F441612

General Info

Members Datasets Scaffolds Average Seq Length
428 197 427 210

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100013635|Ga0070714_1000136353
Length 233
Sequence VPSPLAATPFGDNGIMSESLSYGGYGAATQDRTRTLFGQTMWYVAATAGFFALGAYLGRNLSQGWVIVWFIVAFACLISMNFAVRRSAGLTAGLLFIFGVAVGLAMAPVLVFYATTNPQVLWQAGGATALFIAGFGTAGYATRRDLSGIARLCFWALIALIVFGIVLIFVNIPNGSLIYSVIGLVIFAGLTAFDFQRLRRSKDLDSAPLLAASIFLDALNVFLFFLRIFSRGN

Samples

Sample ID Description Type Environment
1 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
52 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
94 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
95 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 2.1
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.5
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100257361 3300005330 Bacteria 1237
2 Ga0070682_100606110 3300005337 Bacteria 865
3 Ga0070660_100178485 3300005339 Bacteria 1718
4 Ga0070689_100863062 3300005340 Bacteria 799
5 Ga0070691_10039811 3300005341 Bacteria 2221
6 Ga0070691_10447544 3300005341 Bacteria 737
7 Ga0070674_100019149 3300005356 Bacteria 4343
8 Ga0070667_100068561 3300005367 Bacteria 3018
9 Ga0070709_10003884 3300005434 Bacteria 8053
10 Ga0070709_10007417 3300005434 Bacteria 6012
11 Ga0070709_10040684 3300005434 Bacteria 2859
12 Ga0070709_10173962 3300005434 Bacteria 1507
13 Ga0070714_100004071 3300005435 Bacteria 10987
14 Ga0070714_100013261 3300005435 Bacteria 6599
15 Ga0070714_100013635 3300005435 Bacteria 6517
16 Ga0070714_100054236 3300005435 Bacteria 3424
17 Ga0070714_100067930 3300005435 Bacteria 3075
18 Ga0070714_100129863 3300005435 Bacteria 2251
19 Ga0070714_100482423 3300005435 Bacteria 1180
20 Ga0070714_100527142 3300005435 Bacteria 1129
21 Ga0070713_100101703 3300005436 Bacteria 2490
22 Ga0070713_100139678 3300005436 Bacteria 2144
23 Ga0070713_100172669 3300005436 Bacteria 1937
24 Ga0070713_100270342 3300005436 Bacteria 1556
25 Ga0070713_100432156 3300005436 Bacteria 1234
26 Ga0070710_10000482 3300005437 Bacteria 18742
27 Ga0070710_10043107 3300005437 Bacteria 2498
28 Ga0070710_10106417 3300005437 Bacteria 1678
29 Ga0070710_10208585 3300005437 Unclassified 1237
30 Ga0070711_100001135 3300005439 Bacteria 14255
31 Ga0070711_100006992 3300005439 Bacteria 6845
32 Ga0070711_100017144 3300005439 Bacteria 4608
33 Ga0070711_100161808 3300005439 Bacteria 1697
34 Ga0070711_100327089 3300005439 Bacteria 1226
35 Ga0070711_100369886 3300005439 Bacteria 1156
36 Ga0070711_100474688 3300005439 Bacteria 1027
37 Ga0070708_100068751 3300005445 Bacteria 3184
38 Ga0070708_100137418 3300005445 Bacteria 2265
39 Ga0070708_100443075 3300005445 Bacteria 1225
40 Ga0070708_100884799 3300005445 Unclassified 839
41 Ga0070663_100232020 3300005455 Bacteria 1454
42 Ga0070678_100273137 3300005456 Bacteria 1426
43 Ga0070706_100030532 3300005467 Bacteria 4967
44 Ga0070706_100079031 3300005467 Bacteria 3044
45 Ga0070706_100181688 3300005467 Bacteria 1964
46 Ga0070706_100224095 3300005467 Bacteria 1755
47 Ga0070706_100479624 3300005467 Bacteria 1157
48 Ga0070707_100007713 3300005468 Bacteria 9996
49 Ga0070707_100028852 3300005468 Bacteria 5280
50 Ga0070707_100072651 3300005468 Bacteria 3316
51 Ga0070707_100092475 3300005468 Bacteria 2928
52 Ga0070707_100131054 3300005468 Bacteria 2438
53 Ga0070707_100229437 3300005468 Bacteria 1808
54 Ga0070698_100010715 3300005471 Bacteria 9763
55 Ga0070698_100110104 3300005471 Bacteria 2720
56 Ga0070698_100375541 3300005471 Bacteria 1354
57 Ga0070699_100037088 3300005518 Bacteria 4218
58 Ga0068853_100154885 3300005539 Bacteria 2064
59 Ga0070693_100001721 3300005547 Bacteria 9948
60 Ga0070693_100227307 3300005547 Unclassified 1226
61 Ga0068855_100159542 3300005563 Bacteria 2561
62 Ga0070664_100565078 3300005564 Bacteria 1053
63 Ga0068856_100933273 3300005614 Unclassified 886
64 Ga0070702_100266251 3300005615 Bacteria 1169
65 Ga0068866_10190889 3300005718 Bacteria 1217
66 Ga0068851_10086478 3300005834 Bacteria 1645
67 Ga0068863_100553890 3300005841 Bacteria 1136
68 Ga0081540_1000255 3300005983 Bacteria 56347
69 Ga0081540_1006393 3300005983 Bacteria 8589
70 Ga0070717_10006079 3300006028 Bacteria 8857
71 Ga0070717_10089436 3300006028 Bacteria 2597
72 Ga0070717_10102551 3300006028 Bacteria 2431
73 Ga0070717_10193645 3300006028 Bacteria 1777
74 Ga0070717_10346483 3300006028 Bacteria 1327
75 Ga0070717_10429763 3300006028 Bacteria 1188
76 Ga0070717_10556626 3300006028 Bacteria 1039
77 Ga0070715_10015699 3300006163 Bacteria 2830
78 Ga0070716_100004082 3300006173 Bacteria 6925
79 Ga0070716_100018425 3300006173 Bacteria 3637
80 Ga0070712_100009357 3300006175 Bacteria 6170
81 Ga0070712_100018633 3300006175 Bacteria 4513
82 Ga0070712_100018950 3300006175 Bacteria 4479
83 Ga0070712_100021888 3300006175 Bacteria 4204
84 Ga0070712_100107407 3300006175 Bacteria 2076
85 Ga0070712_100796757 3300006175 Bacteria 810
86 Ga0097621_100066143 3300006237 Bacteria 2976
87 Ga0068871_101000648 3300006358 Bacteria 778
88 Ga0075428_100511946 3300006844 Bacteria 1284
89 Ga0075431_100541846 3300006847 Bacteria 1152
90 Ga0075431_101195160 3300006847 Bacteria 723
91 Ga0075433_10016072 3300006852 Bacteria 6158
92 Ga0075433_10028540 3300006852 Bacteria 4745
93 Ga0075434_100040793 3300006871 Bacteria 4597
94 Ga0075434_100453294 3300006871 Bacteria 1304
95 Ga0075436_100014063 3300006914 Bacteria 5478
96 Ga0075436_100031853 3300006914 Bacteria 3633
97 Ga0075435_100020822 3300007076 Bacteria 5033
98 Ga0075435_100058241 3300007076 Bacteria 3128
99 Ga0075435_100284111 3300007076 Bacteria 1413
100 Ga0111539_10026489 3300009094 Bacteria 7087
101 Ga0105245_10054856 3300009098 Bacteria 3579
102 Ga0114129_10023945 3300009147 Bacteria 8653
103 Ga0114129_11212576 3300009147 Bacteria 939
104 Ga0157378_10921207 3300013297 Bacteria 905
105 Ga0163162_10615347 3300013306 Bacteria 1212
106 Ga0157377_10034064 3300014745 Bacteria 2784
107 Ga0197907_10104446 3300020069 Bacteria 5895
108 Ga0206356_10161472 3300020070 Bacteria 2764
109 Ga0206356_11039206 3300020070 Bacteria 1354
110 Ga0206355_1301906 3300020076 Bacteria 1501
111 Ga0206352_10070517 3300020078 Bacteria 927
112 Ga0206350_10158994 3300020080 Bacteria 1541
