F441643

General Info

Members Datasets Scaffolds Average Seq Length
428 293 390 514

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10004426|Ga0075368_100044264
Length 541
Sequence MTIPFFSKAKRGEEQPHGKLRIFVPKDAAAVACGADAVAAAIARSASQTGVPVEIVRTGSRGLLWLEPLVELEMGGIRHGFGPIEPETVGNLLNAGLLRGDLKALSAHPQSLGPVDKIDYLARQTRLTFARCGVIDPLSLDAYRALGGYKGLEKALSLTPAGVIEEVSKSGLRGRGGAGFPTGIKWKTVHDTSAEQKYIVCNADEGDSGTFADRMLMEGDPFVLIEGMTIAGLAVGATKGFIYVRSEYSHAIVALNAAIGIARKAGLLGIDVAGSRKVFDIEVRTGAGAYVCGEETALLDSLEGKRGIVRAKPPLPAHKGLFGRPTVINNVLSLGAVPFIMAEGAKTYFDFGLGRSRGTMPIQLAGNIKRGGLFETAFGVTLGQLVDDIGGGTASGRPVKAVQVGGPLGAYFPRALFDTPFDYEAFAARDGLIGHAGVVVFDDTADMAKQARFAFEFCAIESCGKCTPCRIGSTRGVETVDKIMAGDASEDNLAVVKDLCNTMKFGSLCALGGFTPYPVMSALTHFPEDFRRPTQRLQAAE

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
8 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2791355199
13 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
14 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
15 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2904699407
20 2906610324
21 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
22 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
23 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
24 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
25 2909042592 Labrys sp. LIt4 Isolate Nodule
26 2922425934
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
29 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
30 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
31 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
34 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
37 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
38 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
85 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
171 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
173 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
288 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
289 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
290 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
291 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
292 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
293 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0.24
Isolates 8.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.48
Nodule 6.54
Rhizoplane 7.48
Rhizosphere 67.99
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000801 3300001976 Bacteria 4241
2 JGI24740J21852_10010758 3300001979 Bacteria 3507
3 JGI24739J22299_10017889 3300001989 Bacteria 2552
4 JGI24739J22299_10024173 3300001989 Bacteria 2144
5 JGI24735J21928_10003412 3300002067 Bacteria 5418
6 JGI24738J21930_10002207 3300002075 Bacteria 5180
7 JGI24034J26672_10000028 3300002239 Bacteria 105058
8 JGI25153J46596_10005767 3300003215 Bacteria 6450
9 Ga0070690_100000003 3300005330 Bacteria 144748
10 Ga0070670_100081880 3300005331 Bacteria 2773
11 Ga0070670_100184127 3300005331 Bacteria 1813
12 Ga0070666_10000006 3300005335 Bacteria 319173
13 Ga0070680_100062242 3300005336 Bacteria 3056
14 Ga0068868_100041351 3300005338 Bacteria 3591
15 Ga0070660_100072572 3300005339 Bacteria 2690
16 Ga0070661_100021261 3300005344 Bacteria 4632
17 Ga0070668_100014799 3300005347 Bacteria 5830
18 Ga0070668_100185233 3300005347 Bacteria 1702
19 Ga0070669_100000014 3300005353 Bacteria 206875
20 Ga0070669_100147197 3300005353 Bacteria 1821
21 Ga0070675_100021182 3300005354 Bacteria 5193
22 Ga0070673_100025867 3300005364 Bacteria 4327
23 Ga0070688_100001679 3300005365 Bacteria 11047
24 Ga0070688_100086015 3300005365 Bacteria 2045
25 Ga0070659_100108606 3300005366 Bacteria 2238
26 Ga0070667_100009677 3300005367 Bacteria 7993
27 Ga0070667_100009949 3300005367 Bacteria 7883
28 Ga0070713_100165047 3300005436 Bacteria 1980
29 Ga0070711_100025096 3300005439 Bacteria 3896
30 Ga0070711_100074934 3300005439 Bacteria 2395
31 Ga0070663_100034961 3300005455 Bacteria 3483
32 Ga0070662_100110401 3300005457 Bacteria 2094
33 Ga0070681_10009165 3300005458 Bacteria 9724
34 Ga0068867_100012648 3300005459 Bacteria 5968
35 Ga0070685_10000072 3300005466 Bacteria 59953
36 Ga0068853_100042702 3300005539 Bacteria 3878
37 Ga0070686_100000022 3300005544 Bacteria 131168
38 Ga0070686_100001519 3300005544 Bacteria 13029
39 Ga0070693_100078317 3300005547 Bacteria 1964
40 Ga0070665_100000011 3300005548 Bacteria 525539
41 Ga0070665_100000019 3300005548 Bacteria 413972
42 Ga0070665_100001612 3300005548 Bacteria 25956
43 Ga0068857_100012261 3300005577 Bacteria 7457
44 Ga0068857_100138286 3300005577 Bacteria 2200
45 Ga0068857_100144186 3300005577 Bacteria 2154
46 Ga0068856_100234745 3300005614 Bacteria 1849
47 Ga0068859_100062134 3300005617 Bacteria 3764
48 Ga0068861_100008632 3300005719 Bacteria 7006
49 Ga0068861_100083039 3300005719 Bacteria 2512
50 Ga0068863_100000048 3300005841 Bacteria 135912
51 Ga0068863_100105241 3300005841 Bacteria 2684
52 Ga0068860_100000014 3300005843 Bacteria 319437
53 Ga0068860_100000429 3300005843 Bacteria 53378
54 Ga0068860_100021988 3300005843 Bacteria 6173
55 Ga0068860_100022212 3300005843 Bacteria 6142
56 Ga0068862_100000595 3300005844 Bacteria 37638
57 Ga0068862_100007061 3300005844 Bacteria 9325
58 Ga0081455_10001223 3300005937 Bacteria 32117
59 Ga0081540_1000114 3300005983 Bacteria 85489
60 Ga0081540_1006968 3300005983 Bacteria 8140
61 Ga0081540_1009314 3300005983 Bacteria 6773
62 Ga0081540_1012667 3300005983 Bacteria 5532
63 Ga0081540_1019527 3300005983 Bacteria 4112
64 Ga0081539_10000824 3300005985 Bacteria 59921
65 Ga0070717_10000402 3300006028 Bacteria 27731
66 Ga0070717_10043138 3300006028 Bacteria 3681
67 Ga0070717_10091547 3300006028 Bacteria 2568
68 Ga0075368_10004426 3300006042 Bacteria 4762
69 Ga0075363_100006496 3300006048 Bacteria 5318
70 Ga0075363_100017482 3300006048 Bacteria 3557
71 Ga0075363_100077311 3300006048 Bacteria 1816
72 Ga0075364_10006651 3300006051 Bacteria 6812
73 Ga0070712_100011940 3300006175 Bacteria 5519
74 Ga0075367_10004569 3300006178 Bacteria 6775
75 Ga0075367_10012738 3300006178 Bacteria 4498
76 Ga0075367_10098764 3300006178 Bacteria 1783
