F441608

General Info

Members Datasets Scaffolds Average Seq Length
428 362 176 205

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100338183|Ga0070674_1003381832
Length 231
Sequence MIQKQNATPDLFPESEKPVEIIPARKLSAKVAALYVAPLDHFQTRAVQELQLGFDGIDGDFHAGATRRSGGREPWYPRGTEMRNERQISIVAADELAIVAGRMGLAEIKPEWIGANLLIEGVPHLSMLPSGTLLFFKGGVTIKVDAQNGPCRLAGRSVAENAGMADRETGALAFTKAAKRLRGLVAWVEKPGCITTGDFRARAGAVDLSSLSIAEGRGCAAKATQPDLKTI

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
14 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
15 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
16 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
17 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
18 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
19 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
20 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
21 2738543024 Aminobacter sp. AP02 Isolate Unclassified
22 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
23 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
24 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
25 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
26 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
27 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
30 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
31 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
32 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
33 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
34 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
35 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
36 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
37 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
38 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
39 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
40 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
41 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
42 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
43 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
44 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
45 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
46 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
47 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
48 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
49 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
50 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
51 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
52 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
53 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
54 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
55 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
56 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
57 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
58 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
59 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
60 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
61 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
62 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
63 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
64 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
65 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
66 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
67 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
68 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
69 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
70 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
71 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
72 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
73 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
74 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
75 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
76 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
77 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
78 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
79 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
80 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
81 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
82 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
83 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
84 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
85 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
86 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
87 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
88 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
89 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
90 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
91 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
92 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
93 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
94 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
95 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
96 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
97 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
98 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
99 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
100 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
101 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
102 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
103 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
104 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
105 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
106 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
107 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
108 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
109 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
110 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
111 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
112 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
113 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
114 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
115 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
