga0496120_0020017 | Ga0496120_0020017_3164_3802 | 205 |
| 332 | 3300048929 | Ga0496126_0255257 | Ga0496126_0255257_502_1119 | 205 |
| 333 | 3300049568 | Ga0501031_0030819 | Ga0501031_0030819_2005_2628 | 205 |
| 334 | 3300049569 | Ga0501032_0015236 | Ga0501032_0015236_1944_2567 | 205 |
| 335 | 3300049570 | Ga0501033_0085611 | Ga0501033_0085611_158_781 | 205 |
| 336 | 3300049570 | Ga0501033_0354952 | Ga0501033_0354952_243_860 | 205 |
| 337 | 3300049572 | Ga0501036_0187135 | Ga0501036_0187135_41_664 | 205 |
| 338 | 3300049574 | Ga0501038_0298996 | Ga0501038_0298996_600_1223 | 205 |
| 339 | 3300049576 | Ga0501040_0170121 | Ga0501040_0170121_441_1064 | 205 |
| 340 | 3300049578 | Ga0501042_0069249 | Ga0501042_0069249_670_1293 | 205 |
| 341 | 3300049579 | Ga0501043_0141549 | Ga0501043_0141549_390_1013 | 205 |
| 342 | 3300049580 | Ga0501046_0044413 | Ga0501046_0044413_2046_2669 | 205 |
| 343 | 3300049581 | Ga0501047_0109312 | Ga0501047_0109312_1154_1777 | 205 |
| 344 | 3300049582 | Ga0501048_0090353 | Ga0501048_0090353_668_1291 | 205 |
| 345 | 3300049583 | Ga0501067_0123962 | Ga0501067_0123962_100_723 | 205 |
| 346 | 3300049586 | Ga0501070_0280879 | Ga0501070_0280879_41_664 | 205 |
| 347 | 3300049587 | Ga0501071_0085317 | Ga0501071_0085317_1256_1879 | 205 |
| 348 | 3300049742 | Ga0501080_0258029 | Ga0501080_0258029_13_636 | 205 |
| 349 | 3300049823 | Ga0501044_0411472 | Ga0501044_0411472_600_1223 | 205 |
| 350 | 3300050490 | nmdc:mga03n38_9312_c1 | nmdc:mga03n38_9312_c1_69_686 | 205 |
| 351 | 3300050491 | nmdc:mga00v17_117693_c1 | nmdc:mga00v17_117693_c1_861_1478 | 205 |
| 352 | 3300050492 | nmdc:mga0yw44_32317_c1 | nmdc:mga0yw44_32317_c1_803_1441 | 205 |
| 353 | 3300050492 | nmdc:mga0yw44_379344_c1 | nmdc:mga0yw44_379344_c1_212_829 | 205 |
| 354 | 3300053087 | Ga0500643_009681 | Ga0500643_009681_802_1419 | 205 |
| 355 | 3300053119 | Ga0500595_073615 | Ga0500595_073615_138_776 | 205 |
| 356 | 3300053134 | Ga0500658_0103214 | Ga0500658_0103214_484_1122 | 205 |
| 357 | 3300053139 | Ga0500568_0000093 | Ga0500568_0000093_80052_80678 | 205 |
| 358 | 3300053151 | Ga0500604_0008368 | Ga0500604_0008368_1449_2087 | 205 |
| 359 | 3300053155 | Ga0500620_004709 | Ga0500620_004709_1852_2469 | 205 |
| 360 | 3300053158 | Ga0500627_0122175 | Ga0500627_0122175_150_788 | 205 |
| 361 | iso_pu_bacteria | 2509276022 | 2509396314 | 205 |
| 362 | iso_pu_bacteria | 2693429783 | 2694631077 | 205 |
| 363 | iso_pu_bacteria | 2847686936 | 2847692261 | 205 |
| 364 | iso_pu_bacteria | 2856356410 | 2856360082 | 205 |
| 365 | iso_pu_bacteria | 2869162929 | 2869169296 | 205 |
| 366 | iso_pu_bacteria | 2871444079 | 2871448918 | 205 |
| 367 | iso_pu_bacteria | 2871488783 | 2871494537 | 205 |
| 368 | iso_pu_bacteria | 2871495908 | 2871501393 | 205 |
| 369 | iso_pu_bacteria | 2874102143 | 2874103725 | 205 |
| 370 | iso_pu_bacteria | 2878753008 | 2878758881 | 205 |
| 371 | iso_pu_bacteria | 2878760144 | 2878765373 | 205 |
| 372 | iso_pu_bacteria | 2878767105 | 2878773081 | 205 |
| 373 | iso_pu_bacteria | 2878781027 | 2878784536 | 205 |
| 374 | iso_pu_bacteria | 2881845957 | 2881853096 | 205 |
| 375 | iso_pu_bacteria | 2881861095 | 2881867307 | 205 |
| 376 | iso_pu_bacteria | 2882912400 | 2882912566 | 205 |
| 377 | iso_pu_bacteria | 2885305155 | 2885309437 | 205 |
| 378 | iso_pu_bacteria | 2885318864 | 2885323704 | 205 |
| 379 | iso_pu_bacteria | 2885326080 | 2885330376 | 205 |
| 380 | iso_pu_bacteria | 2885334103 | 2885337502 | 205 |
| 381 | iso_pu_bacteria | 2903492973 | 2903503880 | 205 |
| 382 | iso_pu_bacteria | 2903540706 | 2903546204 | 205 |
| 383 | iso_pu_bacteria | 2906328253 | 2906330002 | 205 |
| 384 | iso_pu_bacteria | 2922158528 | 2922162841 | 205 |
| 385 | iso_pu_bacteria | 2924726620 | 2924728238 | 205 |
| 386 | iso_pu_bacteria | 2924762789 | 2924764243 | 205 |
| 387 | iso_pu_bacteria | 2924784321 | 2924789085 | 205 |
| 388 | iso_pu_bacteria | 2937822353 | 2937824467 | 205 |
| 389 | iso_pu_bacteria | 2937868953 | 2937870541 | 205 |
| 390 | iso_pu_bacteria | 2937891427 | 2937896293 | 205 |