77 Ga0075428_100006220 3300006844 Bacteria 13281
78 Ga0075431_100148671 3300006847 Bacteria 2413
79 Ga0097620_100062132 3300006931 Bacteria 3764
80 Ga0099824_1010736 3300006942 Bacteria 10647
81 Ga0099822_1001873 3300006943 Bacteria 25386
82 Ga0105240_10191076 3300009093 Bacteria 2408
83 Ga0111539_10025831 3300009094 Bacteria 7192
84 Ga0105245_10094969 3300009098 Bacteria 2750
85 Ga0105247_10039051 3300009101 Bacteria 2900
86 Ga0114129_10209648 3300009147 Bacteria 2635
87 Ga0105241_10188148 3300009174 Bacteria 1717
88 Ga0105248_10058346 3300009177 Bacteria 4335
89 Ga0105237_10130645 3300009545 Bacteria 2506
90 Ga0105237_10136040 3300009545 Bacteria 2451
91 Ga0105238_10083087 3300009551 Bacteria 3192
92 Ga0105238_10176814 3300009551 Bacteria 2111
93 Ga0105238_10207579 3300009551 Bacteria 1935
94 Ga0105249_10000104 3300009553 Bacteria 118213
95 Ga0105249_10006652 3300009553 Bacteria 10061
96 Ga0105239_10193472 3300010375 Bacteria 2277
97 Ga0157369_10008193 3300013105 Bacteria 11990
98 Ga0157369_10018521 3300013105 Bacteria 7806
99 Ga0163162_10113340 3300013306 Bacteria 2810
100 Ga0163162_10154831 3300013306 Bacteria 2412
101 Ga0157375_10033244 3300013308 Bacteria 4898
102 Ga0157375_10055765 3300013308 Bacteria 3898
103 Ga0163163_10079456 3300014325 Bacteria 3278
104 Ga0157380_10023281 3300014326 Bacteria 4671
105 Ga0163161_10000020 3300017792 Bacteria 214642
106 Ga0163161_10049391 3300017792 Bacteria 3040
107 Ga0213876_10003117 3300021384 Bacteria 9586
108 Ga0213876_10027402 3300021384 Bacteria 3007
109 Ga0209148_1005310 3300025254 Bacteria 2980
110 Ga0209455_1002894 3300025272 Bacteria 6337
111 Ga0209455_1008301 3300025272 Bacteria 2834
112 Ga0209758_1001959 3300025297 Bacteria 22262
113 Ga0207656_10005204 3300025321 Bacteria 4576
114 Ga0207680_10000011 3300025903 Bacteria 391225
115 Ga0207647_10004010 3300025904 Bacteria 10986
116 Ga0207705_10031436 3300025909 Bacteria 3789
117 Ga0207705_10064722 3300025909 Bacteria 2642
118 Ga0207654_10023730 3300025911 Bacteria 3290
119 Ga0207707_10000404 3300025912 Bacteria 45123
120 Ga0207695_10013657 3300025913 Bacteria 9669
121 Ga0207671_10001056 3300025914 Bacteria 33385
122 Ga0207693_10017987 3300025915 Bacteria 5633
123 Ga0207663_10022927 3300025916 Bacteria 3575
124 Ga0207657_10016479 3300025919 Bacteria 7126
125 Ga0207681_10000045 3300025923 Bacteria 128454
126 Ga0207694_10004027 3300025924 Bacteria 11568
127 Ga0207694_10024032 3300025924 Bacteria 4628
128 Ga0207650_10013443 3300025925 Bacteria 5668
129 Ga0207650_10054101 3300025925 Bacteria 2976
130 Ga0207687_10013063 3300025927 Bacteria 5426
131 Ga0207700_10213801 3300025928 Bacteria 1631
132 Ga0207664_10027721 3300025929 Bacteria 4299
133 Ga0207690_10101016 3300025932 Bacteria 2060
134 Ga0207706_10133920 3300025933 Bacteria 2180
135 Ga0207706_10161228 3300025933 Bacteria 1971
136 Ga0207711_10011472 3300025941 Bacteria 7366
137 Ga0207711_10021860 3300025941 Bacteria 5344
138 Ga0207689_10072170 3300025942 Bacteria 2836
139 Ga0207679_10054988 3300025945 Bacteria 2933
140 Ga0207667_10003961 3300025949 Bacteria 18221
141 Ga0207651_10022254 3300025960 Bacteria 3871
142 Ga0207712_10000013 3300025961 Bacteria 391208
143 Ga0207668_10011314 3300025972 Bacteria 5416
144 Ga0207668_10021291 3300025972 Bacteria 4133
145 Ga0207658_10004086 3300025986 Bacteria 10177
146 Ga0207677_10058843 3300026023 Bacteria 2648
147 Ga0207703_10018727 3300026035 Bacteria 5408
148 Ga0207703_10060810 3300026035 Bacteria 3090
149 Ga0207639_10076193 3300026041 Bacteria 2640
150 Ga0207678_10007944 3300026067 Bacteria 9359
151 Ga0207702_10012833 3300026078 Bacteria 6970
152 Ga0207641_10000143 3300026088 Bacteria 102398
153 Ga0207641_10063006 3300026088 Bacteria 3166
154 Ga0207676_10013322 3300026095 Bacteria 5906
155 Ga0207676_10087281 3300026095 Bacteria 2551
156 Ga0207674_10111629 3300026116 Bacteria 2708
157 Ga0207674_10162026 3300026116 Bacteria 2191
158 Ga0207674_10166969 3300026116 Bacteria 2155
159 Ga0207675_100011915 3300026118 Bacteria 8125
160 Ga0207675_100015746 3300026118 Bacteria 7051
161 Ga0207675_100062997 3300026118 Bacteria 3465
162 Ga0207675_100079803 3300026118 Bacteria 3067
163 Ga0207675_100081813 3300026118 Bacteria 3028
164 Ga0209589_1000001 3300027357 Bacteria 794224
165 Ga0209489_100001 3300027361 Bacteria 794224
166 Ga0209700_100001 3300027363 Bacteria 794224
167 Ga0209813_10000325 3300027866 Bacteria 12570
168 Ga0209813_10001069 3300027866 Bacteria 6156
169 Ga0268266_10000025 3300028379 Bacteria 477143
170 Ga0268266_10000063 3300028379 Bacteria 253339
171 Ga0268266_10000487 3300028379 Bacteria 56915
172 Ga0268266_10125633 3300028379 Bacteria 2288
173 Ga0268265_10000954 3300028380 Bacteria 26564
174 Ga0268265_10081205 3300028380 Bacteria 2559
175 Ga0268264_10000037 3300028381 Bacteria 391116
176 Ga0268264_10000048 3300028381 Bacteria 334457
177 Ga0268264_10011554 3300028381 Bacteria 7293
178 Ga0265337_1014325 3300028556 Bacteria 2631
179 Ga0307515_10001840 3300028794 Bacteria 47276
180 Ga0265338_10000034 3300028800 Bacteria 244623
181 Ga0265338_10012491 3300028800 Bacteria 9679
182 Ga0265324_10008520 3300029957 Bacteria 4070
183 Ga0265332_10001463 3300031238 Bacteria 13211
184 Ga0265332_10020911 3300031238 Bacteria 2890
185 Ga0265340_10001613 3300031247 Bacteria 12952
186 Ga0265339_10049199 3300031249 Bacteria 2310
187 Ga0265327_10001365 3300031251 Bacteria 31449
188 Ga0307509_10004515 3300031507 Bacteria 20009
189 Ga0307408_100128428 3300031548 Bacteria 1974
190 Ga0307508_10000003 3300031616 Bacteria 321602
191 Ga0307508_10091923 3300031616 Bacteria 2623
192 Ga0307508_10102001 3300031616 Bacteria 2465
193 Ga0307508_10126578 3300031616 Bacteria 2158
194 Ga0265314_10003438 3300031711 Bacteria 15304
195 Ga0265314_10006795 3300031711 Bacteria 10029
196 Ga0265314_10008040 3300031711 Bacteria 9093
197 Ga0265314_10044098 3300031711 Bacteria 3164
198 Ga0265314_10055608 3300031711 Bacteria 2730
199 Ga0265342_10000039 3300031712 Bacteria 140091
200 Ga0265342_10007997 3300031712 Bacteria 7657
201 Ga0316578_10078845 3300031728 Bacteria 1957
202 Ga0307516_10010023 3300031730 Bacteria 10487