116 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
117 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
118 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
119 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
120 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
121 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
122 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
123 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
124 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
125 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
126 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
127 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
128 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
129 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
130 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
131 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
132 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
133 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
134 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
135 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
136 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
137 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
138 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
139 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
140 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
141 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
142 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
143 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
144 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
145 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
146 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
147 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
148 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
149 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
150 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
151 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
152 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
153 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
154 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
155 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
156 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
157 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
158 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
159 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
160 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
161 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
162 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
163 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
164 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
165 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
166 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
167 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
168 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
169 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
170 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
171 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
172 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
173 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
174 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
175 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
176 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
177 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
178 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
179 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
180 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
181 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
182 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
183 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
184 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
185 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
186 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
187 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
188 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
189 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
190 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
191 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
192 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
193 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
194 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
195 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
196 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
197 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
198 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
199 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
200 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
201 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
202 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
203 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
204 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
205 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
206 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
207 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
208 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
209 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
210 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
211 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
212 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
213 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
214 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
215 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
216 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
217 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
218 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
219 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
220 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
221 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
222 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
223 3004167301 Mesorhizobium loti 582 Isolate Unclassified
224 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
225 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
226 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
227 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
228 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
229 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
230 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
231 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
232 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
233 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
234 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
235 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
236 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
237 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
238 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
239 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
240 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
241 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
242 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
243 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
244 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
245 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
246 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
247 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
248 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
249 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
250 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
251 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
252 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
253 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
254 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
255 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
256 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
257 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
258 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
259 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
260 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
261 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
262 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
263 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
264 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
265 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
266 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
267 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
268 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
269 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
270 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
271 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
274 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
275 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
288 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
296 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
297 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
298 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
336 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
337 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
338 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
345 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
346 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
347 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
348 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
349 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
350 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
351 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
352 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
353 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
354 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
355 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
356 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
357 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
358 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
359 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
360 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
361 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
362 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.12
Metatranscriptomes 0
Isolates 58.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.88
Nodule 50.47
Rhizoplane 2.8
Rhizosphere 28.74
Stem 0
Stem Tuber 0
Unclassified 9.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1004419 3300002705 Bacteria 4284
2 JGI25157J39369_1000162 3300002741 Bacteria 55941
3 JGI25165J46597_1000015 3300003214 Bacteria 380891
4 Ga0055542_1000986 3300003762 Bacteria 18435
5 Ga0055529_1002120 3300003763 Bacteria 4190
6 Ga0070658_10121469 3300005327 Bacteria 2171
7 Ga0070660_100358514 3300005339 Bacteria 1201
8 Ga0070661_100911560 3300005344 Bacteria 726
9 Ga0070674_100048646 3300005356 Bacteria 2911
10 Ga0070674_100338183 3300005356 Bacteria 1212
11 Ga0070678_100580165 3300005456 Bacteria 999
12 Ga0068853_100027297 3300005539 Bacteria 4796
13 Ga0068853_100568027 3300005539 Bacteria 1075
14 Ga0070665_100226586 3300005548 Bacteria 1869
15 Ga0070665_100480186 3300005548 Bacteria 1254
16 Ga0068856_100109505 3300005614 Bacteria 2759
17 Ga0081539_10003450 3300005985 Bacteria 19403
18 Ga0075365_10034011 3300006038 Bacteria 3289
19 Ga0075365_10104589 3300006038 Bacteria 1941
20 Ga0075368_10115664 3300006042 Bacteria 1108
21 Ga0075363_100093712 3300006048 Bacteria 1655
22 Ga0075364_10024071 3300006051 Bacteria 3861
23 Ga0075367_10018980 3300006178 Bacteria 3804
24 Ga0075367_10132029 3300006178 Bacteria 1544
25 Ga0075369_10038628 3300006186 Bacteria 2037
26 Ga0075369_10062043 3300006186 Bacteria 1632
27 Ga0075366_10086290 3300006195 Bacteria 1878
28 Ga0075366_10352625 3300006195 Bacteria 903
29 Ga0075370_10076534 3300006353 Bacteria 1919
30 Ga0105240_10137242 3300009093 Bacteria 2928
31 Ga0105240_10305106 3300009093 Bacteria 1820
32 Ga0105241_10540431 3300009174 Bacteria 1045