113 Ga0206353_10694706 3300020082 Bacteria 1323
114 Ga0213875_10000508 3300021388 Bacteria 32578
115 Ga0213875_10048671 3300021388 Bacteria 1989
116 Ga0224712_10001459 3300022467 Bacteria 5455
117 Ga0207692_10002958 3300025898 Bacteria 6581
118 Ga0207692_10022016 3300025898 Bacteria 2926
119 Ga0207692_10096175 3300025898 Bacteria 1616
120 Ga0207692_10212412 3300025898 Bacteria 1143
121 Ga0207685_10009292 3300025905 Bacteria 2849
122 Ga0207685_10094832 3300025905 Bacteria 1264
123 Ga0207699_10001518 3300025906 Bacteria 11021
124 Ga0207699_10011646 3300025906 Bacteria 4449
125 Ga0207699_10022571 3300025906 Bacteria 3413
126 Ga0207699_10106436 3300025906 Bacteria 1790
127 Ga0207699_10254593 3300025906 Bacteria 1211
128 Ga0207684_10116862 3300025910 Bacteria 2286
129 Ga0207684_10200698 3300025910 Unclassified 1720
130 Ga0207684_10595122 3300025910 Unclassified 945
131 Ga0207684_10600826 3300025910 Unclassified 940
132 Ga0207684_10617927 3300025910 Bacteria 925
133 Ga0207654_10016738 3300025911 Bacteria 3821
134 Ga0207654_10090333 3300025911 Unclassified 1865
135 Ga0207693_10001262 3300025915 Bacteria 22547
136 Ga0207693_10002335 3300025915 Bacteria 16489
137 Ga0207693_10003542 3300025915 Bacteria 13335
138 Ga0207693_10052562 3300025915 Bacteria 3196
139 Ga0207693_10053700 3300025915 Bacteria 3161
140 Ga0207693_10289450 3300025915 Bacteria 1284
141 Ga0207663_10015395 3300025916 Bacteria 4218
142 Ga0207663_10037872 3300025916 Bacteria 2910
143 Ga0207663_10045000 3300025916 Bacteria 2712
144 Ga0207663_10084239 3300025916 Bacteria 2091
145 Ga0207663_10188090 3300025916 Bacteria 1480
146 Ga0207660_10063193 3300025917 Bacteria 2669
147 Ga0207657_10074535 3300025919 Bacteria 2865
148 Ga0207652_10742948 3300025921 Bacteria 874
149 Ga0207646_10004410 3300025922 Bacteria 15303
150 Ga0207646_10020411 3300025922 Bacteria 6138
151 Ga0207646_10047555 3300025922 Bacteria 3848
152 Ga0207646_10050286 3300025922 Bacteria 3731
153 Ga0207646_10069311 3300025922 Bacteria 3150
154 Ga0207646_10328699 3300025922 Bacteria 1381
155 Ga0207646_10338352 3300025922 Unclassified 1360
156 Ga0207700_10000317 3300025928 Bacteria 28228
157 Ga0207700_10000517 3300025928 Bacteria 22669
158 Ga0207700_10005106 3300025928 Bacteria 7805
159 Ga0207700_10013863 3300025928 Bacteria 5263
160 Ga0207700_10020168 3300025928 Bacteria 4520
161 Ga0207700_10075359 3300025928 Bacteria 2614
162 Ga0207700_10191879 3300025928 Unclassified 1717
163 Ga0207700_10287464 3300025928 Bacteria 1416
164 Ga0207664_10000699 3300025929 Bacteria 22986
165 Ga0207664_10007549 3300025929 Bacteria 7544
166 Ga0207664_10008591 3300025929 Bacteria 7138
167 Ga0207664_10015100 3300025929 Bacteria 5595
168 Ga0207664_10028125 3300025929 Bacteria 4270
169 Ga0207664_10030525 3300025929 Bacteria 4116
170 Ga0207664_10033817 3300025929 Bacteria 3932
171 Ga0207664_10127961 3300025929 Bacteria 2134
172 Ga0207664_10318516 3300025929 Bacteria 1372
173 Ga0207665_10000637 3300025939 Bacteria 23600
174 Ga0207665_10002828 3300025939 Bacteria 11640
175 Ga0207665_10005711 3300025939 Bacteria 8286
176 Ga0207665_10006076 3300025939 Bacteria 8016
177 Ga0207665_10012998 3300025939 Bacteria 5470
178 Ga0207679_10136478 3300025945 Bacteria 1976
179 Ga0207712_10646698 3300025961 Bacteria 919
180 Ga0207658_10159755 3300025986 Bacteria 1846
181 Ga0207639_10145634 3300026041 Bacteria 1978
182 Ga0207678_10012330 3300026067 Bacteria 7506
183 Ga0207708_10025221 3300026075 Bacteria 4497
184 Ga0207641_11305494 3300026088 Bacteria 726
185 Ga0207683_10000233 3300026121 Bacteria 49324
186 Ga0207683_10261589 3300026121 Bacteria 1580
187 Ga0207428_10220017 3300027907 Bacteria 1424
188 Ga0265336_10020447 3300028666 Bacteria 2123
189 Ga0265338_10001979 3300028800 Bacteria 31905
190 Ga0265760_10137519 3300031090 Archaea 794
191 Ga0265340_10017381 3300031247 Bacteria 3721
192 Ga0307405_10015269 3300031731 Bacteria 4155
193 Ga0307405_10192822 3300031731 Bacteria 1473
194 Ga0307413_10008652 3300031824 Bacteria 4821
195 Ga0307406_10008502 3300031901 Bacteria 5732
196 Ga0307407_10053754 3300031903 Bacteria 2318
197 Ga0307409_100259226 3300031995 Bacteria 1594
198 Ga0307409_100488563 3300031995 Bacteria 1196
199 Ga0307416_100004004 3300032002 Bacteria 8790
200 Ga0307416_100713724 3300032002 Bacteria 1093
201 Ga0307411_10010439 3300032005 Bacteria 4951
202 Ga0307411_10769666 3300032005 Bacteria 845
203 Ga0307415_100002587 3300032126 Bacteria 9040
204 Ga0373930_0016630 3300034816 Bacteria 1394
205 Ga0373950_0020557 3300034818 Bacteria 1162
206 Ga0373938_0012299 3300034957 Bacteria 1604
207 Ga0373926_0000850 3300035083 Bacteria 8708
208 Ga0373926_0001614 3300035083 Bacteria 6947
209 Ga0373934_0015540 3300035086 Bacteria 2889
210 Ga0373934_0093122 3300035086 Bacteria 1216
211 Ga0373940_0040044 3300035088 Bacteria 1285
212 Ga0373944_0000427 3300035089 Bacteria 9635
213 Ga0373949_0006482 3300035090 Bacteria 2573
214 Ga0373952_0079032 3300035092 Bacteria 836
215 Ga0373923_0002215 3300035111 Bacteria 5917
216 Ga0373923_0159706 3300035111 Bacteria 1028
217 Ga0373945_0000016 3300035116 Bacteria 34712
218 Ga0373945_0049979 3300035116 Bacteria 1535
219 Ga0373953_0007407 3300035117 Bacteria 3673
220 Ga0373954_0016342 3300035118 Bacteria 3320
221 Ga0373956_0011948 3300035119 Bacteria 3590
222 Ga0373956_0013057 3300035119 Bacteria 3452
223 Ga0373957_0010524 3300035120 Bacteria 3061
224 Ga0373943_0003777 3300035170 Bacteria 6877
225 Ga0373946_0002742 3300035171 Bacteria 6227
226 Ga0373946_0027268 3300035171 Bacteria 2258
227 Ga0373946_0098631 3300035171 Bacteria 1306
228 Ga0373955_0036768 3300035172 Bacteria 2600
229 Ga0373955_0055046 3300035172 Bacteria 2177
230 Ga0373942_0039415 3300035207 Bacteria 1285
231 Ga0373961_0007847 3300035241 Bacteria 2588
232 Ga0373924_0004243 3300035410 Bacteria 4993
233 Ga0373924_0009168 3300035410 Bacteria 3621
234 Ga0373931_0026266 3300035691 Bacteria 2963
235 Ga0373935_0001369 3300035692 Bacteria 13465
236 Ga0373935_0020287 3300035692 Bacteria 4059
237 Ga0373935_0041211 3300035692 Bacteria 2900
238 Ga0373935_0358636 3300035692 Bacteria 1040
239 Ga0373927_0000603 3300035695 Bacteria 27426
240 Ga0373933_0005987 3300035724 Bacteria 6618