203 Ga0307405_10124427 3300031731 Bacteria 1770
204 Ga0316577_10080783 3300031733 Bacteria 1817
205 Ga0307409_100080329 3300031995 Bacteria 2631
206 Ga0307416_100089297 3300032002 Bacteria 2638
207 Ga0307414_10018272 3300032004 Bacteria 4311
208 Ga0316585_10014194 3300032137 Bacteria 2378
209 Ga0316593_10001971 3300032168 Bacteria 4722
210 Ga0307507_10057433 3300033179 Bacteria 3665
211 Ga0315911_1000002 3300033442 Bacteria 926833
212 Ga0373923_0005649 3300035111 Bacteria 4261
213 Ga0373953_0002986 3300035117 Bacteria 5176
214 Ga0373954_0016099 3300035118 Bacteria 3346
215 Ga0373943_0021339 3300035170 Bacteria 2990
216 Ga0373955_0018293 3300035172 Bacteria 3483
217 Ga0316574_0020272 3300035398 Bacteria 3934
218 Ga0373924_0013160 3300035410 Bacteria 3105
219 Ga0373931_0055103 3300035691 Bacteria 2127
220 Ga0373935_0018766 3300035692 Bacteria 4213
221 Ga0373927_0036629 3300035695 Bacteria 3190
222 Ga0373933_0116762 3300035724 Bacteria 1668
223 Ga0373947_0002058 3300035725 Bacteria 12264
224 Ga0373925_0014994 3300037068 Bacteria 5602
225 Ga0395899_0063292 3300037312 Bacteria 2722
226 Ga0395900_0062919 3300037418 Bacteria 3814
227 Ga0395898_0014826 3300037466 Bacteria 8002
228 Ga0395898_0037505 3300037466 Bacteria 4807
229 Ga0395905_0001489 3300037471 Bacteria 28024
230 Ga0395905_0003242 3300037471 Bacteria 17500
231 Ga0316581_0000346 3300037588 Bacteria 8468
232 Ga0436364_0114650 3300037853 Bacteria 1839
233 Ga0436364_0722576 3300037853 Bacteria 4936
234 Ga0395901_0026492 3300038443 Bacteria 5953
235 Ga0436365_0564814 3300039437 Bacteria 24891
236 Ga0436365_1042606 3300039437 Bacteria 16654
237 Ga0436365_1128219 3300039437 Bacteria 41762
238 Ga0436361_0121455 3300039447 Bacteria 3429
239 Ga0436363_0023802 3300039450 Bacteria 1864
240 Ga0436362_0305045 3300039453 Bacteria 2451
241 Ga0495592_0012321 3300046454 Bacteria 6494
242 Ga0495603_0000198 3300046455 Bacteria 31511
243 Ga0495629_0000907 3300046459 Bacteria 23785
244 Ga0495629_0002029 3300046459 Bacteria 15740
245 Ga0495629_0056731 3300046459 Bacteria 2738
246 Ga0495638_0006759 3300046460 Bacteria 8304
247 Ga0495638_0023696 3300046460 Bacteria 4010
248 Ga0495638_0024159 3300046460 Bacteria 3966
249 Ga0495653_0048844 3300046463 Bacteria 3263
250 Ga0495580_0004406 3300046472 Bacteria 11825
251 Ga0495580_0022608 3300046472 Bacteria 4625
252 Ga0495582_0001026 3300046473 Bacteria 15634
253 Ga0495639_0008463 3300046475 Bacteria 4411
254 Ga0495664_0014560 3300046477 Bacteria 4461
255 Ga0495664_0018042 3300046477 Bacteria 4036
256 Ga0495594_0006841 3300046499 Bacteria 5861
257 Ga0495618_0008774 3300046514 Bacteria 6105
258 Ga0495630_0096655 3300046517 Bacteria 2233
259 Ga0495643_0002676 3300046522 Bacteria 13790
260 Ga0495645_0013656 3300046543 Bacteria 5753
261 Ga0495622_0000964 3300046557 Bacteria 15444
262 Ga0495667_0018933 3300046559 Bacteria 4648
263 Ga0495634_0003965 3300046642 Bacteria 11752
264 Ga0495588_0001473 3300046674 Bacteria 10107
265 Ga0495657_0058559 3300046675 Bacteria 2558
266 Ga0495599_0072529 3300046678 Bacteria 2149
267 Ga0495647_0008590 3300046681 Bacteria 3436
268 Ga0495658_0009190 3300046683 Bacteria 4914
269 Ga0495613_0000680 3300046689 Bacteria 26874
270 Ga0495613_0002597 3300046689 Bacteria 13568
271 Ga0495581_0011225 3300047315 Bacteria 5179
272 Ga0495604_0006563 3300047317 Bacteria 9223
273 Ga0495593_0004032 3300047673 Bacteria 8749
274 Ga0495593_0015143 3300047673 Bacteria 4377
275 Ga0495602_0039574 3300048088 Bacteria 4339
276 Ga0496101_0011628 3300048904 Bacteria 5846
277 Ga0496101_0045229 3300048904 Bacteria 3152
278 Ga0496101_0148016 3300048904 Bacteria 1794
279 Ga0496103_0002059 3300048906 Bacteria 12866
280 Ga0496104_0000189 3300048907 Bacteria 55677
281 Ga0496104_0165672 3300048907 Bacteria 2119
282 Ga0496105_0003335 3300048908 Bacteria 11869
283 Ga0496105_0007034 3300048908 Bacteria 8669
284 Ga0496106_0006359 3300048909 Bacteria 8746
285 Ga0496106_0032793 3300048909 Bacteria 3873
286 Ga0496107_0010605 3300048910 Bacteria 6406
287 Ga0496107_0025317 3300048910 Bacteria 4201
288 Ga0496108_0035334 3300048911 Bacteria 4154
289 Ga0496108_0049451 3300048911 Bacteria 3517
290 Ga0496108_0171253 3300048911 Bacteria 1878
291 Ga0496109_0009042 3300048912 Bacteria 8487
292 Ga0496109_0033414 3300048912 Bacteria 4628
293 Ga0496109_0048842 3300048912 Bacteria 3850
294 Ga0496109_0107457 3300048912 Bacteria 2592
295 Ga0496110_0000425 3300048913 Bacteria 28663
296 Ga0496110_0083899 3300048913 Bacteria 2843
297 Ga0496111_0000217 3300048914 Bacteria 27335
298 Ga0496111_0039349 3300048914 Bacteria 3390
299 Ga0496112_0057769 3300048915 Bacteria 3820
300 Ga0496112_0083173 3300048915 Bacteria 3165
301 Ga0496112_0091751 3300048915 Bacteria 3006
302 Ga0496113_0030562 3300048916 Bacteria 3900
303 Ga0496113_0058780 3300048916 Bacteria 2894
304 Ga0496115_0044445 3300048918 Bacteria 3543
305 Ga0496115_0047636 3300048918 Bacteria 3428
306 Ga0496115_0081112 3300048918 Bacteria 2642
307 Ga0496116_0130354 3300048919 Bacteria 1435
308 Ga0496117_0009968 3300048920 Bacteria 8736
309 Ga0496117_0014289 3300048920 Bacteria 6851
310 Ga0496118_0005282 3300048921 Bacteria 14743
311 Ga0496119_0014111 3300048922 Bacteria 6287
312 Ga0496121_0000009 3300048924 Bacteria 836971
313 Ga0496121_0031009 3300048924 Bacteria 4897
314 Ga0496121_0057009 3300048924 Bacteria 3240
315 Ga0496121_0073592 3300048924 Bacteria 2737
316 Ga0496122_0000529 3300048925 Bacteria 79186
317 Ga0496123_0000210 3300048926 Bacteria 118956
318 Ga0496125_0079091 3300048928 Bacteria 2524
319 Ga0496126_0003285 3300048929 Bacteria 20614
320 Ga0496126_0083973 3300048929 Bacteria 2810
321 Ga0496126_0095442 3300048929 Bacteria 2608
322 Ga0501031_0000025 3300049568 Bacteria 89064
323 Ga0501031_0058570 3300049568 Bacteria 2510
324 Ga0501032_0002015 3300049569 Bacteria 16009
325 Ga0501032_0045415 3300049569 Bacteria 2971
326 Ga0501033_0002377 3300049570 Bacteria 16023
327 Ga0501033_0110448 3300049570 Bacteria 2001
328 Ga0501034_0000296 3300049571 Bacteria 88355
329 Ga0501034_0021493 3300049571 Bacteria 6578
330 Ga0501034_0048345 3300049571 Bacteria 4294