33 Ga0105242_10810344 3300009176 Bacteria 928
34 Ga0105237_10024483 3300009545 Bacteria 6175
35 Ga0105237_10453509 3300009545 Bacteria 1288
36 Ga0105237_10824679 3300009545 Bacteria 934
37 Ga0105238_10033203 3300009551 Bacteria 5253
38 Ga0105238_10476662 3300009551 Bacteria 1247
39 Ga0105239_10047979 3300010375 Bacteria 4681
40 Ga0105239_10101184 3300010375 Bacteria 3188
41 Ga0105239_10505133 3300010375 Bacteria 1375
42 Ga0157370_10756297 3300013104 Bacteria 885
43 Ga0157369_10509352 3300013105 Bacteria 1245
44 Ga0157374_10344888 3300013296 Bacteria 1479
45 Ga0157380_10959890 3300014326 Bacteria 885
46 Ga0182008_10016239 3300014497 Bacteria 3872
47 Ga0157376_10450954 3300014969 Bacteria 1255
48 Ga0182006_1043277 3300015261 Bacteria 1761
49 Ga0182007_10184938 3300015262 Bacteria 722
50 Ga0209026_1000025 3300025250 Bacteria 352548
51 Ga0209677_109509 3300025253 Bacteria 1735
52 Ga0209148_1000181 3300025254 Bacteria 124691
53 Ga0209148_1007732 3300025254 Bacteria 2208
54 Ga0209759_1000121 3300025256 Bacteria 138469
55 Ga0209233_1000010 3300025261 Bacteria 1194329
56 Ga0209233_1009623 3300025261 Bacteria 2935
57 Ga0209455_1000127 3300025272 Bacteria 162518
58 Ga0209758_1027610 3300025297 Bacteria 2421
59 Ga0207647_10018662 3300025904 Bacteria 4684
60 Ga0207647_10077256 3300025904 Bacteria 2002
61 Ga0207705_10086894 3300025909 Bacteria 2286
62 Ga0207695_10313960 3300025913 Bacteria 1457
63 Ga0207695_10383570 3300025913 Bacteria 1291
64 Ga0207694_10003031 3300025924 Bacteria 13465
65 Ga0207694_10333257 3300025924 Bacteria 1254
66 Ga0207667_10198170 3300025949 Bacteria 2060
67 Ga0207640_10674588 3300025981 Bacteria 883
68 Ga0207639_10003685 3300026041 Bacteria 10298
69 Ga0207678_10064613 3300026067 Bacteria 3144
70 Ga0207683_10535665 3300026121 Bacteria 1082
71 Ga0207698_10646927 3300026142 Bacteria 1047
72 Ga0209813_10085130 3300027866 Bacteria 1052
73 Ga0207428_10527118 3300027907 Bacteria 856
74 Ga0268266_10013179 3300028379 Bacteria 7130
75 Ga0316582_0016286 3300036647 Bacteria 4273
76 Ga0316582_0268245 3300036647 Bacteria 1171
77 Ga0395900_0083708 3300037418 Bacteria 3277
78 Ga0395898_0556675 3300037466 Bacteria 1089
79 Ga0395905_0015434 3300037471 Bacteria 7262
80 Ga0395905_0055498 3300037471 Bacteria 3707
81 Ga0395905_0119552 3300037471 Bacteria 2476
82 Ga0395905_0209314 3300037471 Bacteria 1827
83 Ga0395901_0096853 3300038443 Bacteria 3092
84 Ga0395901_0134413 3300038443 Bacteria 2599
85 Ga0395901_0169115 3300038443 Bacteria 2294
86 Ga0395901_0259994 3300038443 Bacteria 1807
87 Ga0395901_0316029 3300038443 Bacteria 1617
88 Ga0439466_0070276 3300041411 Bacteria 1116
89 Ga0451797_0475723 3300041453 Bacteria 935
90 Ga0466972_0091842 3300044658 Bacteria 1439
91 Ga0495638_0076062 3300046460 Bacteria 2045
92 Ga0495668_0018238 3300046616 Bacteria 4056
93 Ga0495625_0107896 3300046660 Bacteria 1905
94 Ga0495625_0110335 3300046660 Bacteria 1881
95 Ga0495625_0229481 3300046660 Bacteria 1213
96 Ga0496103_0101455 3300048906 Bacteria 1822
97 Ga0496104_0835392 3300048907 Bacteria 827
98 Ga0496110_0177679 3300048913 Bacteria 1933
99 Ga0496112_0071137 3300048915 Bacteria 3438
100 Ga0496112_0253887 3300048915 Bacteria 1709
101 Ga0496113_0295155 3300048916 Bacteria 1297
102 Ga0496114_0185947 3300048917 Bacteria 1816
103 Ga0496115_0072115 3300048918 Bacteria 2802
104 Ga0496118_0180042 3300048921 Bacteria 1278
105 Ga0496119_0019343 3300048922 Bacteria 5021
106 Ga0496120_0003090 3300048923 Bacteria 15675
107 Ga0496120_0020017 3300048923 Bacteria 4264
108 Ga0496126_0208762 3300048929 Bacteria 1645
109 Ga0496126_0255257 3300048929 Bacteria 1460
110 Ga0501031_0030724 3300049568 Bacteria 3504
111 Ga0501031_0030819 3300049568 Bacteria 3498
112 Ga0501032_0000075 3300049569 Bacteria 84153
113 Ga0501032_0015236 3300049569 Bacteria 5428
114 Ga0501033_0000216 3300049570 Bacteria 55449
115 Ga0501033_0012955 3300049570 Bacteria 6360
116 Ga0501033_0085611 3300049570 Bacteria 2308
117 Ga0501033_0230208 3300049570 Bacteria 1317
118 Ga0501033_0354952 3300049570 Bacteria 1026
119 Ga0501034_0000476 3300049571 Bacteria 65960
120 Ga0501034_0582967 3300049571 Bacteria 1025
121 Ga0501036_0000398 3300049572 Bacteria 30616
122 Ga0501036_0187135 3300049572 Bacteria 1742
123 Ga0501036_0610173 3300049572 Bacteria 905
124 Ga0501037_0000021 3300049573 Bacteria 150037
125 Ga0501038_0000032 3300049574 Bacteria 131432
126 Ga0501038_0096322 3300049574 Bacteria 2471
127 Ga0501038_0208661 3300049574 Bacteria 1564
128 Ga0501038_0298996 3300049574 Bacteria 1263
129 Ga0501039_0000025 3300049575 Bacteria 152236
130 Ga0501040_0170121 3300049576 Bacteria 1543
131 Ga0501042_0069249 3300049578 Bacteria 2523
132 Ga0501042_0378250 3300049578 Bacteria 1025
133 Ga0501043_0000570 3300049579 Bacteria 32944
134 Ga0501043_0141549 3300049579 Bacteria 1883
135 Ga0501043_0180767 3300049579 Bacteria 1643
136 Ga0501043_0220262 3300049579 Bacteria 1468
137 Ga0501046_0044413 3300049580 Bacteria 3534
138 Ga0501046_0046069 3300049580 Bacteria 3462
139 Ga0501046_0205071 3300049580 Bacteria 1466
140 Ga0501047_0003462 3300049581 Bacteria 14913
141 Ga0501047_0109312 3300049581 Bacteria 2647
142 Ga0501048_0090353 3300049582 Bacteria 2160
143 Ga0501067_0123962 3300049583 Bacteria 1438
144 Ga0501068_0055943 3300049584 Bacteria 2391
145 Ga0501070_0000264 3300049586 Bacteria 49510
146 Ga0501070_0020934 3300049586 Bacteria 5487
147 Ga0501070_0276253 3300049586 Bacteria 1371
148 Ga0501070_0280879 3300049586 Bacteria 1358
149 Ga0501071_0085317 3300049587 Bacteria 2315
150 Ga0501074_0007044 3300049590 Bacteria 8121
151 Ga0501079_0381724 3300049741 Bacteria 1105
152 Ga0501080_0003495 3300049742 Bacteria 13843
153 Ga0501080_0258029 3300049742 Bacteria 1588
154 Ga0501035_0000085 3300049822 Bacteria 116189
155 Ga0501035_0002015 3300049822 Bacteria 20268
156 Ga0501035_0316739 3300049822 Bacteria 1311
157 Ga0501044_0010392 3300049823 Bacteria 10099
158 Ga0501044_0032428 3300049823 Bacteria 5492
159 Ga0501044_0042087 3300049823 Bacteria 4754
160 Ga0501044_0411472 3300049823 Bacteria 1263
161 Ga0501044_0839531 3300049823 Bacteria 796
162 nmdc:mga03n38_9312_c1 3300050490 Bacteria 3567
163 nmdc:mga00v17_117693_c1 3300050491 Bacteria 1690