241 Ga0373933_0037948 3300035724 Bacteria 2829
242 Ga0373947_0000018 3300035725 Bacteria 114087
243 Ga0373947_0005652 3300035725 Bacteria 7298
244 Ga0373947_0050136 3300035725 Bacteria 2510
245 Ga0373947_0652434 3300035725 Bacteria 718
246 Ga0373937_0008813 3300036401 Bacteria 8750
247 Ga0373937_0085803 3300036401 Bacteria 2913
248 Ga0373937_0095029 3300036401 Bacteria 2764
249 Ga0373925_0015520 3300037068 Bacteria 5509
250 Ga0373925_0069633 3300037068 Bacteria 2658
251 Ga0373925_0094077 3300037068 Bacteria 2294
252 Ga0373925_0110135 3300037068 Bacteria 2126
253 Ga0395899_0432428 3300037312 Bacteria 865
254 Ga0395900_0075352 3300037418 Bacteria 3469
255 Ga0395898_0258088 3300037466 Bacteria 1662
256 Ga0395905_0428639 3300037471 Bacteria 1219
257 Ga0436364_0156249 3300037853 Bacteria 1405
258 Ga0436364_0168316 3300037853 Bacteria 53247
259 Ga0395901_0028362 3300038443 Bacteria 5756
260 Ga0395901_0338824 3300038443 Bacteria 1554
261 Ga0436360_0522949 3300039438 Bacteria 1723
262 Ga0436363_0252140 3300039450 Bacteria 1643
263 Ga0436363_0810953 3300039450 Bacteria 1484
264 Ga0436363_0975291 3300039450 Bacteria 2140
265 Ga0436362_1176978 3300039453 Bacteria 746
266 Ga0453683_0324885 3300044673 Unclassified 986
267 Ga0466957_0233994 3300044842 Bacteria 1217
268 Ga0466967_0065869 3300045976 Bacteria 3226
269 Ga0466967_0082035 3300045976 Bacteria 2913
270 Ga0495592_0044575 3300046454 Bacteria 3313
271 Ga0495592_0061423 3300046454 Bacteria 2761
272 Ga0495629_0033137 3300046459 Bacteria 3655
273 Ga0495629_0139061 3300046459 Bacteria 1690
274 Ga0495629_0331726 3300046459 Bacteria 1039
275 Ga0495641_0066012 3300046461 Bacteria 1628
276 Ga0495651_0007627 3300046462 Bacteria 8272
277 Ga0495651_0007705 3300046462 Bacteria 8236
278 Ga0495651_0068157 3300046462 Bacteria 2712
279 Ga0495653_0001060 3300046463 Bacteria 21183
280 Ga0495653_0031842 3300046463 Bacteria 4190
281 Ga0495653_0079694 3300046463 Bacteria 2424
282 Ga0495653_0253594 3300046463 Bacteria 1166
283 Ga0495580_0108815 3300046472 Bacteria 1924
284 Ga0495582_0036106 3300046473 Bacteria 2718
285 Ga0495582_0176385 3300046473 Bacteria 1217
286 Ga0495639_0022058 3300046475 Bacteria 2791
287 Ga0495639_0103641 3300046475 Bacteria 1345
288 Ga0495662_0013050 3300046476 Bacteria 4047
289 Ga0495662_0017309 3300046476 Bacteria 3489
290 Ga0495664_0002456 3300046477 Bacteria 9974
291 Ga0495664_0011654 3300046477 Bacteria 4962
292 Ga0495664_0031231 3300046477 Bacteria 3122
293 Ga0495664_0364448 3300046477 Bacteria 870
294 Ga0495608_0002353 3300046511 Bacteria 13621
295 Ga0495608_0014936 3300046511 Bacteria 5388
296 Ga0495608_0077103 3300046511 Bacteria 2169
297 Ga0495608_0153689 3300046511 Bacteria 1465
298 Ga0495608_0187952 3300046511 Bacteria 1305
299 Ga0495618_0021889 3300046514 Bacteria 3944
300 Ga0495618_0090995 3300046514 Bacteria 1950
301 Ga0495618_0162542 3300046514 Bacteria 1423
302 Ga0495628_0011338 3300046516 Bacteria 7544
303 Ga0495628_0031756 3300046516 Bacteria 4269
304 Ga0495628_0104942 3300046516 Bacteria 2177
305 Ga0495630_0023035 3300046517 Bacteria 4601
306 Ga0495630_0065513 3300046517 Bacteria 2730
307 Ga0495630_0116347 3300046517 Unclassified 2026
308 Ga0495630_0145467 3300046517 Bacteria 1802
309 Ga0495630_0152575 3300046517 Bacteria 1758
310 Ga0495666_0042280 3300046526 Bacteria 2204
311 Ga0495652_0009512 3300046529 Bacteria 8827
312 Ga0495652_0017563 3300046529 Bacteria 6383
313 Ga0495652_0187710 3300046529 Bacteria 1580
314 Ga0495665_0021480 3300046531 Bacteria 3467
315 Ga0495665_0095339 3300046531 Bacteria 1562
316 Ga0495640_0010972 3300046533 Bacteria 6980
317 Ga0495640_0019265 3300046533 Bacteria 5039
318 Ga0495640_0044656 3300046533 Bacteria 3080
319 Ga0495640_0095685 3300046533 Bacteria 1955
320 Ga0495640_0318748 3300046533 Bacteria 963
321 Ga0495586_0028964 3300046535 Bacteria 2964
322 Ga0495587_0002811 3300046536 Bacteria 11644
323 Ga0495587_0005975 3300046536 Bacteria 7938
324 Ga0495587_0007868 3300046536 Bacteria 6885
325 Ga0495645_0025300 3300046543 Bacteria 4307
326 Ga0495645_0032980 3300046543 Bacteria 3777
327 Ga0495645_0066002 3300046543 Bacteria 2617
328 Ga0495667_0003787 3300046559 Bacteria 10156
329 Ga0495667_0004696 3300046559 Bacteria 9236
330 Ga0495667_0015833 3300046559 Bacteria 5098
331 Ga0495667_0130338 3300046559 Bacteria 1622
332 Ga0495634_0019626 3300046642 Bacteria 4802
333 Ga0495634_0028912 3300046642 Bacteria 3842
334 Ga0495634_0034936 3300046642 Bacteria 3447
335 Ga0495634_0250643 3300046642 Bacteria 1083
336 Ga0495634_0409298 3300046642 Bacteria 805
337 Ga0495635_0006235 3300046663 Bacteria 8307
338 Ga0495635_0043986 3300046663 Bacteria 3081
339 Ga0495635_0058561 3300046663 Bacteria 2650
340 Ga0495635_0062354 3300046663 Bacteria 2560
341 Ga0495635_0088685 3300046663 Bacteria 2116
342 Ga0495635_0117179 3300046663 Bacteria 1817
343 Ga0495657_0007889 3300046675 Bacteria 8169
344 Ga0495657_0009576 3300046675 Bacteria 7339
345 Ga0495657_0063574 3300046675 Bacteria 2434
346 Ga0495599_0015298 3300046678 Bacteria 4760
347 Ga0495599_0064995 3300046678 Bacteria 2279
348 Ga0495599_0214221 3300046678 Bacteria 1180
349 Ga0495623_0064546 3300046679 Bacteria 2291
350 Ga0495623_0279792 3300046679 Bacteria 929
351 Ga0495646_0005189 3300046680 Bacteria 8216
352 Ga0495646_0076048 3300046680 Bacteria 1967
353 Ga0495646_0080967 3300046680 Bacteria 1893
354 Ga0495647_0017476 3300046681 Bacteria 2539
355 Ga0495658_0095566 3300046683 Bacteria 1766
356 Ga0495613_0084452 3300046689 Bacteria 2305
357 Ga0495613_0240332 3300046689 Bacteria 1266
358 Ga0495624_0075663 3300046690 Bacteria 2090
359 Ga0495624_0079069 3300046690 Bacteria 2039
360 Ga0495624_0139702 3300046690 Bacteria 1484
361 Ga0495600_0017332 3300046809 Bacteria 4581
362 Ga0495600_0027222 3300046809 Bacteria 3694
363 Ga0495600_0046111 3300046809 Bacteria 2844
364 Ga0495600_0064302 3300046809 Bacteria 2398
365 Ga0495600_0105494 3300046809 Bacteria 1836
366 Ga0495581_0017412 3300047315 Bacteria 4173
367 Ga0495604_0041204 3300047317 Bacteria 3622
368 Ga0495604_0054863 3300047317 Bacteria 3073
369 Ga0495674_0000278 3300047319 Bacteria 44044
370 Ga0495674_0001151 3300047319 Bacteria 25489
371 Ga0495674_0014006 3300047319 Bacteria 7519