331 Ga0501034_0121289 3300049571 Bacteria 2601
332 Ga0501036_0000034 3300049572 Bacteria 88355
333 Ga0501036_0033458 3300049572 Bacteria 4348
334 Ga0501036_0054751 3300049572 Bacteria 3380
335 Ga0501037_0000079 3300049573 Bacteria 88355
336 Ga0501038_0000063 3300049574 Bacteria 88355
337 Ga0501038_0007128 3300049574 Bacteria 10330
338 Ga0501039_0000058 3300049575 Bacteria 88355
339 Ga0501040_0029124 3300049576 Bacteria 3726
340 Ga0501042_0043977 3300049578 Bacteria 3182
341 Ga0501043_0005868 3300049579 Bacteria 9881
342 Ga0501043_0011743 3300049579 Bacteria 6858
343 Ga0501047_0003776 3300049581 Bacteria 14257
344 Ga0501047_0024321 3300049581 Bacteria 5814
345 Ga0501047_0076378 3300049581 Bacteria 3224
346 Ga0501067_0009754 3300049583 Bacteria 5315
347 Ga0501070_0003899 3300049586 Bacteria 12868
348 Ga0501071_0017292 3300049587 Bacteria 4971
349 Ga0501072_0087524 3300049588 Bacteria 2472
350 Ga0501079_0106303 3300049741 Bacteria 2178
351 Ga0501081_0013967 3300049743 Bacteria 5288
352 Ga0501083_0057812 3300049744 Bacteria 2596
353 Ga0501035_0003071 3300049822 Bacteria 16023
354 Ga0501035_0005805 3300049822 Bacteria 11637
355 Ga0501044_0000084 3300049823 Bacteria 114544
356 Ga0501044_0000142 3300049823 Bacteria 88355
357 Ga0501044_0023271 3300049823 Bacteria 6591
358 Ga0501044_0112177 3300049823 Bacteria 2734
359 Ga0501045_0078847 3300049824 Bacteria 2428
360 Ga0501045_0089248 3300049824 Bacteria 2277
361 nmdc:mga03n38_41277_c1 3300050490 Bacteria 2010
362 nmdc:mga0k408_42657_c1 3300050493 Bacteria 2613
363 nmdc:mga06z11_12162_c1 3300050494 Bacteria 3735
364 nmdc:mga06z11_361_c1 3300050494 Bacteria 17160
365 nmdc:mga04h51_297_c1 3300050495 Bacteria 12708
366 Ga0495601_0001435 3300053077 Bacteria 13125
367 Ga0495601_0026159 3300053077 Bacteria 3601
368 Ga0495601_0034683 3300053077 Bacteria 3148
369 Ga0495612_0010450 3300053078 Bacteria 3754
370 Ga0495612_0012482 3300053078 Bacteria 3425
371 Ga0495595_0005338 3300053084 Bacteria 5198
372 Ga0495595_0063341 3300053084 Bacteria 1736
373 Ga0495619_0002010 3300053085 Bacteria 13525
374 Ga0495619_0015134 3300053085 Bacteria 4876
375 Ga0495619_0015135 3300053085 Bacteria 4876
376 Ga0500643_001002 3300053087 Bacteria 17293
377 Ga0500643_004476 3300053087 Bacteria 6311
378 Ga0500572_000625 3300053111 Bacteria 11822
379 Ga0500658_0050799 3300053134 Bacteria 1693
380 Ga0500568_0009691 3300053139 Bacteria 4561
381 Ga0500603_026127 3300053150 Bacteria 1474
382 Ga0500604_0000086 3300053151 Bacteria 31465
383 Ga0500616_0002916 3300053153 Bacteria 13659
384 Ga0500616_0022149 3300053153 Bacteria 3552
385 Ga0500616_0027563 3300053153 Bacteria 3135
386 Ga0500622_0003301 3300053156 Bacteria 10912
387 Ga0500636_0016866 3300053177 Bacteria 4306
388 Ga0501082_0014835 3300060353 Bacteria 6713
389 Ga0501082_0060759 3300060353 Bacteria 3253
390 Ga0530510_0018668 3300061734 Bacteria 4916

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0087524 Ga0501072_0087524_31_1353 425
2 3300049824 Ga0501045_0089248 Ga0501045_0089248_23_1345 425
3 3300053150 Ga0500603_026127 Ga0500603_026127_33_1355 425
4 3300026095 Ga0207676_10087281 Ga0207676_100872814 443
5 3300048907 Ga0496104_0165672 Ga0496104_0165672_13_1434 443
6 3300037466 Ga0395898_0014826 Ga0395898_0014826_17_1420 447
7 3300039450 Ga0436363_0023802 Ga0436363_0023802_33_1436 447
8 3300039453 Ga0436362_0305045 Ga0436362_0305045_11_1396 450
9 3300048919 Ga0496116_0130354 Ga0496116_0130354_49_1425 458
10 3300005548 Ga0070665_100000011 Ga0070665_100000011115 460
11 3300028379 Ga0268266_10000063 Ga0268266_10000063112 460
12 3300049586 Ga0501070_0003899 Ga0501070_0003899_5764_7278 460
13 3300053084 Ga0495595_0063341 Ga0495595_0063341_37_1494 464
14 3300006048 Ga0075363_100006496 Ga0075363_1000064963 465
15 3300006051 Ga0075364_10006651 Ga0075364_100066513 465
16 3300048911 Ga0496108_0035334 Ga0496108_0035334_2058_3686 466
17 3300048912 Ga0496109_0033414 Ga0496109_0033414_1122_2750 466
18 3300005544 Ga0070686_100001519 Ga0070686_1000015197 467
19 3300039437 Ga0436365_0564814 Ga0436365_0564814_8691_10181 467
20 3300053153 Ga0500616_0002916 Ga0500616_0002916_3204_4715 468
21 3300005539 Ga0068853_100042702 Ga0068853_1000427022 469
22 3300005547 Ga0070693_100078317 Ga0070693_1000783172 469
23 3300005548 Ga0070665_100001612 Ga0070665_10000161217 469
24 3300028379 Ga0268266_10000487 Ga0268266_1000048714 469
25 3300005354 Ga0070675_100021182 Ga0070675_1000211826 470
26 3300049571 Ga0501034_0021493 Ga0501034_0021493_608_2179 470
27 3300053151 Ga0500604_0000086 Ga0500604_0000086_17056_18564 472
28 3300009177 Ga0105248_10058346 Ga0105248_100583463 473
29 3300025941 Ga0207711_10011472 Ga0207711_100114723 473
30 3300048920 Ga0496117_0009968 Ga0496117_0009968_3860_5416 473
31 3300048921 Ga0496118_0005282 Ga0496118_0005282_6525_8081 473
32 3300048922 Ga0496119_0014111 Ga0496119_0014111_2936_4492 473
33 3300048924 Ga0496121_0000009 Ga0496121_0000009_381468_383024 473
34 3300053156 Ga0500622_0003301 Ga0500622_0003301_1797_3353 473
35 3300049568 Ga0501031_0000025 Ga0501031_0000025_74529_76085 474
36 3300049569 Ga0501032_0002015 Ga0501032_0002015_2201_3757 474
37 3300049570 Ga0501033_0002377 Ga0501033_0002377_2215_3771 474
38 3300049571 Ga0501034_0000296 Ga0501034_0000296_74547_76103 474
39 3300049572 Ga0501036_0000034 Ga0501036_0000034_74547_76103 474
40 3300049573 Ga0501037_0000079 Ga0501037_0000079_74547_76103 474
41 3300049574 Ga0501038_0000063 Ga0501038_0000063_12253_13809 474
42 3300049575 Ga0501039_0000058 Ga0501039_0000058_12253_13809 474
43 3300049579 Ga0501043_0011743 Ga0501043_0011743_877_2433 474
44 3300049581 Ga0501047_0003776 Ga0501047_0003776_2190_3746 474
45 3300049822 Ga0501035_0003071 Ga0501035_0003071_2215_3771 474
46 3300049823 Ga0501044_0000142 Ga0501044_0000142_74547_76103 474
47 3300060353 Ga0501082_0014835 Ga0501082_0014835_2355_3902 474
48 3300049571 Ga0501034_0048345 Ga0501034_0048345_1787_3343 477
49 3300005983 Ga0081540_1000114 Ga0081540_100011438 478
50 3300048916 Ga0496113_0058780 Ga0496113_0058780_977_2599 478
51 3300049572 Ga0501036_0054751 Ga0501036_0054751_366_1880 479