164 nmdc:mga0yw44_32317_c1 3300050492 Bacteria 3049
165 nmdc:mga0yw44_379344_c1 3300050492 Bacteria 954
166 nmdc:mga0yw44_455090_c1 3300050492 Bacteria 867
167 nmdc:mga0yw44_574172_c1 3300050492 Bacteria 766
168 nmdc:mga04h51_193746_c1 3300050495 Bacteria 796
169 Ga0500643_009681 3300053087 Bacteria 3659
170 Ga0500595_073615 3300053119 Bacteria 1010
171 Ga0500658_0103214 3300053134 Bacteria 1247
172 Ga0500568_0000093 3300053139 Bacteria 83403
173 Ga0500604_0008368 3300053151 Bacteria 2744
174 Ga0500620_004709 3300053155 Bacteria 3078
175 Ga0500627_0122175 3300053158 Bacteria 1175
176 Ga0500627_0172406 3300053158 Bacteria 974

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2844002411 2844007419 190
2 iso_pu_bacteria 2888350351 2888355763 194
3 iso_pu_bacteria 2889010040 2889010700 194
4 iso_pu_bacteria 2889016732 2889017603 194
5 iso_pu_bacteria 2906354277 2906360843 194
6 iso_pu_bacteria 2922130491 2922134340 194
7 iso_pu_bacteria 2922185730 2922187927 194
8 iso_pu_bacteria 2958100919 2958105748 194
9 iso_pu_bacteria 2958172287 2958173535 194
10 iso_pu_bacteria 2965102966 2965108797 194
11 iso_pu_bacteria 2965119406 2965122057 194
12 iso_pu_bacteria 2977971508 2977974523 194
13 iso_pu_bacteria 2979710463 2979717540 194
14 iso_pu_bacteria 2979742915 2979749647 194
15 iso_pu_bacteria 2987652177 2987654656 194
16 iso_pu_bacteria 2847670302 2847675617 195
17 iso_pu_bacteria 2856314179 2856319504 195
18 iso_pu_bacteria 2878035449 2878040739 195
19 iso_pu_bacteria 2906414383 2906420224 195
20 3300036647 Ga0316582_0016286 Ga0316582_0016286_643_1233 196
21 iso_pu_bacteria 2765235802 2765464593 198
22 iso_pu_bacteria 2767802442 2770195467 198
23 iso_pu_bacteria 2840764183 2840767382 198
24 iso_pu_bacteria 2894652903 2894655968 198
25 iso_pu_bacteria 2904578770 2904580552 198
26 iso_pu_bacteria 2919119836 2919121701 198
27 iso_pu_bacteria 3004334049 3004334348 199
28 iso_pu_bacteria 8004395343 8004396334 199
29 iso_pu_bacteria 2856349417 2856352438 200
30 iso_pu_bacteria 2881155292 2881155311 200
31 iso_pu_bacteria 2881853255 2881853704 200
32 iso_pu_bacteria 2885342637 2885347529 200
33 iso_pu_bacteria 2885350715 2885356701 200
34 iso_pu_bacteria 2961127735 2961131607 200
35 iso_pu_bacteria 8004640170 8004640815 200
36 3300049568 Ga0501031_0030724 Ga0501031_0030724_1973_2650 201
37 3300049569 Ga0501032_0000075 Ga0501032_0000075_49236_49913 201
38 3300049570 Ga0501033_0000216 Ga0501033_0000216_50799_51476 201
39 3300049570 Ga0501033_0012955 Ga0501033_0012955_1616_2239 201
40 3300049570 Ga0501033_0230208 Ga0501033_0230208_193_807 201
41 3300049571 Ga0501034_0000476 Ga0501034_0000476_16048_16725 201
42 3300049572 Ga0501036_0000398 Ga0501036_0000398_891_1568 201
43 3300049572 Ga0501036_0610173 Ga0501036_0610173_275_889 201
44 3300049573 Ga0501037_0000021 Ga0501037_0000021_99799_100476 201
45 3300049574 Ga0501038_0000032 Ga0501038_0000032_81520_82197 201
46 3300049574 Ga0501038_0096322 Ga0501038_0096322_107_721 201
47 3300049574 Ga0501038_0208661 Ga0501038_0208661_480_1103 201
48 3300049575 Ga0501039_0000025 Ga0501039_0000025_95789_96466 201
49 3300049578 Ga0501042_0378250 Ga0501042_0378250_220_897 201
50 3300049579 Ga0501043_0000570 Ga0501043_0000570_16048_16725 201
51 3300049579 Ga0501043_0180767 Ga0501043_0180767_818_1441 201
52 3300049579 Ga0501043_0220262 Ga0501043_0220262_664_1278 201
53 3300049580 Ga0501046_0046069 Ga0501046_0046069_105_782 201
54 3300049580 Ga0501046_0205071 Ga0501046_0205071_300_914 201
55 3300049581 Ga0501047_0003462 Ga0501047_0003462_470_1093 201
56 3300049584 Ga0501068_0055943 Ga0501068_0055943_1519_2142 201
57 3300049586 Ga0501070_0000264 Ga0501070_0000264_38622_39245 201
58 3300049586 Ga0501070_0020934 Ga0501070_0020934_2588_3202 201
59 3300049590 Ga0501074_0007044 Ga0501074_0007044_827_1450 201
60 3300049741 Ga0501079_0381724 Ga0501079_0381724_379_1002 201
61 3300049742 Ga0501080_0003495 Ga0501080_0003495_12707_13330 201
62 3300049822 Ga0501035_0000085 Ga0501035_0000085_61831_62508 201
63 3300049822 Ga0501035_0002015 Ga0501035_0002015_3995_4618 201
64 3300049823 Ga0501044_0010392 Ga0501044_0010392_6180_6857 201
65 3300049823 Ga0501044_0032428 Ga0501044_0032428_3931_4545 201
66 iso_pu_bacteria 2503198000 2503201538 201
67 iso_pu_bacteria 2508501123 2509113140 201
68 iso_pu_bacteria 2508501127 2509143300 201
69 iso_pu_bacteria 2509276018 2509367817 201
70 iso_pu_bacteria 2510065059 2510315495 201
71 iso_pu_bacteria 2512875016 2512931492 201
72 iso_pu_bacteria 2512875024 2512959323 201
73 iso_pu_bacteria 2513237090 2513612729 201
74 iso_pu_bacteria 2513237164 2514033630 201
75 iso_pu_bacteria 2513237305 2514420885 201
76 iso_pu_bacteria 2513237351 2514589264 201
77 iso_pu_bacteria 2597489875 2597813223 201
78 iso_pu_bacteria 2599185301 2599936747 201
79 iso_pu_bacteria 2643221595 2643984403 201
80 iso_pu_bacteria 2643221623 2644129380 201
81 iso_pu_bacteria 2643221627 2644153260 201
82 iso_pu_bacteria 2687453392 2688598450 201
83 iso_pu_bacteria 2721755686 2723575383 201
84 iso_pu_bacteria 2738543024 2739307170 201
85 iso_pu_bacteria 2756170246 2756675462 201
86 iso_pu_bacteria 2791355123 2792749245 201
87 iso_pu_bacteria 2841734538 2841739200 201
88 iso_pu_bacteria 2844009547 2844013708 201
89 iso_pu_bacteria 2856328259 2856334570 201
90 iso_pu_bacteria 2856334872 2856340885 201
91 iso_pu_bacteria 2856342000 2856344939 201
92 iso_pu_bacteria 2869234852 2869237206 201
93 iso_pu_bacteria 2869242130 2869244700 201
94 iso_pu_bacteria 2869249662 2869253108 201
95 iso_pu_bacteria 2869256925 2869260292 201
96 iso_pu_bacteria 2869264136 2869268594 201
97 iso_pu_bacteria 2869271264 2869272231 201
98 iso_pu_bacteria 2869278585 2869284938 201
99 iso_pu_bacteria 2871435913 2871442677 201
100 iso_pu_bacteria 2871451962 2871457894 201
101 iso_pu_bacteria 2871459585 2871462734 201
102 iso_pu_bacteria 2871481445 2871486605 201
103 iso_pu_bacteria 2874109183 2874112351 201
104 iso_pu_bacteria 2874116593 2874122673 201
105 iso_pu_bacteria 2874123672 2874130603 201
106 iso_pu_bacteria 2874131515 2874132091 201
107 iso_pu_bacteria 2874168670 2874169864 201
108 iso_pu_bacteria 2876363079 2876368473 201
109 iso_pu_bacteria 2876386047 2876386709 201