372 Ga0495674_0032327 3300047319 Bacteria 4745
373 Ga0495674_0119786 3300047319 Bacteria 2224
374 Ga0495674_0124037 3300047319 Bacteria 2180
375 Ga0495676_0003229 3300047321 Bacteria 14734
376 Ga0495676_0159323 3300047321 Unclassified 1598
377 Ga0495680_0011525 3300047322 Bacteria 7819
378 Ga0495680_0021765 3300047322 Bacteria 5359
379 Ga0495680_0025797 3300047322 Bacteria 4858
380 Ga0495680_0031053 3300047322 Bacteria 4352
381 Ga0495680_0049234 3300047322 Bacteria 3301
382 Ga0495675_0019288 3300047444 Bacteria 4332
383 Ga0495684_0008669 3300047471 Bacteria 7865
384 Ga0495684_0020835 3300047471 Bacteria 5052
385 Ga0495684_0031459 3300047471 Bacteria 4074
386 Ga0495684_0040407 3300047471 Bacteria 3576
387 Ga0495684_0075605 3300047471 Unclassified 2558
388 Ga0495593_0043378 3300047673 Bacteria 2410
389 Ga0495593_0136109 3300047673 Bacteria 1245
390 Ga0495602_0015545 3300048088 Bacteria 7675
391 Ga0495602_0027046 3300048088 Bacteria 5523
392 Ga0495602_0066849 3300048088 Bacteria 3095
393 Ga0495614_0029451 3300048089 Bacteria 2363
394 Ga0495614_0108054 3300048089 Bacteria 1220
395 Ga0496101_0931934 3300048904 Bacteria 683
396 Ga0496102_0053166 3300048905 Bacteria 3692
397 Ga0496102_0063450 3300048905 Bacteria 3383
398 Ga0496103_0161879 3300048906 Bacteria 1435
399 Ga0496104_0397301 3300048907 Bacteria 1291
400 Ga0496105_0055638 3300048908 Bacteria 3266
401 Ga0496106_0042617 3300048909 Bacteria 3403
402 Ga0496107_0020523 3300048910 Bacteria 4667
403 Ga0496108_0120965 3300048911 Bacteria 2246
404 Ga0496108_0213586 3300048911 Bacteria 1675
405 Ga0496112_0185273 3300048915 Bacteria 2045
406 Ga0496113_0661590 3300048916 Bacteria 835
407 Ga0496114_0739483 3300048917 Bacteria 860
408 Ga0496114_1077903 3300048917 Bacteria 688
409 Ga0496115_0065925 3300048918 Bacteria 2925
410 Ga0496118_0000029 3300048921 Bacteria 340978
411 nmdc:mga05p37_13491_c1 3300050507 Bacteria 6002
412 nmdc:mga08y16_418468_c1 3300050511 Bacteria 1370
413 nmdc:mga0n895_15643_c1 3300050512 Bacteria 6928
414 nmdc:mga0n895_48927_c1 3300050512 Bacteria 4141
415 nmdc:mga0n895_571168_c1 3300050512 Bacteria 1135
416 nmdc:mga0rr50_123942_c1 3300050513 Bacteria 2060
417 nmdc:mga0rr50_18111_c1 3300050513 Bacteria 4724
418 nmdc:mga0rr50_801319_c1 3300050513 Bacteria 804
419 nmdc:mga08x19_55595_c1 3300050514 Bacteria 2551
420 nmdc:mga0a205_15290_c1 3300050515 Bacteria 7170
421 nmdc:mga0a205_44450_c1 3300050515 Bacteria 4282
422 Ga0495601_0286494 3300053077 Bacteria 1074
423 Ga0495612_0042550 3300053078 Bacteria 1854
424 Ga0495595_0028451 3300053084 Bacteria 2496
425 Ga0495595_0120321 3300053084 Bacteria 1279
426 Ga0495619_0184209 3300053085 Bacteria 1445
427 Ga0495619_0487474 3300053085 Bacteria 848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005547 Ga0070693_100227307 Ga0070693_1002273071 153
2 3300025961 Ga0207712_10646698 Ga0207712_106466981 153
3 3300026075 Ga0207708_10025221 Ga0207708_100252213 153
4 3300026121 Ga0207683_10261589 Ga0207683_102615893 153
5 3300048907 Ga0496104_0397301 Ga0496104_0397301_232_873 153
6 3300035725 Ga0373947_0050136 Ga0373947_0050136_1068_1784 167
7 3300037068 Ga0373925_0110135 Ga0373925_0110135_1147_1863 167
8 3300046514 Ga0495618_0162542 Ga0495618_0162542_16_732 167
9 3300046533 Ga0495640_0010972 Ga0495640_0010972_1037_1753 167
10 3300046663 Ga0495635_0043986 Ga0495635_0043986_175_891 167
11 3300047319 Ga0495674_0001151 Ga0495674_0001151_18775_19491 167
12 3300047321 Ga0495676_0159323 Ga0495676_0159323_870_1586 167
13 3300035241 Ga0373961_0007847 Ga0373961_0007847_349_1077 173
14 3300005341 Ga0070691_10039811 Ga0070691_100398111 180
15 3300005356 Ga0070674_100019149 Ga0070674_1000191493 180
16 3300005439 Ga0070711_100017144 Ga0070711_1000171443 180
17 3300005614 Ga0068856_100933273 Ga0068856_1009332731 180
18 3300005834 Ga0068851_10086478 Ga0068851_100864782 180
19 3300006175 Ga0070712_100107407 Ga0070712_1001074072 180
20 3300009098 Ga0105245_10054856 Ga0105245_100548562 180
21 3300025911 Ga0207654_10090333 Ga0207654_100903332 180
22 3300025915 Ga0207693_10003542 Ga0207693_1000354211 180
23 3300025916 Ga0207663_10045000 Ga0207663_100450002 180
24 3300025919 Ga0207657_10074535 Ga0207657_100745355 180
25 3300026041 Ga0207639_10145634 Ga0207639_101456344 180
26 3300048905 Ga0496102_0063450 Ga0496102_0063450_1035_1676 180
27 3300014745 Ga0157377_10034064 Ga0157377_100340641 181
28 3300035111 Ga0373923_0002215 Ga0373923_0002215_2580_3233 186
29 3300035117 Ga0373953_0007407 Ga0373953_0007407_1161_1814 186
30 3300035118 Ga0373954_0016342 Ga0373954_0016342_580_1233 186
31 3300035119 Ga0373956_0013057 Ga0373956_0013057_2776_3429 186
32 3300035120 Ga0373957_0010524 Ga0373957_0010524_1450_2103 186
33 3300035410 Ga0373924_0004243 Ga0373924_0004243_4060_4713 186
34 3300035724 Ga0373933_0005987 Ga0373933_0005987_843_1496 186
35 3300036401 Ga0373937_0085803 Ga0373937_0085803_219_872 186
36 3300046454 Ga0495592_0061423 Ga0495592_0061423_797_1450 186
37 3300046462 Ga0495651_0007705 Ga0495651_0007705_4272_4925 186
38 3300046463 Ga0495653_0079694 Ga0495653_0079694_871_1524 186
39 3300046511 Ga0495608_0077103 Ga0495608_0077103_1094_1747 186
40 3300046514 Ga0495618_0021889 Ga0495618_0021889_2391_3044 186
41 3300046516 Ga0495628_0031756 Ga0495628_0031756_2697_3350 186
42 3300046517 Ga0495630_0145467 Ga0495630_0145467_121_774 186
43 3300046533 Ga0495640_0044656 Ga0495640_0044656_1915_2568 186
44 3300046536 Ga0495587_0007868 Ga0495587_0007868_2589_3242 186
45 3300046543 Ga0495645_0025300 Ga0495645_0025300_3033_3686 186
46 3300046559 Ga0495667_0015833 Ga0495667_0015833_482_1135 186
47 3300046663 Ga0495635_0062354 Ga0495635_0062354_350_1003 186
48 3300046675 Ga0495657_0063574 Ga0495657_0063574_1595_2248 186
49 3300046678 Ga0495599_0064995 Ga0495599_0064995_933_1586 186
50 3300046679 Ga0495623_0064546 Ga0495623_0064546_1441_2094 186
51 3300046680 Ga0495646_0076048 Ga0495646_0076048_537_1190 186
52 3300046809 Ga0495600_0027222 Ga0495600_0027222_2285_2938 186
53 3300047317 Ga0495604_0054863 Ga0495604_0054863_1686_2339 186
54 3300047319 Ga0495674_0124037 Ga0495674_0124037_263_916 186
55 3300047322 Ga0495680_0021765 Ga0495680_0021765_3061_3714 186
56 3300047471 Ga0495684_0020835 Ga0495684_0020835_430_1083 186
57 3300048088 Ga0495602_0066849 Ga0495602_0066849_2155_2808 186
58 3300053085 Ga0495619_0184209 Ga0495619_0184209_778_1431 186
59 3300005339 Ga0070660_100178485 Ga0070660_1001784851 187
60 3300005467 Ga0070706_100224095 Ga0070706_1002240954 187
61 3300005468 Ga0070707_100028852 Ga0070707_1000288526 187
62 3300005471 Ga0070698_100010715 Ga0070698_1000107158 187
63 3300005518 Ga0070699_100037088 Ga0070699_1000370886 187
64 3300005539 Ga0068853_100154885 Ga0068853_1001548852 187
65 3300005615 Ga0070702_100266251 Ga0070702_1002662512 187
66 3300025910 Ga0207684_10595122 Ga0207684_105951221 187
67 3300025922 Ga0207646_10047555 Ga0207646_100475554 187
68 3300005435 Ga0070714_100482423 Ga0070714_1004824231 189
69 3300006028 Ga0070717_10346483 Ga0070717_103464832 189
70 3300025928 Ga0207700_10005106 Ga0207700_100051064 189
71 3300039450 Ga0436363_0975291 Ga0436363_0975291_403_1062 190
72 3300021388 Ga0213875_10048671 Ga0213875_100486712 191
73 3300005439 Ga0070711_100161808 Ga0070711_1001618081 192
74 3300006028 Ga0070717_10102551 Ga0070717_101025512 192
75 3300006163 Ga0070715_10015699 Ga0070715_100156994 192
76 3300006173 Ga0070716_100018425 Ga0070716_1000184254 192
77 3300006175 Ga0070712_100021888 Ga0070712_1000218882 192
78 3300025905 Ga0207685_10009292 Ga0207685_100092922 192
79 3300025906 Ga0207699_10011646 Ga0207699_100116463 192
80 3300025928 Ga0207700_10013863 Ga0207700_100138635 192
81 3300025929 Ga0207664_10033817 Ga0207664_100338173 192
82 3300025939 Ga0207665_10012998 Ga0207665_100129986 192
83 3300035111 Ga0373923_0159706 Ga0373923_0159706_12_668 192
84 3300035692 Ga0373935_0358636 Ga0373935_0358636_174_830 192
85 3300046459 Ga0495629_0033137 Ga0495629_0033137_1223_1879 192
86 3300046461 Ga0495641_0066012 Ga0495641_0066012_684_1340 192
87 3300046472 Ga0495580_0108815 Ga0495580_0108815_1002_1658 192
88 3300046473 Ga0495582_0036106 Ga0495582_0036106_37_693 192
89 3300046514 Ga0495618_0090995 Ga0495618_0090995_415_1071 192
90 3300046517 Ga0495630_0065513 Ga0495630_0065513_1222_1878 192
91 3300046526 Ga0495666_0042280 Ga0495666_0042280_547_1203 192
92 3300046529 Ga0495652_0187710 Ga0495652_0187710_630_1286 192
93 3300046531 Ga0495665_0095339 Ga0495665_0095339_567_1223 192
94 3300046642 Ga0495634_0034936 Ga0495634_0034936_1526_2182 192
95 3300046663 Ga0495635_0088685 Ga0495635_0088685_1002_1658 192
96 3300046681 Ga0495647_0017476 Ga0495647_0017476_659_1315 192
97 3300046689 Ga0495613_0240332 Ga0495613_0240332_158_814 192
98 3300046690 Ga0495624_0075663 Ga0495624_0075663_1217_1873 192
99 3300046809 Ga0495600_0064302 Ga0495600_0064302_1238_1894 192
100 3300047319 Ga0495674_0119786 Ga0495674_0119786_1110_1766 192
101 3300047322 Ga0495680_0031053 Ga0495680_0031053_1733_2389 192
102 3300047471 Ga0495684_0031459 Ga0495684_0031459_1733_2389 192
103 3300047673 Ga0495593_0043378 Ga0495593_0043378_559_1215 192
104 3300048089 Ga0495614_0029451 Ga0495614_0029451_1613_2269 192
105 3300034816 Ga0373930_0016630 Ga0373930_0016630_30_611 193
106 3300035086 Ga0373934_0015540 Ga0373934_0015540_31_612 193
107 3300035725 Ga0373947_0652434 Ga0373947_0652434_61_642 193
108 3300037068 Ga0373925_0069633 Ga0373925_0069633_75_704 193
109 3300039453 Ga0436362_1176978 Ga0436362_1176978_110_691 193
110 3300044673 Ga0453683_0324885 Ga0453683_0324885_157_738 193
111 3300046680 Ga0495646_0005189 Ga0495646_0005189_7607_8188 193
112 3300047471 Ga0495684_0075605 Ga0495684_0075605_24_605 193
113 3300048904 Ga0496101_0931934 Ga0496101_0931934_12_593 193
114 3300048917 Ga0496114_1077903 Ga0496114_1077903_52_633 193
115 3300037312 Ga0395899_0432428 Ga0395899_0432428_36_689 195
116 3300037418 Ga0395900_0075352 Ga0395900_0075352_1175_1828 195
117 3300037471 Ga0395905_0428639 Ga0395905_0428639_397_1050 195
118 3300038443 Ga0395901_0338824 Ga0395901_0338824_433_1086 195
119 3300039450 Ga0436363_0252140 Ga0436363_0252140_844_1503 195
120 3300039438 Ga0436360_0522949 Ga0436360_0522949_180_836 197
121 3300048916 Ga0496113_0661590 Ga0496113_0661590_227_823 198
122 3300035172 Ga0373955_0055046 Ga0373955_0055046_990_1646 199
123 3300035724 Ga0373933_0037948 Ga0373933_0037948_1299_1955 199
124 3300036401 Ga0373937_0095029 Ga0373937_0095029_1568_2227 199
125 3300046462 Ga0495651_0068157 Ga0495651_0068157_786_1442 199
126 3300046463 Ga0495653_0001060 Ga0495653_0001060_20337_20993 199
127 3300046477 Ga0495664_0031231 Ga0495664_0031231_1062_1718 199
128 3300046511 Ga0495608_0002353 Ga0495608_0002353_3398_4054 199
129 3300046511 Ga0495608_0187952 Ga0495608_0187952_294_953 199
130 3300046516 Ga0495628_0104942 Ga0495628_0104942_1490_2146 199
131 3300046529 Ga0495652_0009512 Ga0495652_0009512_1213_1869 199
132 3300046533 Ga0495640_0095685 Ga0495640_0095685_768_1424 199
133 3300046536 Ga0495587_0002811 Ga0495587_0002811_739_1395 199
134 3300046543 Ga0495645_0066002 Ga0495645_0066002_1909_2565 199
135 3300046559 Ga0495667_0130338 Ga0495667_0130338_549_1208 199
136 3300046642 Ga0495634_0409298 Ga0495634_0409298_88_744 199
137 3300046663 Ga0495635_0058561 Ga0495635_0058561_502_1158 199
138 3300046675 Ga0495657_0007889 Ga0495657_0007889_892_1548 199
139 3300046809 Ga0495600_0046111 Ga0495600_0046111_1162_1818 199
140 3300047317 Ga0495604_0041204 Ga0495604_0041204_1272_1928 199
141 3300047319 Ga0495674_0014006 Ga0495674_0014006_1918_2574 199
142 3300047322 Ga0495680_0011525 Ga0495680_0011525_946_1602 199
143 3300047471 Ga0495684_0008669 Ga0495684_0008669_6034_6690 199
144 3300048088 Ga0495602_0015545 Ga0495602_0015545_6545_7201 199
145 3300053084 Ga0495595_0120321 Ga0495595_0120321_488_1144 199
146 3300053085 Ga0495619_0487474 Ga0495619_0487474_84_740 199
147 3300031731 Ga0307405_10015269 Ga0307405_100152692 200
148 3300031731 Ga0307405_10192822 Ga0307405_101928222 200
149 3300031824 Ga0307413_10008652 Ga0307413_100086525 200
150 3300031901 Ga0307406_10008502 Ga0307406_100085026 200
151 3300031903 Ga0307407_10053754 Ga0307407_100537542 200
152 3300031995 Ga0307409_100259226 Ga0307409_1002592261 200
153 3300031995 Ga0307409_100488563 Ga0307409_1004885631 200
154 3300032002 Ga0307416_100004004 Ga0307416_1000040049 200
155 3300032002 Ga0307416_100713724 Ga0307416_1007137242 200
156 3300032005 Ga0307411_10010439 Ga0307411_100104394 200
157 3300032005 Ga0307411_10769666 Ga0307411_107696661 200
158 3300032126 Ga0307415_100002587 Ga0307415_1000025872 200
159 3300035086 Ga0373934_0093122 Ga0373934_0093122_178_798 201
160 3300005445 Ga0070708_100443075 Ga0070708_1004430751 202
161 3300005983 Ga0081540_1006393 Ga0081540_10063937 203
162 3300046517 Ga0495630_0152575 Ga0495630_0152575_986_1654 203
163 3300005467 Ga0070706_100181688 Ga0070706_1001816883 204
164 3300005468 Ga0070707_100131054 Ga0070707_1001310543 204
165 3300025910 Ga0207684_10617927 Ga0207684_106179271 204
166 3300046459 Ga0495629_0331726 Ga0495629_0331726_171_821 204
167 3300046473 Ga0495582_0176385 Ga0495582_0176385_540_1190 204
168 3300046535 Ga0495586_0028964 Ga0495586_0028964_1678_2328 204
169 3300046642 Ga0495634_0250643 Ga0495634_0250643_352_1002 204
170 3300046683 Ga0495658_0095566 Ga0495658_0095566_348_998 204
171 3300046689 Ga0495613_0084452 Ga0495613_0084452_543_1193 204
172 3300048906 Ga0496103_0161879 Ga0496103_0161879_358_1056 205
173 3300048921 Ga0496118_0000029 Ga0496118_0000029_323961_324659 205
174 3300005439 Ga0070711_100474688 Ga0070711_1004746881 206
175 3300025898 Ga0207692_10096175 Ga0207692_100961752 206
176 3300005435 Ga0070714_100129863 Ga0070714_1001298633 207
177 3300005436 Ga0070713_100432156 Ga0070713_1004321561 207
178 3300006871 Ga0075434_100453294 Ga0075434_1004532942 207
179 3300006914 Ga0075436_100031853 Ga0075436_1000318532 207
180 3300009147 Ga0114129_11212576 Ga0114129_112125761 207
181 3300046533 Ga0495640_0318748 Ga0495640_0318748_84_740 207
182 3300045976 Ga0466967_0065869 Ga0466967_0065869_1128_1814 209
183 iso_pu_bacteria 3002998708 3003006508 209
184 3300006847 Ga0075431_100541846 Ga0075431_1005418463 210
185 3300037466 Ga0395898_0258088 Ga0395898_0258088_253_906 210
186 3300038443 Ga0395901_0028362 Ga0395901_0028362_418_1071 210
187 3300005445 Ga0070708_100137418 Ga0070708_1001374182 211
188 3300005467 Ga0070706_100079031 Ga0070706_1000790313 211
189 3300006852 Ga0075433_10028540 Ga0075433_100285403 211
190 3300006871 Ga0075434_100040793 Ga0075434_1000407934 211
191 3300006914 Ga0075436_100014063 Ga0075436_1000140634 211
192 3300007076 Ga0075435_100020822 Ga0075435_1000208224 211
193 3300025910 Ga0207684_10200698 Ga0207684_102006983 211
194 3300035092 Ga0373952_0079032 Ga0373952_0079032_99_773 211
195 3300050512 nmdc:mga0n895_15643_c1 nmdc:mga0n895_15643_c1_5616_6266 211
196 3300050513 nmdc:mga0rr50_18111_c1 nmdc:mga0rr50_18111_c1_2325_2975 211
197 3300050513 nmdc:mga0rr50_801319_c1 nmdc:mga0rr50_801319_c1_38_688 211
198 3300050515 nmdc:mga0a205_15290_c1 nmdc:mga0a205_15290_c1_5475_6125 211
199 3300006028 Ga0070717_10429763 Ga0070717_104297632 212
200 3300005340 Ga0070689_100863062 Ga0070689_1008630621 213
201 3300005367 Ga0070667_100068561 Ga0070667_1000685615 213
202 3300005434 Ga0070709_10003884 Ga0070709_100038843 213
203 3300005434 Ga0070709_10007417 Ga0070709_100074172 213
204 3300005434 Ga0070709_10173962 Ga0070709_101739621 213
205 3300005435 Ga0070714_100004071 Ga0070714_1000040713 213
206 3300005435 Ga0070714_100013261 Ga0070714_1000132614 213
207 3300005435 Ga0070714_100013635 Ga0070714_1000136353 213
208 3300005435 Ga0070714_100054236 Ga0070714_1000542363 213
209 3300005435 Ga0070714_100527142 Ga0070714_1005271422 213
210 3300005436 Ga0070713_100101703 Ga0070713_1001017032 213
211 3300005436 Ga0070713_100139678 Ga0070713_1001396782 213
212 3300005436 Ga0070713_100172669 Ga0070713_1001726692 213
213 3300005436 Ga0070713_100270342 Ga0070713_1002703422 213
214 3300005437 Ga0070710_10000482 Ga0070710_1000048210 213
215 3300005437 Ga0070710_10043107 Ga0070710_100431071 213
216 3300005437 Ga0070710_10208585 Ga0070710_102085851 213
217 3300005439 Ga0070711_100001135 Ga0070711_1000011355 213
218 3300005439 Ga0070711_100006992 Ga0070711_1000069926 213
219 3300005439 Ga0070711_100369886 Ga0070711_1003698861 213
220 3300005445 Ga0070708_100068751 Ga0070708_1000687513 213
221 3300005467 Ga0070706_100030532 Ga0070706_1000305325 213
222 3300005467 Ga0070706_100479624 Ga0070706_1004796242 213
223 3300005468 Ga0070707_100007713 Ga0070707_1000077136 213
224 3300005468 Ga0070707_100072651 Ga0070707_1000726513 213
225 3300005468 Ga0070707_100229437 Ga0070707_1002294372 213
226 3300005471 Ga0070698_100110104 Ga0070698_1001101042 213
227 3300005471 Ga0070698_100375541 Ga0070698_1003755412 213
228 3300005563 Ga0068855_100159542 Ga0068855_1001595424 213
229 3300005718 Ga0068866_10190889 Ga0068866_101908892 213
230 3300005841 Ga0068863_100553890 Ga0068863_1005538901 213
231 3300005983 Ga0081540_1000255 Ga0081540_10002556 213
232 3300006028 Ga0070717_10006079 Ga0070717_100060794 213
233 3300006028 Ga0070717_10089436 Ga0070717_100894362 213
234 3300006028 Ga0070717_10193645 Ga0070717_101936453 213
235 3300006173 Ga0070716_100004082 Ga0070716_1000040823 213
236 3300006175 Ga0070712_100009357 Ga0070712_1000093573 213
237 3300006175 Ga0070712_100018633 Ga0070712_1000186335 213
238 3300006844 Ga0075428_100511946 Ga0075428_1005119462 213
239 3300006847 Ga0075431_101195160 Ga0075431_1011951601 213
240 3300006852 Ga0075433_10016072 Ga0075433_100160722 213
241 3300007076 Ga0075435_100058241 Ga0075435_1000582415 213
242 3300009094 Ga0111539_10026489 Ga0111539_100264892 213
243 3300009147 Ga0114129_10023945 Ga0114129_100239452 213
244 3300013306 Ga0163162_10615347 Ga0163162_106153471 213
245 3300021388 Ga0213875_10000508 Ga0213875_1000050820 213
246 3300025898 Ga0207692_10002958 Ga0207692_100029583 213
247 3300025898 Ga0207692_10022016 Ga0207692_100220162 213
248 3300025905 Ga0207685_10094832 Ga0207685_100948321 213
249 3300025906 Ga0207699_10001518 Ga0207699_100015182 213
250 3300025906 Ga0207699_10022571 Ga0207699_100225713 213
251 3300025906 Ga0207699_10106436 Ga0207699_101064361 213
252 3300025910 Ga0207684_10116862 Ga0207684_101168621 213
253 3300025910 Ga0207684_10600826 Ga0207684_106008261 213
254 3300025915 Ga0207693_10001262 Ga0207693_1000126214 213
255 3300025915 Ga0207693_10002335 Ga0207693_1000233516 213
256 3300025915 Ga0207693_10053700 Ga0207693_100537002 213
257 3300025915 Ga0207693_10289450 Ga0207693_102894502 213
258 3300025916 Ga0207663_10015395 Ga0207663_100153952 213
259 3300025916 Ga0207663_10084239 Ga0207663_100842392 213
260 3300025916 Ga0207663_10188090 Ga0207663_101880902 213
261 3300025921 Ga0207652_10742948 Ga0207652_107429482 213
262 3300025922 Ga0207646_10004410 Ga0207646_100044105 213
263 3300025922 Ga0207646_10050286 Ga0207646_100502862 213
264 3300025922 Ga0207646_10069311 Ga0207646_100693112 213
265 3300025922 Ga0207646_10328699 Ga0207646_103286992 213
266 3300025922 Ga0207646_10338352 Ga0207646_103383521 213
267 3300025928 Ga0207700_10000317 Ga0207700_1000031722 213
268 3300025928 Ga0207700_10000517 Ga0207700_1000051711 213
269 3300025928 Ga0207700_10020168 Ga0207700_100201682 213
270 3300025928 Ga0207700_10075359 Ga0207700_100753592 213
271 3300025928 Ga0207700_10191879 Ga0207700_101918793 213
272 3300025928 Ga0207700_10287464 Ga0207700_102874641 213
273 3300025929 Ga0207664_10000699 Ga0207664_1000069911 213
274 3300025929 Ga0207664_10007549 Ga0207664_100075491 213
275 3300025929 Ga0207664_10008591 Ga0207664_100085914 213
276 3300025929 Ga0207664_10015100 Ga0207664_100151002 213
277 3300025929 Ga0207664_10028125 Ga0207664_100281252 213
278 3300025929 Ga0207664_10127961 Ga0207664_101279614 213
279 3300025929 Ga0207664_10318516 Ga0207664_103185161 213
280 3300025939 Ga0207665_10000637 Ga0207665_1000063711 213
281 3300025939 Ga0207665_10002828 Ga0207665_100028283 213
282 3300025939 Ga0207665_10005711 Ga0207665_100057112 213
283 3300025986 Ga0207658_10159755 Ga0207658_101597552 213
284 3300026088 Ga0207641_11305494 Ga0207641_113054941 213
285 3300027907 Ga0207428_10220017 Ga0207428_102200171 213
286 3300028666 Ga0265336_10020447 Ga0265336_100204473 213
287 3300028800 Ga0265338_10001979 Ga0265338_1000197919 213
288 3300031090 Ga0265760_10137519 Ga0265760_101375191 213
289 3300035083 Ga0373926_0000850 Ga0373926_0000850_6731_7399 213
290 3300035083 Ga0373926_0001614 Ga0373926_0001614_3635_4291 213
291 3300035089 Ga0373944_0000427 Ga0373944_0000427_1331_1999 213
292 3300035116 Ga0373945_0000016 Ga0373945_0000016_8510_9178 213
293 3300035116 Ga0373945_0049979 Ga0373945_0049979_753_1409 213
294 3300035119 Ga0373956_0011948 Ga0373956_0011948_1631_2287 213
295 3300035170 Ga0373943_0003777 Ga0373943_0003777_5335_6003 213
296 3300035171 Ga0373946_0002742 Ga0373946_0002742_1520_2188 213
297 3300035171 Ga0373946_0027268 Ga0373946_0027268_699_1355 213
298 3300035171 Ga0373946_0098631 Ga0373946_0098631_224_880 213
299 3300035172 Ga0373955_0036768 Ga0373955_0036768_1513_2169 213
300 3300035410 Ga0373924_0009168 Ga0373924_0009168_540_1196 213
301 3300035691 Ga0373931_0026266 Ga0373931_0026266_1376_2032 213
302 3300035692 Ga0373935_0001369 Ga0373935_0001369_9777_10433 213
303 3300035692 Ga0373935_0020287 Ga0373935_0020287_1474_2142 213
304 3300035692 Ga0373935_0041211 Ga0373935_0041211_482_1138 213
305 3300035695 Ga0373927_0000603 Ga0373927_0000603_9650_10318 213
306 3300035725 Ga0373947_0000018 Ga0373947_0000018_90581_91237 213
307 3300035725 Ga0373947_0005652 Ga0373947_0005652_6140_6808 213
308 3300036401 Ga0373937_0008813 Ga0373937_0008813_4129_4785 213
309 3300037068 Ga0373925_0015520 Ga0373925_0015520_2452_3120 213
310 3300037068 Ga0373925_0094077 Ga0373925_0094077_1204_1860 213
311 3300037853 Ga0436364_0156249 Ga0436364_0156249_274_933 213
312 3300037853 Ga0436364_0168316 Ga0436364_0168316_23648_24307 213
313 3300039450 Ga0436363_0810953 Ga0436363_0810953_735_1391 213
314 3300044842 Ga0466957_0233994 Ga0466957_0233994_393_1061 213
315 3300045976 Ga0466967_0082035 Ga0466967_0082035_1243_1911 213
316 3300046454 Ga0495592_0044575 Ga0495592_0044575_1177_1833 213
317 3300046459 Ga0495629_0139061 Ga0495629_0139061_687_1355 213
318 3300046462 Ga0495651_0007627 Ga0495651_0007627_4419_5075 213
319 3300046463 Ga0495653_0031842 Ga0495653_0031842_1479_2147 213
320 3300046463 Ga0495653_0253594 Ga0495653_0253594_416_1072 213
321 3300046475 Ga0495639_0022058 Ga0495639_0022058_1462_2130 213
322 3300046475 Ga0495639_0103641 Ga0495639_0103641_16_672 213
323 3300046476 Ga0495662_0013050 Ga0495662_0013050_383_1039 213
324 3300046476 Ga0495662_0017309 Ga0495662_0017309_1101_1769 213
325 3300046477 Ga0495664_0002456 Ga0495664_0002456_1117_1785 213
326 3300046477 Ga0495664_0011654 Ga0495664_0011654_4058_4714 213
327 3300046477 Ga0495664_0364448 Ga0495664_0364448_113_769 213
328 3300046511 Ga0495608_0014936 Ga0495608_0014936_3202_3858 213
329 3300046511 Ga0495608_0153689 Ga0495608_0153689_726_1394 213
330 3300046516 Ga0495628_0011338 Ga0495628_0011338_5068_5724 213
331 3300046517 Ga0495630_0023035 Ga0495630_0023035_2482_3150 213
332 3300046517 Ga0495630_0116347 Ga0495630_0116347_1234_1890 213
333 3300046529 Ga0495652_0017563 Ga0495652_0017563_1452_2120 213
334 3300046531 Ga0495665_0021480 Ga0495665_0021480_1085_1753 213
335 3300046533 Ga0495640_0019265 Ga0495640_0019265_188_844 213
336 3300046536 Ga0495587_0005975 Ga0495587_0005975_3039_3695 213
337 3300046543 Ga0495645_0032980 Ga0495645_0032980_246_902 213
338 3300046559 Ga0495667_0003787 Ga0495667_0003787_1855_2511 213
339 3300046559 Ga0495667_0004696 Ga0495667_0004696_7043_7711 213
340 3300046642 Ga0495634_0019626 Ga0495634_0019626_1443_2111 213
341 3300046642 Ga0495634_0028912 Ga0495634_0028912_770_1426 213
342 3300046663 Ga0495635_0006235 Ga0495635_0006235_1466_2134 213
343 3300046663 Ga0495635_0117179 Ga0495635_0117179_967_1623 213
344 3300046675 Ga0495657_0009576 Ga0495657_0009576_987_1643 213
345 3300046678 Ga0495599_0015298 Ga0495599_0015298_3886_4554 213
346 3300046678 Ga0495599_0214221 Ga0495599_0214221_328_984 213
347 3300046679 Ga0495623_0279792 Ga0495623_0279792_21_689 213
348 3300046680 Ga0495646_0080967 Ga0495646_0080967_959_1627 213
349 3300046690 Ga0495624_0079069 Ga0495624_0079069_234_902 213
350 3300046690 Ga0495624_0139702 Ga0495624_0139702_530_1186 213
351 3300046809 Ga0495600_0017332 Ga0495600_0017332_1542_2198 213
352 3300046809 Ga0495600_0105494 Ga0495600_0105494_944_1612 213
353 3300047315 Ga0495581_0017412 Ga0495581_0017412_1084_1752 213
354 3300047319 Ga0495674_0000278 Ga0495674_0000278_1917_2585 213
355 3300047319 Ga0495674_0032327 Ga0495674_0032327_1299_1955 213
356 3300047321 Ga0495676_0003229 Ga0495676_0003229_7168_7836 213
357 3300047322 Ga0495680_0025797 Ga0495680_0025797_4186_4842 213
358 3300047322 Ga0495680_0049234 Ga0495680_0049234_1327_1995 213
359 3300047444 Ga0495675_0019288 Ga0495675_0019288_1870_2526 213
360 3300047471 Ga0495684_0040407 Ga0495684_0040407_1448_2116 213
361 3300047673 Ga0495593_0136109 Ga0495593_0136109_137_793 213
362 3300048088 Ga0495602_0027046 Ga0495602_0027046_3210_3866 213
363 3300048089 Ga0495614_0108054 Ga0495614_0108054_152_820 213
364 3300048911 Ga0496108_0120965 Ga0496108_0120965_763_1431 213
365 3300050507 nmdc:mga05p37_13491_c1 nmdc:mga05p37_13491_c1_3563_4219 213
366 3300050511 nmdc:mga08y16_418468_c1 nmdc:mga08y16_418468_c1_414_1070 213
367 3300050512 nmdc:mga0n895_48927_c1 nmdc:mga0n895_48927_c1_3286_3942 213
368 3300050512 nmdc:mga0n895_571168_c1 nmdc:mga0n895_571168_c1_27_695 213
369 3300050513 nmdc:mga0rr50_123942_c1 nmdc:mga0rr50_123942_c1_275_931 213
370 3300050514 nmdc:mga08x19_55595_c1 nmdc:mga08x19_55595_c1_1545_2201 213
371 3300050515 nmdc:mga0a205_44450_c1 nmdc:mga0a205_44450_c1_967_1623 213
372 3300053077 Ga0495601_0286494 Ga0495601_0286494_95_763 213
373 3300053078 Ga0495612_0042550 Ga0495612_0042550_1046_1714 213
374 3300053084 Ga0495595_0028451 Ga0495595_0028451_150_806 213
375 3300005445 Ga0070708_100884799 Ga0070708_1008847991 214
376 3300005468 Ga0070707_100092475 Ga0070707_1000924754 214
377 3300006028 Ga0070717_10556626 Ga0070717_105566261 214
378 3300020069 Ga0197907_10104446 Ga0197907_101044461 214
379 3300020070 Ga0206356_10161472 Ga0206356_101614721 214
380 3300020070 Ga0206356_11039206 Ga0206356_110392061 214
381 3300020076 Ga0206355_1301906 Ga0206355_13019061 214
382 3300020078 Ga0206352_10070517 Ga0206352_100705171 214
383 3300020080 Ga0206350_10158994 Ga0206350_101589941 214
384 3300020082 Ga0206353_10694706 Ga0206353_106947063 214
385 3300022467 Ga0224712_10001459 Ga0224712_100014591 214
386 3300025922 Ga0207646_10020411 Ga0207646_100204116 214
387 3300005330 Ga0070690_100257361 Ga0070690_1002573612 217
388 3300005337 Ga0070682_100606110 Ga0070682_1006061101 217
389 3300005341 Ga0070691_10447544 Ga0070691_104475441 217
390 3300005434 Ga0070709_10040684 Ga0070709_100406841 217
391 3300005435 Ga0070714_100067930 Ga0070714_1000679302 217
392 3300005437 Ga0070710_10106417 Ga0070710_101064173 217
393 3300005439 Ga0070711_100327089 Ga0070711_1003270892 217
394 3300005455 Ga0070663_100232020 Ga0070663_1002320202 217
395 3300005456 Ga0070678_100273137 Ga0070678_1002731372 217
396 3300005547 Ga0070693_100001721 Ga0070693_1000017218 217
397 3300005564 Ga0070664_100565078 Ga0070664_1005650782 217
398 3300006175 Ga0070712_100018950 Ga0070712_1000189502 217
399 3300006175 Ga0070712_100796757 Ga0070712_1007967571 217
400 3300006237 Ga0097621_100066143 Ga0097621_1000661434 217
401 3300006358 Ga0068871_101000648 Ga0068871_1010006481 217
402 3300007076 Ga0075435_100284111 Ga0075435_1002841112 217
403 3300013297 Ga0157378_10921207 Ga0157378_109212071 217
404 3300025898 Ga0207692_10212412 Ga0207692_102124122 217
405 3300025906 Ga0207699_10254593 Ga0207699_102545932 217
406 3300025911 Ga0207654_10016738 Ga0207654_100167382 217
407 3300025915 Ga0207693_10052562 Ga0207693_100525624 217
408 3300025916 Ga0207663_10037872 Ga0207663_100378724 217
409 3300025917 Ga0207660_10063193 Ga0207660_100631932 217
410 3300025929 Ga0207664_10030525 Ga0207664_100305254 217
411 3300025939 Ga0207665_10006076 Ga0207665_100060765 217
412 3300025945 Ga0207679_10136478 Ga0207679_101364782 217
413 3300026067 Ga0207678_10012330 Ga0207678_100123304 217
414 3300026121 Ga0207683_10000233 Ga0207683_1000023343 217
415 3300031247 Ga0265340_10017381 Ga0265340_100173813 217
416 3300034818 Ga0373950_0020557 Ga0373950_0020557_472_1125 217
417 3300034957 Ga0373938_0012299 Ga0373938_0012299_176_829 217
418 3300035088 Ga0373940_0040044 Ga0373940_0040044_400_1053 217
419 3300035090 Ga0373949_0006482 Ga0373949_0006482_1264_1917 217
420 3300035207 Ga0373942_0039415 Ga0373942_0039415_348_1001 217
421 3300048905 Ga0496102_0053166 Ga0496102_0053166_2930_3583 217
422 3300048908 Ga0496105_0055638 Ga0496105_0055638_1899_2552 217
423 3300048909 Ga0496106_0042617 Ga0496106_0042617_2251_2904 217
424 3300048910 Ga0496107_0020523 Ga0496107_0020523_3703_4356 217
425 3300048911 Ga0496108_0213586 Ga0496108_0213586_83_736 217
426 3300048915 Ga0496112_0185273 Ga0496112_0185273_754_1407 217
427 3300048917 Ga0496114_0739483 Ga0496114_0739483_98_751 217
428 3300048918 Ga0496115_0065925 Ga0496115_0065925_1567_2220 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01027

Bax1-I

Inhibitor of apoptosis-promoting Bax1

34

229

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8891 20 214
6nq9-assembly3.cif.gz_C crystal structure of yetj mutant from bacillus subtilis - d195e 0.8775 20 214
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8661 20 214
6nq8-assembly2.cif.gz_B crystal structure of yetj mutant from bacillus subtilis - d171e 0.8561 20 214
4pgw-assembly1.cif.gz_A crystal structure of yetj from bacillus subtilis at ph 6 by pt-sad 0.8495 20 214
ID Description Score Start End Superfamily
af_Q6ZEY7_1_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8972 11 211 1.20.1250.20
af_O74888_1_266_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8903 13 214 1.20.1250.20
af_Q6P9T9_32_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8857 19 210 1.20.1250.20
af_Q8IKN3_1_243_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.883 11 215 1.20.1250.20
af_F4JP81_38_234_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8717 20 213 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6P2BXT6-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9807 9 214 GO:0005886
AF-A0A1Q5A6M9-F1-model_v4 Transporter 0.9707 44 215 GO:0005886
AF-A0A6P2BXT6-F1-model_v4 Bax inhibitor-1/YccA family protein 0.9445 9 214 GO:0005886
AF-A0A2T0JTQ4-F1-model_v4 Modulator of FtsH protease 0.9436 3 216 GO:0005886
GO:0006508
GO:0008233
AF-A0A1Q6XGZ1-F1-model_v4 Transporter 0.942 1 216 GO:0005886

Feature Viewer

pLDDT pTM Quality
85.32 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map