52 3300049824 Ga0501045_0078847 Ga0501045_0078847_816_2330 479
53 3300006847 Ga0075431_100148671 Ga0075431_1001486712 480
54 3300009094 Ga0111539_10025831 Ga0111539_100258314 480
55 3300009147 Ga0114129_10209648 Ga0114129_102096482 480
56 3300048907 Ga0496104_0000189 Ga0496104_0000189_41784_43406 481
57 3300048908 Ga0496105_0003335 Ga0496105_0003335_537_2159 481
58 3300048911 Ga0496108_0049451 Ga0496108_0049451_648_2270 481
59 3300048912 Ga0496109_0009042 Ga0496109_0009042_5440_7062 481
60 3300048913 Ga0496110_0000425 Ga0496110_0000425_11422_13044 481
61 3300048914 Ga0496111_0000217 Ga0496111_0000217_407_2029 481
62 3300048915 Ga0496112_0091751 Ga0496112_0091751_486_2108 481
63 3300028794 Ga0307515_10001840 Ga0307515_100018408 483
64 3300005439 Ga0070711_100074934 Ga0070711_1000749341 484
65 3300006175 Ga0070712_100011940 Ga0070712_1000119402 484
66 3300013306 Ga0163162_10154831 Ga0163162_101548312 484
67 3300013308 Ga0157375_10033244 Ga0157375_100332442 484
68 3300025909 Ga0207705_10064722 Ga0207705_100647222 484
69 3300025915 Ga0207693_10017987 Ga0207693_100179875 484
70 3300025916 Ga0207663_10022927 Ga0207663_100229272 484
71 3300035170 Ga0373943_0021339 Ga0373943_0021339_830_2389 484
72 3300035692 Ga0373935_0018766 Ga0373935_0018766_665_2224 484
73 3300035725 Ga0373947_0002058 Ga0373947_0002058_1036_2595 484
74 3300037068 Ga0373925_0014994 Ga0373925_0014994_2449_4008 484
75 3300046455 Ga0495603_0000198 Ga0495603_0000198_16807_18366 484
76 3300046459 Ga0495629_0000907 Ga0495629_0000907_19012_20571 484
77 3300046472 Ga0495580_0004406 Ga0495580_0004406_875_2434 484
78 3300046473 Ga0495582_0001026 Ga0495582_0001026_5213_6772 484
79 3300046475 Ga0495639_0008463 Ga0495639_0008463_1125_2684 484
80 3300046499 Ga0495594_0006841 Ga0495594_0006841_3291_4850 484
81 3300046557 Ga0495622_0000964 Ga0495622_0000964_940_2499 484
82 3300046642 Ga0495634_0003965 Ga0495634_0003965_2805_4364 484
83 3300046674 Ga0495588_0001473 Ga0495588_0001473_7760_9319 484
84 3300046683 Ga0495658_0009190 Ga0495658_0009190_1105_2664 484
85 3300046689 Ga0495613_0002597 Ga0495613_0002597_7347_8906 484
86 3300047315 Ga0495581_0011225 Ga0495581_0011225_1118_2677 484
87 3300047673 Ga0495593_0015143 Ga0495593_0015143_822_2381 484
88 3300048904 Ga0496101_0045229 Ga0496101_0045229_502_2058 484
89 3300048908 Ga0496105_0007034 Ga0496105_0007034_28_1584 484
90 3300048909 Ga0496106_0006359 Ga0496106_0006359_1858_3414 484
91 3300048910 Ga0496107_0010605 Ga0496107_0010605_970_2526 484
92 3300048911 Ga0496108_0171253 Ga0496108_0171253_56_1612 484
93 3300048915 Ga0496112_0057769 Ga0496112_0057769_1093_2652 484
94 3300048918 Ga0496115_0047636 Ga0496115_0047636_582_2138 484
95 3300048918 Ga0496115_0081112 Ga0496115_0081112_456_2012 484
96 3300049569 Ga0501032_0045415 Ga0501032_0045415_1325_2881 484
97 3300049570 Ga0501033_0110448 Ga0501033_0110448_53_1609 484
98 3300049579 Ga0501043_0005868 Ga0501043_0005868_7337_8893 484
99 3300049581 Ga0501047_0024321 Ga0501047_0024321_3407_4963 484
100 3300049822 Ga0501035_0005805 Ga0501035_0005805_5058_6614 484
101 3300049823 Ga0501044_0023271 Ga0501044_0023271_797_2353 484
102 3300053085 Ga0495619_0002010 Ga0495619_0002010_2985_4544 484
103 3300005843 Ga0068860_100022212 Ga0068860_1000222122 485
104 3300028381 Ga0268264_10011554 Ga0268264_100115547 485
105 3300035117 Ga0373953_0002986 Ga0373953_0002986_141_1694 486
106 3300035172 Ga0373955_0018293 Ga0373955_0018293_1593_3146 486
107 3300046517 Ga0495630_0096655 Ga0495630_0096655_103_1656 486
108 3300046675 Ga0495657_0058559 Ga0495657_0058559_637_2190 486
109 3300032004 Ga0307414_10018272 Ga0307414_100182724 487
110 3300005347 Ga0070668_100014799 Ga0070668_1000147992 488
111 3300005353 Ga0070669_100147197 Ga0070669_1001471972 488
112 3300005367 Ga0070667_100009677 Ga0070667_1000096776 488
113 3300005617 Ga0068859_100062134 Ga0068859_1000621344 488
114 3300005719 Ga0068861_100083039 Ga0068861_1000830392 488
115 3300005843 Ga0068860_100021988 Ga0068860_1000219882 488
116 3300005844 Ga0068862_100007061 Ga0068862_1000070619 488
117 3300006931 Ga0097620_100062132 Ga0097620_1000621322 488
118 3300025925 Ga0207650_10013443 Ga0207650_100134432 488
119 3300025972 Ga0207668_10011314 Ga0207668_100113145 488
120 3300026118 Ga0207675_100081813 Ga0207675_1000818132 488
121 3300028380 Ga0268265_10081205 Ga0268265_100812052 488
122 3300046522 Ga0495643_0002676 Ga0495643_0002676_2763_4313 488
123 iso_pu_bacteria 2513237141 2513891447 488
124 3300005577 Ga0068857_100012261 Ga0068857_1000122615 489
125 3300035691 Ga0373931_0055103 Ga0373931_0055103_396_1931 489
126 3300049574 Ga0501038_0007128 Ga0501038_0007128_2619_4103 489
127 iso_pu_bacteria 2909042592 2909046617 489
128 iso_pu_bacteria 2935630451 2935633822 489
129 iso_pu_bacteria 2941507105 2941510875 489
130 iso_pu_bacteria 2941515067 2941518259 489
131 iso_pu_bacteria 2941523033 2941526870 489
132 3300031995 Ga0307409_100080329 Ga0307409_1000803293 490
133 3300053087 Ga0500643_004476 Ga0500643_004476_4033_5505 490
134 iso_pu_bacteria 2508501128 2509147657 490
135 iso_pu_bacteria 2513237096 2513653853 490
136 iso_pu_bacteria 2513237137 2513856290 490
137 iso_pu_bacteria 2513237145 2513918193 490
138 iso_pu_bacteria 2524023228 2524538664 490
139 iso_pu_bacteria 2643221547 2643755739 490
140 iso_pu_bacteria 2667528175 2671118656 490
141 iso_pu_bacteria 2728368998 2728749338 490
142 iso_pu_bacteria 2791355197 2793066932 490
143 iso_pu_bacteria 2791355199 2793084224 490
144 iso_pu_bacteria 2837651117 2837653896 490
145 iso_pu_bacteria 2874604998 2874611060 490
146 iso_pu_bacteria 2876808645 2876814048 490
147 iso_pu_bacteria 2879110137 2879115588 490
148 iso_pu_bacteria 2885374607 2885381656 490
149 iso_pu_bacteria 2903748898 2903757148 490
150 iso_pu_bacteria 2904699407 2904704717 490
151 iso_pu_bacteria 2906610324 2906616742 490
152 iso_pu_bacteria 2906626472 2906632341 490
153 iso_pu_bacteria 2906635258 2906640176 490
154 iso_pu_bacteria 2906660503 2906667074 490
155 iso_pu_bacteria 2908739725 2908741918 490
156 iso_pu_bacteria 2922425934 2922431226 490
157 iso_pu_bacteria 3005474847 3005481013 490
158 iso_pu_bacteria 8001845381 8001846803 490
159 iso_pu_bacteria 8006933436 8006939692 490
160 iso_pu_bacteria 8006973647 8006979441 490
161 iso_pu_bacteria 8019555841 8019565584 490
162 iso_pu_bacteria 8019565922 8019575678 490
163 3300025272 Ga0209455_1002894 Ga0209455_10028945 492
164 3300031616 Ga0307508_10102001 Ga0307508_101020011 492
165 3300035111 Ga0373923_0005649 Ga0373923_0005649_1876_3426 492
166 3300035118 Ga0373954_0016099 Ga0373954_0016099_175_1725 492
167 3300035724 Ga0373933_0116762 Ga0373933_0116762_19_1569 492
168 3300037853 Ga0436364_0114650 Ga0436364_0114650_57_1598 492
169 3300046472 Ga0495580_0022608 Ga0495580_0022608_2056_3606 492
170 3300046477 Ga0495664_0014560 Ga0495664_0014560_1029_2579 492
171 3300046681 Ga0495647_0008590 Ga0495647_0008590_1333_2883 492
172 3300047673 Ga0495593_0004032 Ga0495593_0004032_19_1569 492
173 3300048924 Ga0496121_0031009 Ga0496121_0031009_2475_4016 492
174 3300048924 Ga0496121_0057009 Ga0496121_0057009_971_2512 492
175 3300053139 Ga0500568_0009691 Ga0500568_0009691_877_2433 492
176 iso_pu_bacteria 2524023250 2524612719 492
177 3300005577 Ga0068857_100138286 Ga0068857_1001382862 493
178 3300005983 Ga0081540_1019527 Ga0081540_10195273 493
179 3300009551 Ga0105238_10207579 Ga0105238_102075792 493
180 3300013105 Ga0157369_10008193 Ga0157369_100081936 493
181 3300021384 Ga0213876_10027402 Ga0213876_100274023 493
182 3300025933 Ga0207706_10133920 Ga0207706_101339201 493
183 3300026116 Ga0207674_10162026 Ga0207674_101620261 493
184 3300031251 Ga0265327_10001365 Ga0265327_100013658 493
185 3300031616 Ga0307508_10091923 Ga0307508_100919232 493
186 3300031711 Ga0265314_10044098 Ga0265314_100440982 493
187 3300031728 Ga0316578_10078845 Ga0316578_100788451 493
188 3300031733 Ga0316577_10080783 Ga0316577_100807832 493
189 3300032137 Ga0316585_10014194 Ga0316585_100141943 493
190 3300032168 Ga0316593_10001971 Ga0316593_100019713 493
191 3300035398 Ga0316574_0020272 Ga0316574_0020272_217_1773 493
192 3300035695 Ga0373927_0036629 Ga0373927_0036629_244_1797 493
193 3300037312 Ga0395899_0063292 Ga0395899_0063292_187_1746 493
194 3300037588 Ga0316581_0000346 Ga0316581_0000346_72_1628 493
195 3300038443 Ga0395901_0026492 Ga0395901_0026492_519_2072 493
196 3300039437 Ga0436365_1042606 Ga0436365_1042606_6584_8137 493
197 3300039447 Ga0436361_0121455 Ga0436361_0121455_138_1694 493
198 3300046454 Ga0495592_0012321 Ga0495592_0012321_1107_2660 493
199 3300046459 Ga0495629_0002029 Ga0495629_0002029_9064_10617 493
200 3300046460 Ga0495638_0006759 Ga0495638_0006759_1782_3338 493
201 3300046463 Ga0495653_0048844 Ga0495653_0048844_565_2118 493
202 3300046514 Ga0495618_0008774 Ga0495618_0008774_1212_2765 493
203 3300046559 Ga0495667_0018933 Ga0495667_0018933_59_1612 493
204 3300046678 Ga0495599_0072529 Ga0495599_0072529_349_1902 493
205 3300047317 Ga0495604_0006563 Ga0495604_0006563_1394_2947 493
206 3300048088 Ga0495602_0039574 Ga0495602_0039574_1215_2768 493
207 3300049571 Ga0501034_0121289 Ga0501034_0121289_831_2387 493
208 3300049744 Ga0501083_0057812 Ga0501083_0057812_306_1871 493
209 3300053077 Ga0495601_0001435 Ga0495601_0001435_3802_5355 493
210 3300053078 Ga0495612_0010450 Ga0495612_0010450_890_2443 493
211 3300053084 Ga0495595_0005338 Ga0495595_0005338_2566_4119 493
212 3300053085 Ga0495619_0015134 Ga0495619_0015134_212_1765 493
213 3300053153 Ga0500616_0027563 Ga0500616_0027563_828_2381 493
214 3300003215 JGI25153J46596_10005767 JGI25153J46596_100057676 494
215 3300005331 Ga0070670_100081880 Ga0070670_1000818802 494
216 3300005336 Ga0070680_100062242 Ga0070680_1000622422 494
217 3300005338 Ga0068868_100041351 Ga0068868_1000413512 494
218 3300005347 Ga0070668_100185233 Ga0070668_1001852331 494
219 3300005364 Ga0070673_100025867 Ga0070673_1000258672 494
220 3300005365 Ga0070688_100086015 Ga0070688_1000860152 494
221 3300005436 Ga0070713_100165047 Ga0070713_1001650471 494
222 3300005439 Ga0070711_100025096 Ga0070711_1000250962 494
223 3300005455 Ga0070663_100034961 Ga0070663_1000349613 494
224 3300005458 Ga0070681_10009165 Ga0070681_100091654 494
225 3300005459 Ga0068867_100012648 Ga0068867_1000126484 494
226 3300005719 Ga0068861_100008632 Ga0068861_1000086323 494
227 3300005841 Ga0068863_100105241 Ga0068863_1001052412 494
228 3300005843 Ga0068860_100000429 Ga0068860_10000042939 494
229 3300005937 Ga0081455_10001223 Ga0081455_1000122312 494
230 3300005983 Ga0081540_1006968 Ga0081540_10069683 494
231 3300005983 Ga0081540_1009314 Ga0081540_10093142 494
232 3300005983 Ga0081540_1012667 Ga0081540_10126671 494
233 3300005985 Ga0081539_10000824 Ga0081539_1000082451 494
234 3300006028 Ga0070717_10000402 Ga0070717_1000040210 494
235 3300006028 Ga0070717_10043138 Ga0070717_100431382 494
236 3300006028 Ga0070717_10091547 Ga0070717_100915472 494
237 3300006042 Ga0075368_10004426 Ga0075368_100044264 494
238 3300006048 Ga0075363_100017482 Ga0075363_1000174822 494
239 3300006048 Ga0075363_100077311 Ga0075363_1000773112 494
240 3300006178 Ga0075367_10004569 Ga0075367_100045695 494
241 3300006178 Ga0075367_10012738 Ga0075367_100127382 494
242 3300006178 Ga0075367_10098764 Ga0075367_100987642 494
243 3300006844 Ga0075428_100006220 Ga0075428_1000062209 494
244 3300006942 Ga0099824_1010736 Ga0099824_10107362 494
245 3300006943 Ga0099822_1001873 Ga0099822_10018735 494
246 3300009098 Ga0105245_10094969 Ga0105245_100949692 494
247 3300009101 Ga0105247_10039051 Ga0105247_100390512 494
248 3300009545 Ga0105237_10130645 Ga0105237_101306452 494
249 3300009551 Ga0105238_10083087 Ga0105238_100830873 494
250 3300009553 Ga0105249_10006652 Ga0105249_100066522 494
251 3300010375 Ga0105239_10193472 Ga0105239_101934722 494
252 3300013308 Ga0157375_10055765 Ga0157375_100557652 494
253 3300017792 Ga0163161_10049391 Ga0163161_100493912 494
254 3300021384 Ga0213876_10003117 Ga0213876_100031174 494
255 3300025254 Ga0209148_1005310 Ga0209148_10053102 494
256 3300025272 Ga0209455_1008301 Ga0209455_10083011 494
257 3300025297 Ga0209758_1001959 Ga0209758_100195912 494
258 3300025912 Ga0207707_10000404 Ga0207707_100004046 494
259 3300025924 Ga0207694_10024032 Ga0207694_100240322 494
260 3300025925 Ga0207650_10054101 Ga0207650_100541012 494
261 3300025927 Ga0207687_10013063 Ga0207687_100130634 494
262 3300025928 Ga0207700_10213801 Ga0207700_102138011 494
263 3300025929 Ga0207664_10027721 Ga0207664_100277214 494
264 3300025942 Ga0207689_10072170 Ga0207689_100721702 494
265 3300025945 Ga0207679_10054988 Ga0207679_100549882 494
266 3300025960 Ga0207651_10022254 Ga0207651_100222542 494
267 3300025972 Ga0207668_10021291 Ga0207668_100212913 494
268 3300026023 Ga0207677_10058843 Ga0207677_100588432 494
269 3300026035 Ga0207703_10060810 Ga0207703_100608103 494
270 3300026067 Ga0207678_10007944 Ga0207678_100079448 494
271 3300026088 Ga0207641_10063006 Ga0207641_100630062 494
272 3300026116 Ga0207674_10111629 Ga0207674_101116292 494
273 3300026118 Ga0207675_100015746 Ga0207675_1000157463 494
274 3300026118 Ga0207675_100062997 Ga0207675_1000629973 494
275 3300026118 Ga0207675_100079803 Ga0207675_1000798033 494
276 3300027357 Ga0209589_1000001 Ga0209589_1000001712 494
277 3300027361 Ga0209489_100001 Ga0209489_100001712 494
278 3300027363 Ga0209700_100001 Ga0209700_100001712 494
279 3300027866 Ga0209813_10000325 Ga0209813_100003252 494
280 3300027866 Ga0209813_10001069 Ga0209813_100010694 494
281 3300028379 Ga0268266_10125633 Ga0268266_101256332 494
282 3300028381 Ga0268264_10000048 Ga0268264_10000048238 494
283 3300028556 Ga0265337_1014325 Ga0265337_10143252 494
284 3300028800 Ga0265338_10000034 Ga0265338_1000003426 494
285 3300028800 Ga0265338_10012491 Ga0265338_1001249111 494
286 3300029957 Ga0265324_10008520 Ga0265324_100085203 494
287 3300031238 Ga0265332_10001463 Ga0265332_100014635 494
288 3300031238 Ga0265332_10020911 Ga0265332_100209112 494
289 3300031247 Ga0265340_10001613 Ga0265340_100016135 494
290 3300031249 Ga0265339_10049199 Ga0265339_100491992 494
291 3300031507 Ga0307509_10004515 Ga0307509_100045158 494
292 3300031616 Ga0307508_10000003 Ga0307508_10000003210 494
293 3300031616 Ga0307508_10126578 Ga0307508_101265782 494
294 3300031711 Ga0265314_10003438 Ga0265314_100034388 494
295 3300031711 Ga0265314_10006795 Ga0265314_100067952 494
296 3300031711 Ga0265314_10008040 Ga0265314_100080406 494
297 3300031711 Ga0265314_10055608 Ga0265314_100556083 494
298 3300031712 Ga0265342_10000039 Ga0265342_1000003934 494
299 3300031712 Ga0265342_10007997 Ga0265342_100079972 494
300 3300031730 Ga0307516_10010023 Ga0307516_100100235 494
301 3300033179 Ga0307507_10057433 Ga0307507_100574332 494
302 3300033442 Ga0315911_1000002 Ga0315911_1000002373 494
303 3300035410 Ga0373924_0013160 Ga0373924_0013160_1375_2928 494
304 3300037418 Ga0395900_0062919 Ga0395900_0062919_505_2061 494
305 3300037466 Ga0395898_0037505 Ga0395898_0037505_263_1819 494
306 3300037471 Ga0395905_0001489 Ga0395905_0001489_19168_20724 494
307 3300037471 Ga0395905_0003242 Ga0395905_0003242_14929_16485 494
308 3300037853 Ga0436364_0722576 Ga0436364_0722576_514_2070 494
309 3300039437 Ga0436365_1128219 Ga0436365_1128219_29518_31074 494
310 3300046459 Ga0495629_0056731 Ga0495629_0056731_931_2484 494
311 3300046460 Ga0495638_0023696 Ga0495638_0023696_1175_2731 494
312 3300046460 Ga0495638_0024159 Ga0495638_0024159_423_1979 494
313 3300046477 Ga0495664_0018042 Ga0495664_0018042_1728_3284 494
314 3300046543 Ga0495645_0013656 Ga0495645_0013656_1974_3530 494
315 3300046689 Ga0495613_0000680 Ga0495613_0000680_10815_12398 494
316 3300048904 Ga0496101_0011628 Ga0496101_0011628_1973_3535 494
317 3300048909 Ga0496106_0032793 Ga0496106_0032793_1458_3020 494
318 3300048910 Ga0496107_0025317 Ga0496107_0025317_1298_2857 494
319 3300048912 Ga0496109_0048842 Ga0496109_0048842_1584_3140 494
320 3300048912 Ga0496109_0107457 Ga0496109_0107457_613_2166 494
321 3300048913 Ga0496110_0083899 Ga0496110_0083899_103_1659 494
322 3300048914 Ga0496111_0039349 Ga0496111_0039349_624_2180 494
323 3300048915 Ga0496112_0083173 Ga0496112_0083173_966_2519 494
324 3300048916 Ga0496113_0030562 Ga0496113_0030562_1912_3468 494
325 3300048918 Ga0496115_0044445 Ga0496115_0044445_395_1957 494
326 3300048924 Ga0496121_0073592 Ga0496121_0073592_254_1810 494
327 3300048928 Ga0496125_0079091 Ga0496125_0079091_178_1734 494
328 3300048929 Ga0496126_0003285 Ga0496126_0003285_9670_11226 494
329 3300048929 Ga0496126_0083973 Ga0496126_0083973_150_1706 494
330 3300048929 Ga0496126_0095442 Ga0496126_0095442_724_2280 494
331 3300049568 Ga0501031_0058570 Ga0501031_0058570_118_1677 494
332 3300049572 Ga0501036_0033458 Ga0501036_0033458_446_2005 494
333 3300049576 Ga0501040_0029124 Ga0501040_0029124_2042_3601 494
334 3300049578 Ga0501042_0043977 Ga0501042_0043977_641_2200 494
335 3300049581 Ga0501047_0076378 Ga0501047_0076378_1603_3159 494
336 3300049583 Ga0501067_0009754 Ga0501067_0009754_479_2035 494
337 3300049587 Ga0501071_0017292 Ga0501071_0017292_2257_3816 494
338 3300049741 Ga0501079_0106303 Ga0501079_0106303_32_1591 494
339 3300049743 Ga0501081_0013967 Ga0501081_0013967_80_1639 494
340 3300049823 Ga0501044_0000084 Ga0501044_0000084_86651_88207 494
341 3300049823 Ga0501044_0112177 Ga0501044_0112177_611_2170 494
342 3300050490 nmdc:mga03n38_41277_c1 nmdc:mga03n38_41277_c1_228_1853 494
343 3300050493 nmdc:mga0k408_42657_c1 nmdc:mga0k408_42657_c1_33_1589 494
344 3300050494 nmdc:mga06z11_12162_c1 nmdc:mga06z11_12162_c1_551_2110 494
345 3300050494 nmdc:mga06z11_361_c1 nmdc:mga06z11_361_c1_1845_3470 494
346 3300050495 nmdc:mga04h51_297_c1 nmdc:mga04h51_297_c1_1517_3142 494
347 3300053077 Ga0495601_0026159 Ga0495601_0026159_1053_2609 494
348 3300053077 Ga0495601_0034683 Ga0495601_0034683_419_1978 494
349 3300053078 Ga0495612_0012482 Ga0495612_0012482_1634_3190 494
350 3300053085 Ga0495619_0015135 Ga0495619_0015135_1756_3315 494
351 3300053111 Ga0500572_000625 Ga0500572_000625_6573_8132 494
352 3300053134 Ga0500658_0050799 Ga0500658_0050799_102_1658 494
353 3300053177 Ga0500636_0016866 Ga0500636_0016866_873_2429 494
354 3300060353 Ga0501082_0060759 Ga0501082_0060759_1161_2720 494
355 3300061734 Ga0530510_0018668 Ga0530510_0018668_1590_3149 494
356 iso_pu_bacteria 8016583857 8016593911 494
357 3300053153 Ga0500616_0022149 Ga0500616_0022149_725_2302 495
358 iso_pu_bacteria 3000865235 3000867154 506
359 3300031548 Ga0307408_100128428 Ga0307408_1001284282 510
360 3300031731 Ga0307405_10124427 Ga0307405_101244272 510
361 3300032002 Ga0307416_100089297 Ga0307416_1000892973 512
362 3300053087 Ga0500643_001002 Ga0500643_001002_11200_12741 512
363 3300048925 Ga0496122_0000529 Ga0496122_0000529_63702_65255 513
364 3300048926 Ga0496123_0000210 Ga0496123_0000210_74201_75754 513
365 3300001976 JGI24752J21851_1000801 JGI24752J21851_10008012 516
366 3300001979 JGI24740J21852_10010758 JGI24740J21852_100107583 516
367 3300001989 JGI24739J22299_10017889 JGI24739J22299_100178892 516
368 3300001989 JGI24739J22299_10024173 JGI24739J22299_100241731 516
369 3300002067 JGI24735J21928_10003412 JGI24735J21928_100034124 516
370 3300002075 JGI24738J21930_10002207 JGI24738J21930_100022072 516
371 3300002239 JGI24034J26672_10000028 JGI24034J26672_1000002855 516
372 3300005330 Ga0070690_100000003 Ga0070690_10000000384 516
373 3300005331 Ga0070670_100184127 Ga0070670_1001841271 516
374 3300005335 Ga0070666_10000006 Ga0070666_1000000649 516
375 3300005339 Ga0070660_100072572 Ga0070660_1000725722 516
376 3300005344 Ga0070661_100021261 Ga0070661_1000212612 516
377 3300005353 Ga0070669_100000014 Ga0070669_100000014167 516
378 3300005365 Ga0070688_100001679 Ga0070688_1000016792 516
379 3300005366 Ga0070659_100108606 Ga0070659_1001086061 516
380 3300005367 Ga0070667_100009949 Ga0070667_1000099495 516
381 3300005457 Ga0070662_100110401 Ga0070662_1001104012 516
382 3300005466 Ga0070685_10000072 Ga0070685_1000007238 516
383 3300005544 Ga0070686_100000022 Ga0070686_10000002280 516
384 3300005548 Ga0070665_100000019 Ga0070665_100000019338 516
385 3300005577 Ga0068857_100144186 Ga0068857_1001441862 516
386 3300005614 Ga0068856_100234745 Ga0068856_1002347452 516
387 3300005841 Ga0068863_100000048 Ga0068863_10000004872 516
388 3300005843 Ga0068860_100000014 Ga0068860_10000001449 516
389 3300005844 Ga0068862_100000595 Ga0068862_10000059512 516
390 3300009093 Ga0105240_10191076 Ga0105240_101910763 516
391 3300009174 Ga0105241_10188148 Ga0105241_101881482 516
392 3300009545 Ga0105237_10136040 Ga0105237_101360402 516
393 3300009551 Ga0105238_10176814 Ga0105238_101768142 516
394 3300009553 Ga0105249_10000104 Ga0105249_1000010470 516
395 3300013105 Ga0157369_10018521 Ga0157369_100185215 516
396 3300013306 Ga0163162_10113340 Ga0163162_101133402 516
397 3300014325 Ga0163163_10079456 Ga0163163_100794563 516
398 3300014326 Ga0157380_10023281 Ga0157380_100232812 516
399 3300017792 Ga0163161_10000020 Ga0163161_1000002068 516
400 3300025321 Ga0207656_10005204 Ga0207656_100052042 516
401 3300025903 Ga0207680_10000011 Ga0207680_1000001148 516
402 3300025904 Ga0207647_10004010 Ga0207647_100040107 516
403 3300025909 Ga0207705_10031436 Ga0207705_100314362 516
404 3300025911 Ga0207654_10023730 Ga0207654_100237303 516
405 3300025913 Ga0207695_10013657 Ga0207695_100136574 516
406 3300025914 Ga0207671_10001056 Ga0207671_100010568 516
407 3300025919 Ga0207657_10016479 Ga0207657_100164792 516
408 3300025923 Ga0207681_10000045 Ga0207681_1000004572 516
409 3300025924 Ga0207694_10004027 Ga0207694_100040276 516
410 3300025932 Ga0207690_10101016 Ga0207690_101010162 516
411 3300025933 Ga0207706_10161228 Ga0207706_101612281 516
412 3300025941 Ga0207711_10021860 Ga0207711_100218601 516
413 3300025949 Ga0207667_10003961 Ga0207667_100039613 516
414 3300025961 Ga0207712_10000013 Ga0207712_1000001348 516
415 3300025986 Ga0207658_10004086 Ga0207658_100040865 516
416 3300026035 Ga0207703_10018727 Ga0207703_100187272 516
417 3300026041 Ga0207639_10076193 Ga0207639_100761932 516
418 3300026078 Ga0207702_10012833 Ga0207702_100128333 516
419 3300026088 Ga0207641_10000143 Ga0207641_1000014370 516
420 3300026095 Ga0207676_10013322 Ga0207676_100133224 516
421 3300026116 Ga0207674_10166969 Ga0207674_101669692 516
422 3300026118 Ga0207675_100011915 Ga0207675_1000119152 516
423 3300028379 Ga0268266_10000025 Ga0268266_10000025165 516
424 3300028380 Ga0268265_10000954 Ga0268265_1000095421 516
425 3300028381 Ga0268264_10000037 Ga0268264_1000003748 516
426 3300048904 Ga0496101_0148016 Ga0496101_0148016_63_1613 516
427 3300048906 Ga0496103_0002059 Ga0496103_0002059_6480_8030 516
428 3300048920 Ga0496117_0014289 Ga0496117_0014289_3176_4726 516

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

167

339

0.97

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

449

533

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tg9-assembly1.cif.gz_B cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.9259 4 506
6tg9-assembly1.cif.gz_B cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.9204 4 506
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.9137 1 509
7t30-assembly1.cif.gz_G structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/nad(h) bound state 0.9132 88 510
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.9068 1 509
ID Description Score Start End Superfamily
af_P31979_241_332_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9401 308 397 3.10.20.600
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9389 307 400 3.10.20.600
af_P9WIV7_242_335_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9201 307 400 3.10.20.600
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9113 402 506 1.20.1440.230
af_P31979_241_332_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9112 308 397 3.10.20.600
ID Description Score Start End GO Terms
AF-A0A6J6TBN4-F1-model_v4 Unannotated protein 0.9761 295 506 GO:0008137
GO:0010181
GO:0046872
GO:0051539
AF-A0A257G442-F1-model_v4 Formate dehydrogenase 0.9759 2 186 GO:0046872
GO:0051539
AF-A0A257G442-F1-model_v4 Formate dehydrogenase 0.9706 2 186 GO:0046872
GO:0051539
AF-A0A351CY51-F1-model_v4 NADH-quinone oxidoreductase subunit F (NADH dehydrogenase I subunit F) (NDH-1 subunit F) 0.9661 271 506 GO:0008137
GO:0010181
GO:0046872
GO:0051539
AF-A0A553WJT4-F1-model_v4 Formate dehydrogenase 0.9641 5 506 GO:0008137
GO:0010181
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
84.95 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map