110 iso_pu_bacteria 2876392853 2876398446 201
111 iso_pu_bacteria 2876399893 2876400208 201
112 iso_pu_bacteria 2876420981 2876422999 201
113 iso_pu_bacteria 2878774303 2878777090 201
114 iso_pu_bacteria 2881147464 2881151337 201
115 iso_pu_bacteria 2881161766 2881167536 201
116 iso_pu_bacteria 2882632389 2882636279 201
117 iso_pu_bacteria 2888343758 2888346826 201
118 iso_pu_bacteria 2903448605 2903451322 201
119 iso_pu_bacteria 2903513507 2903517871 201
120 iso_pu_bacteria 2903521522 2903527472 201
121 iso_pu_bacteria 2903528002 2903533926 201
122 iso_pu_bacteria 2904659560 2904665001 201
123 iso_pu_bacteria 2906363423 2906366769 201
124 iso_pu_bacteria 2906370794 2906372610 201
125 iso_pu_bacteria 2906378014 2906385074 201
126 iso_pu_bacteria 2906386501 2906387988 201
127 iso_pu_bacteria 2906401398 2906405395 201
128 iso_pu_bacteria 2906408224 2906408909 201
129 iso_pu_bacteria 2906427513 2906431108 201
130 iso_pu_bacteria 2922151315 2922152076 201
131 iso_pu_bacteria 2922172374 2922178289 201
132 iso_pu_bacteria 2922178524 2922182844 201
133 iso_pu_bacteria 2924733363 2924736435 201
134 iso_pu_bacteria 2924741084 2924743492 201
135 iso_pu_bacteria 2924748358 2924750107 201
136 iso_pu_bacteria 2937836603 2937839389 201
137 iso_pu_bacteria 2937843397 2937848038 201
138 iso_pu_bacteria 2937848649 2937853179 201
139 iso_pu_bacteria 2937861824 2937866280 201
140 iso_pu_bacteria 2937877337 2937882117 201
141 iso_pu_bacteria 2958034702 2958040640 201
142 iso_pu_bacteria 2958041894 2958056722 201
143 iso_pu_bacteria 2958064165 2958064370 201
144 iso_pu_bacteria 2958071322 2958078194 201
145 iso_pu_bacteria 2958084443 2958089239 201
146 iso_pu_bacteria 2958137437 2958138003 201
147 iso_pu_bacteria 2961114664 2961120000 201
148 iso_pu_bacteria 2961183825 2961185947 201
149 iso_pu_bacteria 2963644680 2963647720 201
150 iso_pu_bacteria 2965025482 2965031748 201
151 iso_pu_bacteria 2965032056 2965038124 201
152 iso_pu_bacteria 2965040258 2965045716 201
153 iso_pu_bacteria 2965089291 2965094790 201
154 iso_pu_bacteria 2968083720 2968090352 201
155 iso_pu_bacteria 2968110612 2968116357 201
156 iso_pu_bacteria 2970510686 2970514625 201
157 iso_pu_bacteria 2970524798 2970528596 201
158 iso_pu_bacteria 2970532167 2970539673 201
159 iso_pu_bacteria 2970540015 2970544788 201
160 iso_pu_bacteria 2970547951 2970552019 201
161 iso_pu_bacteria 2970593180 2970599553 201
162 iso_pu_bacteria 2977864932 2977867083 201
163 iso_pu_bacteria 2977872689 2977877298 201
164 iso_pu_bacteria 2977898635 2977904958 201
165 iso_pu_bacteria 2977907340 2977911336 201
166 iso_pu_bacteria 2977915119 2977916775 201
167 iso_pu_bacteria 2977922695 2977924229 201
168 iso_pu_bacteria 2977950692 2977952284 201
169 iso_pu_bacteria 2977957713 2977957856 201
170 iso_pu_bacteria 2979764755 2979766233 201
171 iso_pu_bacteria 2979772303 2979774489 201
172 iso_pu_bacteria 2987645492 2987645779 201
173 iso_pu_bacteria 2987673487 2987676014 201
174 iso_pu_bacteria 2996310559 2996314071 201
175 iso_pu_bacteria 2996386984 2996391441 201
176 iso_pu_bacteria 3000135777 3000140654 201
177 iso_pu_bacteria 3004167301 3004168909 201
178 iso_pu_bacteria 3004195979 3004200569 201
179 iso_pu_bacteria 3004211236 3004215964 201
180 iso_pu_bacteria 3004218560 3004223714 201
181 iso_pu_bacteria 3004232784 3004235839 201
182 iso_pu_bacteria 3004239961 3004244922 201
183 iso_pu_bacteria 3004248173 3004254703 201
184 iso_pu_bacteria 3004268573 3004274949 201
185 iso_pu_bacteria 649633066 649872976 201
186 iso_pu_bacteria 8002285264 8002289039 201
187 iso_pu_bacteria 8004300914 8004301046 201
188 iso_pu_bacteria 8004361976 8004365137 201
189 iso_pu_bacteria 8004633249 8004634846 201
190 iso_pu_bacteria 8004695233 8004703600 201
191 iso_pu_bacteria 8004727605 8004731437 201
192 iso_pu_bacteria 8055617313 8055620779 201
193 3300046660 Ga0495625_0110335 Ga0495625_0110335_973_1581 202
194 3300049571 Ga0501034_0582967 Ga0501034_0582967_157_774 202
195 3300049823 Ga0501044_0839531 Ga0501044_0839531_112_729 202
196 3300027907 Ga0207428_10527118 Ga0207428_105271181 203
197 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015178 204
198 3300003762 Ga0055542_1000986 Ga0055542_100098616 204
199 3300003763 Ga0055529_1002120 Ga0055529_10021207 204
200 3300005327 Ga0070658_10121469 Ga0070658_101214692 204
201 3300005339 Ga0070660_100358514 Ga0070660_1003585141 204
202 3300005539 Ga0068853_100027297 Ga0068853_1000272973 204
203 3300005614 Ga0068856_100109505 Ga0068856_1001095053 204
204 3300005985 Ga0081539_10003450 Ga0081539_100034501 204
205 3300006038 Ga0075365_10034011 Ga0075365_100340114 204
206 3300006038 Ga0075365_10104589 Ga0075365_101045893 204
207 3300006051 Ga0075364_10024071 Ga0075364_100240714 204
208 3300006178 Ga0075367_10132029 Ga0075367_101320291 204
209 3300009176 Ga0105242_10810344 Ga0105242_108103441 204
210 3300009545 Ga0105237_10024483 Ga0105237_100244832 204
211 3300009545 Ga0105237_10824679 Ga0105237_108246791 204
212 3300009551 Ga0105238_10033203 Ga0105238_100332036 204
213 3300010375 Ga0105239_10047979 Ga0105239_100479797 204
214 3300010375 Ga0105239_10101184 Ga0105239_101011843 204
215 3300013105 Ga0157369_10509352 Ga0157369_105093522 204
216 3300014326 Ga0157380_10959890 Ga0157380_109598902 204
217 3300025253 Ga0209677_109509 Ga0209677_1095093 204
218 3300025254 Ga0209148_1000181 Ga0209148_1000181106 204
219 3300025261 Ga0209233_1000010 Ga0209233_1000010276 204
220 3300025272 Ga0209455_1000127 Ga0209455_1000127106 204
221 3300025297 Ga0209758_1027610 Ga0209758_10276102 204
222 3300025904 Ga0207647_10018662 Ga0207647_100186626 204
223 3300025904 Ga0207647_10077256 Ga0207647_100772562 204
224 3300025909 Ga0207705_10086894 Ga0207705_100868942 204
225 3300025913 Ga0207695_10383570 Ga0207695_103835702 204
226 3300025924 Ga0207694_10003031 Ga0207694_100030317 204
227 3300026041 Ga0207639_10003685 Ga0207639_100036853 204
228 3300026067 Ga0207678_10064613 Ga0207678_100646132 204
229 3300027866 Ga0209813_10085130 Ga0209813_100851302 204
230 3300028379 Ga0268266_10013179 Ga0268266_100131795 204
231 3300037471 Ga0395905_0055498 Ga0395905_0055498_2045_2671 204
232 3300038443 Ga0395901_0096853 Ga0395901_0096853_1785_2411 204
233 3300046460 Ga0495638_0076062 Ga0495638_0076062_933_1547 204
234 3300048922 Ga0496119_0019343 Ga0496119_0019343_1045_1671 204
235 3300048923 Ga0496120_0003090 Ga0496120_0003090_4004_4630 204
236 3300048929 Ga0496126_0208762 Ga0496126_0208762_337_960 204
237 3300049586 Ga0501070_0276253 Ga0501070_0276253_525_1151 204
238 3300049822 Ga0501035_0316739 Ga0501035_0316739_109_735 204
239 3300049823 Ga0501044_0042087 Ga0501044_0042087_3906_4532 204
240 3300050492 nmdc:mga0yw44_455090_c1 nmdc:mga0yw44_455090_c1_206_820 204
241 3300050492 nmdc:mga0yw44_574172_c1 nmdc:mga0yw44_574172_c1_138_752 204
242 3300050495 nmdc:mga04h51_193746_c1 nmdc:mga04h51_193746_c1_159_773 204
243 3300053158 Ga0500627_0172406 Ga0500627_0172406_333_947 204
244 iso_pu_bacteria 2856364286 2856369464 204
245 iso_pu_bacteria 2857349434 2857351149 204
246 iso_pu_bacteria 2869285874 2869286462 204
247 iso_pu_bacteria 2871429161 2871434615 204
248 iso_pu_bacteria 2874146452 2874149821 204
249 iso_pu_bacteria 2874155637 2874158079 204
250 iso_pu_bacteria 2876413966 2876416283 204
251 iso_pu_bacteria 2878745973 2878751748 204
252 iso_pu_bacteria 2903492973 2903504694 204
253 iso_pu_bacteria 2906308376 2906314146 204
254 iso_pu_bacteria 2906321335 2906327312 204
255 iso_pu_bacteria 2937813078 2937815743 204
256 iso_pu_bacteria 2958041894 2958057107 204
257 iso_pu_bacteria 2958130278 2958130865 204
258 iso_pu_bacteria 2958179912 2958184786 204
259 iso_pu_bacteria 2961077736 2961082953 204
260 iso_pu_bacteria 2968117919 2968120637 204
261 iso_pu_bacteria 2977843712 2977845979 204
262 iso_pu_bacteria 2977942078 2977942752 204
263 iso_pu_bacteria 2987636660 2987638333 204
264 iso_pu_bacteria 3004203850 3004205423 204
265 iso_pu_bacteria 8004387939 8004393636 204
266 iso_pu_bacteria 8004714634 8004720404 204
267 3300002705 JGI25156J39149_1004419 JGI25156J39149_10044192 205
268 3300002741 JGI25157J39369_1000162 JGI25157J39369_100016229 205
269 3300005344 Ga0070661_100911560 Ga0070661_1009115601 205
270 3300005356 Ga0070674_100048646 Ga0070674_1000486463 205
271 3300005356 Ga0070674_100338183 Ga0070674_1003381832 205
272 3300005456 Ga0070678_100580165 Ga0070678_1005801651 205
273 3300005539 Ga0068853_100568027 Ga0068853_1005680272 205
274 3300005548 Ga0070665_100226586 Ga0070665_1002265861 205
275 3300005548 Ga0070665_100480186 Ga0070665_1004801862 205
276 3300006042 Ga0075368_10115664 Ga0075368_101156641 205
277 3300006048 Ga0075363_100093712 Ga0075363_1000937123 205
278 3300006178 Ga0075367_10018980 Ga0075367_100189803 205
279 3300006186 Ga0075369_10038628 Ga0075369_100386282 205
280 3300006186 Ga0075369_10062043 Ga0075369_100620432 205
281 3300006195 Ga0075366_10086290 Ga0075366_100862902 205
282 3300006195 Ga0075366_10352625 Ga0075366_103526252 205
283 3300006353 Ga0075370_10076534 Ga0075370_100765343 205
284 3300009093 Ga0105240_10137242 Ga0105240_101372424 205
285 3300009093 Ga0105240_10305106 Ga0105240_103051063 205
286 3300009174 Ga0105241_10540431 Ga0105241_105404312 205
287 3300009545 Ga0105237_10453509 Ga0105237_104535092 205
288 3300009551 Ga0105238_10476662 Ga0105238_104766622 205
289 3300010375 Ga0105239_10505133 Ga0105239_105051332 205
290 3300013104 Ga0157370_10756297 Ga0157370_107562972 205
291 3300013296 Ga0157374_10344888 Ga0157374_103448882 205
292 3300014497 Ga0182008_10016239 Ga0182008_100162394 205
293 3300014969 Ga0157376_10450954 Ga0157376_104509542 205
294 3300015261 Ga0182006_1043277 Ga0182006_10432772 205
295 3300015262 Ga0182007_10184938 Ga0182007_101849381 205
296 3300025250 Ga0209026_1000025 Ga0209026_1000025137 205
297 3300025254 Ga0209148_1007732 Ga0209148_10077323 205
298 3300025256 Ga0209759_1000121 Ga0209759_100012195 205
299 3300025261 Ga0209233_1009623 Ga0209233_10096233 205
300 3300025913 Ga0207695_10313960 Ga0207695_103139601 205
301 3300025924 Ga0207694_10333257 Ga0207694_103332572 205
302 3300025949 Ga0207667_10198170 Ga0207667_101981702 205
303 3300025981 Ga0207640_10674588 Ga0207640_106745882 205
304 3300026121 Ga0207683_10535665 Ga0207683_105356652 205
305 3300026142 Ga0207698_10646927 Ga0207698_106469272 205
306 3300036647 Ga0316582_0268245 Ga0316582_0268245_38_655 205
307 3300037418 Ga0395900_0083708 Ga0395900_0083708_921_1550 205
308 3300037466 Ga0395898_0556675 Ga0395898_0556675_87_722 205
309 3300037471 Ga0395905_0015434 Ga0395905_0015434_5918_6547 205
310 3300037471 Ga0395905_0119552 Ga0395905_0119552_1000_1629 205
311 3300037471 Ga0395905_0209314 Ga0395905_0209314_564_1199 205
312 3300038443 Ga0395901_0134413 Ga0395901_0134413_717_1346 205
313 3300038443 Ga0395901_0169115 Ga0395901_0169115_561_1190 205
314 3300038443 Ga0395901_0259994 Ga0395901_0259994_883_1518 205
315 3300038443 Ga0395901_0316029 Ga0395901_0316029_647_1285 205
316 3300041411 Ga0439466_0070276 Ga0439466_0070276_277_894 205
317 3300041453 Ga0451797_0475723 Ga0451797_0475723_237_875 205
318 3300044658 Ga0466972_0091842 Ga0466972_0091842_672_1301 205
319 3300046616 Ga0495668_0018238 Ga0495668_0018238_2764_3381 205
320 3300046660 Ga0495625_0107896 Ga0495625_0107896_565_1203 205
321 3300046660 Ga0495625_0229481 Ga0495625_0229481_182_820 205
322 3300048906 Ga0496103_0101455 Ga0496103_0101455_719_1336 205
323 3300048907 Ga0496104_0835392 Ga0496104_0835392_128_745 205
324 3300048913 Ga0496110_0177679 Ga0496110_0177679_708_1346 205
325 3300048915 Ga0496112_0071137 Ga0496112_0071137_2119_2757 205
326 3300048915 Ga0496112_0253887 Ga0496112_0253887_566_1195 205
327 3300048916 Ga0496113_0295155 Ga0496113_0295155_443_1081 205
328 3300048917 Ga0496114_0185947 Ga0496114_0185947_394_1032 205
329 3300048918 Ga0496115_0072115 Ga0496115_0072115_1355_1972 205
330 3300048921 Ga0496118_0180042 Ga0496118_0180042_302_919 205
331 3300048923 Ga0496120_0020017 Ga0496120_0020017_3164_3802 205
332 3300048929 Ga0496126_0255257 Ga0496126_0255257_502_1119 205
333 3300049568 Ga0501031_0030819 Ga0501031_0030819_2005_2628 205
334 3300049569 Ga0501032_0015236 Ga0501032_0015236_1944_2567 205
335 3300049570 Ga0501033_0085611 Ga0501033_0085611_158_781 205
336 3300049570 Ga0501033_0354952 Ga0501033_0354952_243_860 205
337 3300049572 Ga0501036_0187135 Ga0501036_0187135_41_664 205
338 3300049574 Ga0501038_0298996 Ga0501038_0298996_600_1223 205
339 3300049576 Ga0501040_0170121 Ga0501040_0170121_441_1064 205
340 3300049578 Ga0501042_0069249 Ga0501042_0069249_670_1293 205
341 3300049579 Ga0501043_0141549 Ga0501043_0141549_390_1013 205
342 3300049580 Ga0501046_0044413 Ga0501046_0044413_2046_2669 205
343 3300049581 Ga0501047_0109312 Ga0501047_0109312_1154_1777 205
344 3300049582 Ga0501048_0090353 Ga0501048_0090353_668_1291 205
345 3300049583 Ga0501067_0123962 Ga0501067_0123962_100_723 205
346 3300049586 Ga0501070_0280879 Ga0501070_0280879_41_664 205
347 3300049587 Ga0501071_0085317 Ga0501071_0085317_1256_1879 205
348 3300049742 Ga0501080_0258029 Ga0501080_0258029_13_636 205
349 3300049823 Ga0501044_0411472 Ga0501044_0411472_600_1223 205
350 3300050490 nmdc:mga03n38_9312_c1 nmdc:mga03n38_9312_c1_69_686 205
351 3300050491 nmdc:mga00v17_117693_c1 nmdc:mga00v17_117693_c1_861_1478 205
352 3300050492 nmdc:mga0yw44_32317_c1 nmdc:mga0yw44_32317_c1_803_1441 205
353 3300050492 nmdc:mga0yw44_379344_c1 nmdc:mga0yw44_379344_c1_212_829 205
354 3300053087 Ga0500643_009681 Ga0500643_009681_802_1419 205
355 3300053119 Ga0500595_073615 Ga0500595_073615_138_776 205
356 3300053134 Ga0500658_0103214 Ga0500658_0103214_484_1122 205
357 3300053139 Ga0500568_0000093 Ga0500568_0000093_80052_80678 205
358 3300053151 Ga0500604_0008368 Ga0500604_0008368_1449_2087 205
359 3300053155 Ga0500620_004709 Ga0500620_004709_1852_2469 205
360 3300053158 Ga0500627_0122175 Ga0500627_0122175_150_788 205
361 iso_pu_bacteria 2509276022 2509396314 205
362 iso_pu_bacteria 2693429783 2694631077 205
363 iso_pu_bacteria 2847686936 2847692261 205
364 iso_pu_bacteria 2856356410 2856360082 205
365 iso_pu_bacteria 2869162929 2869169296 205
366 iso_pu_bacteria 2871444079 2871448918 205
367 iso_pu_bacteria 2871488783 2871494537 205
368 iso_pu_bacteria 2871495908 2871501393 205
369 iso_pu_bacteria 2874102143 2874103725 205
370 iso_pu_bacteria 2878753008 2878758881 205
371 iso_pu_bacteria 2878760144 2878765373 205
372 iso_pu_bacteria 2878767105 2878773081 205
373 iso_pu_bacteria 2878781027 2878784536 205
374 iso_pu_bacteria 2881845957 2881853096 205
375 iso_pu_bacteria 2881861095 2881867307 205
376 iso_pu_bacteria 2882912400 2882912566 205
377 iso_pu_bacteria 2885305155 2885309437 205
378 iso_pu_bacteria 2885318864 2885323704 205
379 iso_pu_bacteria 2885326080 2885330376 205
380 iso_pu_bacteria 2885334103 2885337502 205
381 iso_pu_bacteria 2903492973 2903503880 205
382 iso_pu_bacteria 2903540706 2903546204 205
383 iso_pu_bacteria 2906328253 2906330002 205
384 iso_pu_bacteria 2922158528 2922162841 205
385 iso_pu_bacteria 2924726620 2924728238 205
386 iso_pu_bacteria 2924762789 2924764243 205
387 iso_pu_bacteria 2924784321 2924789085 205
388 iso_pu_bacteria 2937822353 2937824467 205
389 iso_pu_bacteria 2937868953 2937870541 205
390 iso_pu_bacteria 2937891427 2937896293 205
391 iso_pu_bacteria 2937994558 2938000062 205
392 iso_pu_bacteria 2938014810 2938022084 205
393 iso_pu_bacteria 2958115193 2958118465 205
394 iso_pu_bacteria 2958158011 2958161013 205
395 iso_pu_bacteria 2958165035 2958170526 205
396 iso_pu_bacteria 2961136820 2961138716 205
397 iso_pu_bacteria 2961163497 2961168981 205
398 iso_pu_bacteria 2961170736 2961176040 205
399 iso_pu_bacteria 2965018300 2965024268 205
400 iso_pu_bacteria 2965047637 2965051511 205
401 iso_pu_bacteria 2965062239 2965066008 205
402 iso_pu_bacteria 2965110997 2965117744 205
403 iso_pu_bacteria 2967996073 2968001928 205
404 iso_pu_bacteria 2968003550 2968009048 205
405 iso_pu_bacteria 2968091066 2968096370 205
406 iso_pu_bacteria 2968097103 2968098871 205
407 iso_pu_bacteria 2968128360 2968129189 205
408 iso_pu_bacteria 2968171901 2968177375 205
409 iso_pu_bacteria 2970489779 2970491112 205
410 iso_pu_bacteria 2970503327 2970508706 205
411 iso_pu_bacteria 2970554993 2970560221 205
412 iso_pu_bacteria 2977821940 2977827421 205
413 iso_pu_bacteria 2977828996 2977830956 205
414 iso_pu_bacteria 2977858184 2977859275 205
415 iso_pu_bacteria 2977935797 2977941196 205
416 iso_pu_bacteria 2977986579 2977986586 205
417 iso_pu_bacteria 2979779861 2979781286 205
418 iso_pu_bacteria 2979793036 2979796347 205
419 iso_pu_bacteria 2979808191 2979811646 205
420 iso_pu_bacteria 2987659509 2987665012 205
421 iso_pu_bacteria 2987666974 2987669238 205
422 iso_pu_bacteria 2996341866 2996345075 205
423 iso_pu_bacteria 3004188549 3004194069 205
424 iso_pu_bacteria 637000159 637074592 205
425 iso_pu_bacteria 8004312739 8004314007 205
426 iso_pu_bacteria 8004374579 8004380402 205
427 iso_pu_bacteria 8004445564 8004450196 205
428 iso_pu_bacteria 8004703790 8004709367 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

58

199

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.9581 17 197
1oru-assembly1.cif.gz_B crystal structure of apc1665, yuad protein from bacillus subtilis 0.9378 17 197
6ksh-assembly1.cif.gz_C crystal structure of pyruvate kinase (pyk) from plasmodium falciparum in complex with oxalate and atp 0.7818 110 193
1o67-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7704 18 195
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.7626 22 204
ID Description Score Start End Superfamily
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9497 18 197 2.40.33.20
1oruB00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.9289 18 197 2.40.33.20
af_P9WKE5_72_166_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7083 81 195 3.20.20.60
5yhiA00 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.6974 18 205 2.40.33.20
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.6899 81 193 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A531M5Y8-F1-model_v4 Molybdenum cofactor sulfurase 0.9711 96 205 GO:0003824
GO:0030151
GO:0030170
AF-A0A659UJ01-F1-model_v4 Molybdenum cofactor sulfurase 0.9709 84 205 GO:0003824
GO:0030151
GO:0030170
AF-A0A6B3TLT2-F1-model_v4 MOSC domain-containing protein 0.9666 98 197 GO:0003824
GO:0030151
GO:0030170
AF-A0A659UJ01-F1-model_v4 Molybdenum cofactor sulfurase 0.963 84 205 GO:0003824
GO:0030151
GO:0030170
AF-A0A530MEV2-F1-model_v4 Molybdenum cofactor sulfurase 0.9591 75 154 GO:0003824
GO:0030151
GO:0030170

Feature Viewer

pLDDT pTM Quality
91.1 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map