| 391 | iso_pu_bacteria | 2937994558 | 2938000062 | 205 |
| 392 | iso_pu_bacteria | 2938014810 | 2938022084 | 205 |
| 393 | iso_pu_bacteria | 2958115193 | 2958118465 | 205 |
| 394 | iso_pu_bacteria | 2958158011 | 2958161013 | 205 |
| 395 | iso_pu_bacteria | 2958165035 | 2958170526 | 205 |
| 396 | iso_pu_bacteria | 2961136820 | 2961138716 | 205 |
| 397 | iso_pu_bacteria | 2961163497 | 2961168981 | 205 |
| 398 | iso_pu_bacteria | 2961170736 | 2961176040 | 205 |
| 399 | iso_pu_bacteria | 2965018300 | 2965024268 | 205 |
| 400 | iso_pu_bacteria | 2965047637 | 2965051511 | 205 |
| 401 | iso_pu_bacteria | 2965062239 | 2965066008 | 205 |
| 402 | iso_pu_bacteria | 2965110997 | 2965117744 | 205 |
| 403 | iso_pu_bacteria | 2967996073 | 2968001928 | 205 |
| 404 | iso_pu_bacteria | 2968003550 | 2968009048 | 205 |
| 405 | iso_pu_bacteria | 2968091066 | 2968096370 | 205 |
| 406 | iso_pu_bacteria | 2968097103 | 2968098871 | 205 |
| 407 | iso_pu_bacteria | 2968128360 | 2968129189 | 205 |
| 408 | iso_pu_bacteria | 2968171901 | 2968177375 | 205 |
| 409 | iso_pu_bacteria | 2970489779 | 2970491112 | 205 |
| 410 | iso_pu_bacteria | 2970503327 | 2970508706 | 205 |
| 411 | iso_pu_bacteria | 2970554993 | 2970560221 | 205 |
| 412 | iso_pu_bacteria | 2977821940 | 2977827421 | 205 |
| 413 | iso_pu_bacteria | 2977828996 | 2977830956 | 205 |
| 414 | iso_pu_bacteria | 2977858184 | 2977859275 | 205 |
| 415 | iso_pu_bacteria | 2977935797 | 2977941196 | 205 |
| 416 | iso_pu_bacteria | 2977986579 | 2977986586 | 205 |
| 417 | iso_pu_bacteria | 2979779861 | 2979781286 | 205 |
| 418 | iso_pu_bacteria | 2979793036 | 2979796347 | 205 |
| 419 | iso_pu_bacteria | 2979808191 | 2979811646 | 205 |
| 420 | iso_pu_bacteria | 2987659509 | 2987665012 | 205 |
| 421 | iso_pu_bacteria | 2987666974 | 2987669238 | 205 |
| 422 | iso_pu_bacteria | 2996341866 | 2996345075 | 205 |
| 423 | iso_pu_bacteria | 3004188549 | 3004194069 | 205 |
| 424 | iso_pu_bacteria | 637000159 | 637074592 | 205 |
| 425 | iso_pu_bacteria | 8004312739 | 8004314007 | 205 |
| 426 | iso_pu_bacteria | 8004374579 | 8004380402 | 205 |
| 427 | iso_pu_bacteria | 8004445564 | 8004450196 | 205 |
| 428 | iso_pu_bacteria | 8004703790 | 8004709367 | 205 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oru-assembly1.cif.gz_B | crystal structure of apc1665, yuad protein from bacillus subtilis | 0.9581 | 17 | 197 |
| 1oru-assembly1.cif.gz_B | crystal structure of apc1665, yuad protein from bacillus subtilis | 0.9378 | 17 | 197 |
| 6ksh-assembly1.cif.gz_C | crystal structure of pyruvate kinase (pyk) from plasmodium falciparum in complex with oxalate and atp | 0.7818 | 110 | 193 |
| 1o67-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.7704 | 18 | 195 |
| 5yhh-assembly1.cif.gz_A | crystal structure of yiim from geobacillus stearothermophilus | 0.7626 | 22 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9497 | 18 | 197 | 2.40.33.20 |
| 1oruB00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.9289 | 18 | 197 | 2.40.33.20 |
| af_P9WKE5_72_166_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.7083 | 81 | 195 | 3.20.20.60 |
| 5yhiA00 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.6974 | 18 | 205 | 2.40.33.20 |
| af_A1Z803_208_336_2.40.33.20 | Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like | 0.6899 | 81 | 193 | 2.40.33.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531M5Y8-F1-model_v4 | Molybdenum cofactor sulfurase | 0.9711 | 96 | 205 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A659UJ01-F1-model_v4 | Molybdenum cofactor sulfurase | 0.9709 | 84 | 205 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A6B3TLT2-F1-model_v4 | MOSC domain-containing protein | 0.9666 | 98 | 197 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A659UJ01-F1-model_v4 | Molybdenum cofactor sulfurase | 0.963 | 84 | 205 |
GO:0003824
GO:0030151 GO:0030170 |
| AF-A0A530MEV2-F1-model_v4 | Molybdenum cofactor sulfurase | 0.9591 | 75 | 154 |
GO:0003824
GO:0030151 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar