F441649

General Info

Members Datasets Scaffolds Average Seq Length
428 230 428 329

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100017727|Ga0075430_1000177276
Length 345
Sequence VTDRFLRACRLEPVDATPVWFMRQAGRYMSDYRALRERYSLLEICRHPDLAVAVTLQPVDVIEVDAAILFSDLLLPFTPLGLEFDFVKGEGPSVENPIRSAADVDRLRRFEPRDELAHVIETIHILRTELTGRVPLIGFGGAPFTLAAYAIEGGPSTTYARTKTFMYAHPRAWHRLCEDYMRAQIEAGAQAIQIFDSWAGSLSRSDYREFAYPHTRAIFDRLADAGVPLIHFGVGTTAILPDLAAAGGDVIGVDWRLPLDEAWGRIGHDRGIQGNLDPTLLLGPADRVFSAAHEVLRTANGRPGHVFNLGHGVLPATPLERVQELARYVHRTSARPVDAGAPLGR

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 6.07
Rhizosphere 90.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_2782814 2162886011 Bacteria 1650
2 JGI24751J29686_10004094 3300002459 Bacteria 2954
3 Ga0065712_10080398 3300005290 Bacteria 3107
4 Ga0065712_10082128 3300005290 Bacteria 2946
5 Ga0065715_10002603 3300005293 Bacteria 4629
6 Ga0065715_10019668 3300005293 Bacteria 2669
7 Ga0065715_10127086 3300005293 Bacteria 2095
8 Ga0065707_10119652 3300005295 Bacteria 2154
9 Ga0065707_10226284 3300005295 Bacteria 1205
10 Ga0070676_10037313 3300005328 Bacteria 2802
11 Ga0070683_100011332 3300005329 Bacteria 7703
12 Ga0070683_100048998 3300005329 Bacteria 3906
13 Ga0070690_100016427 3300005330 Bacteria 4434
14 Ga0070670_100006131 3300005331 Bacteria 10167
15 Ga0070670_100017684 3300005331 Bacteria 6116
16 Ga0070670_100069025 3300005331 Bacteria 3034
17 Ga0070670_100251413 3300005331 Bacteria 1540
18 Ga0068869_100006316 3300005334 Bacteria 7503
19 Ga0070666_10014454 3300005335 Bacteria 5026
20 Ga0070666_10231665 3300005335 Bacteria 1305
21 Ga0070680_100047016 3300005336 Bacteria 3513
22 Ga0070660_100284580 3300005339 Bacteria 1353
23 Ga0070689_100012244 3300005340 Bacteria 6172
24 Ga0070691_10021813 3300005341 Bacteria 2966
25 Ga0070687_100047971 3300005343 Bacteria 2194
26 Ga0070661_100129984 3300005344 Bacteria 1891
27 Ga0070692_10041738 3300005345 Bacteria 2352
28 Ga0070669_100003679 3300005353 Bacteria 11063
29 Ga0070669_100206277 3300005353 Bacteria 1549
30 Ga0070675_100004928 3300005354 Bacteria 10178
31 Ga0070675_100117888 3300005354 Bacteria 2253
32 Ga0070671_100011793 3300005355 Bacteria 7031
33 Ga0070671_100018521 3300005355 Bacteria 5657
34 Ga0070674_100011399 3300005356 Bacteria 5413
35 Ga0070674_100031663 3300005356 Bacteria 3506
36 Ga0070673_100004033 3300005364 Bacteria 9246
37 Ga0070673_100036395 3300005364 Bacteria 3741
38 Ga0070659_100163113 3300005366 Bacteria 1823
39 Ga0070713_100151946 3300005436 Bacteria 2060
40 Ga0070711_100268977 3300005439 Bacteria 1344
41 Ga0070700_100029773 3300005441 Bacteria 3257
42 Ga0070681_10011426 3300005458 Bacteria 8790
43 Ga0068867_100008307 3300005459 Bacteria 7329
44 Ga0070679_100122824 3300005530 Bacteria 2580
45 Ga0070679_100438563 3300005530 Bacteria 1251
46 Ga0070684_100063056 3300005535 Bacteria 3248
47 Ga0070672_100019602 3300005543 Bacteria 4912
48 Ga0070686_100001249 3300005544 Bacteria 14442
49 Ga0070693_100005285 3300005547 Bacteria 6187
50 Ga0070665_100007922 3300005548 Bacteria 10770
51 Ga0070665_100012476 3300005548 Bacteria 8564
52 Ga0070665_100066304 3300005548 Bacteria 3622
53 Ga0070665_100538835 3300005548 Bacteria 1179
54 Ga0070664_100000163 3300005564 Bacteria 45912
55 Ga0070664_100041475 3300005564 Bacteria 3884
56 Ga0068857_100010905 3300005577 Bacteria 7910
57 Ga0068857_100015109 3300005577 Bacteria 6739
58 Ga0068854_100080885 3300005578 Bacteria 2398
59 Ga0068852_100045249 3300005616 Bacteria 3743
60 Ga0068864_100008563 3300005618 Bacteria 8442
61 Ga0068866_10003380 3300005718 Bacteria 6545
62 Ga0068861_100067241 3300005719 Bacteria 2765
63 Ga0068861_100217320 3300005719 Bacteria 1613
64 Ga0068863_100174089 3300005841 Bacteria 2065
65 Ga0068858_100012005 3300005842 Bacteria 8166
66 Ga0068858_100018512 3300005842 Bacteria 6520
67 Ga0068860_100146411 3300005843 Bacteria 2273
68 Ga0068862_100040480 3300005844 Bacteria 3961
69 Ga0070717_10355112 3300006028 Bacteria 1311
70 Ga0075365_10029970 3300006038 Bacteria 3481
71 Ga0075368_10005104 3300006042 Bacteria 4496
72 Ga0075368_10014910 3300006042 Bacteria 2877
73 Ga0075364_10014158 3300006051 Bacteria 4923
74 Ga0075364_10027912 3300006051 Bacteria 3609
75 Ga0070716_100073686 3300006173 Bacteria 2015
76 Ga0075362_10006433 3300006177 Bacteria 4379
77 Ga0075367_10056358 3300006178 Bacteria 2334
78 Ga0075366_10006971 3300006195 Bacteria 6222
79 Ga0075366_10021123 3300006195 Bacteria 3785
80 Ga0097621_100025619 3300006237 Bacteria 4616
81 Ga0068871_100002793 3300006358 Bacteria 11934
82 Ga0075428_100000865 3300006844 Bacteria 31862
83 Ga0075428_100015779 3300006844 Bacteria 8366
84 Ga0075428_100018567 3300006844 Bacteria 7687
85 Ga0075430_100017727 3300006846 Bacteria 6061
86 Ga0075430_100018331 3300006846 Bacteria 5958
87 Ga0075430_100061891 3300006846 Bacteria 3144
88 Ga0075430_100083775 3300006846 Bacteria 2671
89 Ga0075431_100010327 3300006847 Bacteria 9381
90 Ga0075431_100026582 3300006847 Bacteria 5938
91 Ga0075433_10004871 3300006852 Bacteria 10500
92 Ga0075433_10027110 3300006852 Bacteria 4857
93 Ga0075433_10083393 3300006852 Bacteria 2821
94 Ga0075433_10176549 3300006852 Bacteria 1901
95 Ga0075433_10230380 3300006852 Bacteria 1645
96 Ga0075434_100003115 3300006871 Bacteria 14769
97 Ga0075434_100030631 3300006871 Bacteria 5300
98 Ga0075434_100113581 3300006871 Bacteria 2720
99 Ga0075434_100147871 3300006871 Bacteria 2370
100 Ga0075429_100003645 3300006880 Bacteria 13117
101 Ga0075429_100103847 3300006880 Bacteria 2482
102 Ga0075429_100114323 3300006880 Bacteria 2359
103 Ga0068865_100004678 3300006881 Bacteria 8267
104 Ga0075435_100006656 3300007076 Bacteria 8190
105 Ga0075435_100013180 3300007076 Bacteria 6143
106 Ga0075435_100054796 3300007076 Bacteria 3219
107 Ga0075435_100059349 3300007076 Bacteria 3101
108 Ga0105240_10007971 3300009093 Bacteria 15273
109 Ga0105240_10231775 3300009093 Bacteria 2145
110 Ga0105240_10491360 3300009093 Bacteria 1366
111 Ga0111539_10003820 3300009094 Bacteria 19828
112 Ga0111539_10010872 3300009094 Bacteria 11455
113 Ga0111539_10116951 3300009094 Unclassified 3126
114 Ga0111539_10133435 3300009094 Bacteria 2907
115 Ga0111539_10259112 3300009094 Bacteria 2025
116 Ga0111539_10312790 3300009094 Bacteria 1828
117 Ga0105245_10020467 3300009098 Bacteria 5802
118 Ga0105245_10136225 3300009098 Bacteria 2308
119 Ga0105247_10020269 3300009101 Bacteria 3998
120 Ga0105247_10061636 3300009101 Bacteria 2326
121 Ga0114129_10000076 3300009147 Bacteria 90985
122 Ga0114129_10000973 3300009147 Bacteria 37498
123 Ga0114129_10001069 3300009147 Bacteria 36016
124 Ga0114129_10017015 3300009147 Bacteria 10352
125 Ga0114129_10032236 3300009147 Bacteria 7406
126 Ga0114129_10039413 3300009147 Bacteria 6660
127 Ga0114129_10047615 3300009147 Bacteria 6024
128 Ga0114129_10788467 3300009147 Bacteria 1213
129 Ga0105241_10039422 3300009174 Bacteria 3563
130 Ga0105241_10058203 3300009174 Bacteria 2967
131 Ga0105242_10007403 3300009176 Bacteria 8452
132 Ga0105242_10019556 3300009176 Bacteria 5308
133 Ga0105242_10067044 3300009176 Bacteria 2966
134 Ga0105248_10048515 3300009177 Bacteria 4763
135 Ga0105248_10058376 3300009177 Bacteria 4334
136 Ga0105248_10107154 3300009177 Bacteria 3151
137 Ga0105248_10540828 3300009177 Bacteria 1314
138 Ga0105248_10639817 3300009177 Bacteria 1200
139 Ga0105248_10722663 3300009177 Bacteria 1124
140 Ga0105249_10000796 3300009553 Bacteria 28325
141 Ga0105249_10341407 3300009553 Bacteria 1514
142 Ga0105249_10395811 3300009553 Bacteria 1411
143 Ga0105249_10444965 3300009553 Bacteria 1334
144 Ga0105239_10088428 3300010375 Bacteria 3416
145 Ga0157374_10043351 3300013296 Bacteria 4156
146 Ga0157378_10133295 3300013297 Bacteria 2302
147 Ga0157372_10080668 3300013307 Bacteria 3682
148 Ga0157372_10305951 3300013307 Bacteria 1849
149 Ga0157375_10849072 3300013308 Bacteria 1060
150 Ga0163163_10011542 3300014325 Bacteria 8023
151 Ga0163163_10063826 3300014325 Bacteria 3654
152 Ga0163163_10374113 3300014325 Bacteria 1482
153 Ga0157380_10023556 3300014326 Bacteria 4645
154 Ga0157380_10115114 3300014326 Bacteria 2267
155 Ga0157379_10011356 3300014968 Bacteria 7767
156 Ga0157379_10019175 3300014968 Bacteria 6039
157 Ga0157379_10115860 3300014968 Bacteria 2409
158 Ga0157376_10012899 3300014969 Bacteria 6218
159 Ga0157376_10029487 3300014969 Bacteria 4370
160 Ga0157376_10085986 3300014969 Bacteria 2711
161 Ga0157376_10224652 3300014969 Bacteria 1741
162 Ga0207697_10031722 3300025315 Bacteria 2161
163 Ga0207682_10025605 3300025893 Bacteria 2340
164 Ga0207642_10005530 3300025899 Bacteria 4128
165 Ga0207710_10009810 3300025900 Bacteria 4024
166 Ga0207688_10012350 3300025901 Bacteria 4647
167 Ga0207688_10060450 3300025901 Bacteria 2134
168 Ga0207680_10087401 3300025903 Bacteria 1974
169 Ga0207680_10117267 3300025903 Bacteria 1736
170 Ga0207645_10062601 3300025907 Bacteria 2377
171 Ga0207654_10043032 3300025911 Bacteria 2558
172 Ga0207695_10104626 3300025913 Bacteria 2819
173 Ga0207662_10001397 3300025918 Bacteria 11669
174 Ga0207649_10101284 3300025920 Bacteria 1907
175 Ga0207652_10190745 3300025921 Bacteria 1843
176 Ga0207681_10024833 3300025923 Bacteria 3848
177 Ga0207650_10009789 3300025925 Bacteria 6552
178 Ga0207650_10016918 3300025925 Bacteria 5100
179 Ga0207650_10050350 3300025925 Bacteria 3080
180 Ga0207650_10120689 3300025925 Bacteria 2041
181 Ga0207650_10210499 3300025925 Bacteria 1561
182 Ga0207659_10000637 3300025926 Bacteria 20834
183 Ga0207659_10133145 3300025926 Bacteria 1921
184 Ga0207687_10108704 3300025927 Bacteria 2054
185 Ga0207644_10090993 3300025931 Bacteria 2274
186 Ga0207690_10160025 3300025932 Bacteria 1678
187 Ga0207706_10163082 3300025933 Bacteria 1959
188 Ga0207686_10013332 3300025934 Bacteria 4546
189 Ga0207686_10062164 3300025934 Bacteria 2370
190 Ga0207670_10034094 3300025936 Bacteria 3286
191 Ga0207669_10067752 3300025937 Bacteria 2226
192 Ga0207691_10014887 3300025940 Bacteria 7411
193 Ga0207711_10016817 3300025941 Bacteria 6075
194 Ga0207711_10502449 3300025941 Bacteria 1130
195 Ga0207689_10018657 3300025942 Bacteria 5852
196 Ga0207689_10023982 3300025942 Bacteria 5118
197 Ga0207661_10032033 3300025944 Bacteria 4069
198 Ga0207679_10011000 3300025945 Bacteria 5840
199 Ga0207651_10037343 3300025960 Bacteria 3181
200 Ga0207651_10059348 3300025960 Bacteria 2650
201 Ga0207640_10158573 3300025981 Bacteria 1671
202 Ga0207658_10147003 3300025986 Bacteria 1916
203 Ga0207703_10036045 3300026035 Bacteria 3934
204 Ga0207703_10352103 3300026035 Bacteria 1356
205 Ga0207708_10114552 3300026075 Bacteria 2096
206 Ga0207641_10219824 3300026088 Bacteria 1761
207 Ga0207648_10076494 3300026089 Bacteria 2918
208 Ga0207648_10105001 3300026089 Bacteria 2478
209 Ga0207648_10116998 3300026089 Bacteria 2343
210 Ga0207648_10400018 3300026089 Bacteria 1244
211 Ga0207676_10038195 3300026095 Bacteria 3662
212 Ga0207674_10017271 3300026116 Bacteria 7872
213 Ga0207674_10067564 3300026116 Bacteria 3599
214 Ga0207674_10138960 3300026116 Bacteria 2390
215 Ga0207675_100042523 3300026118 Bacteria 4243
216 Ga0207675_100056439 3300026118 Bacteria 3663
217 Ga0207675_100173170 3300026118 Bacteria 2064
218 Ga0207683_10061290 3300026121 Bacteria 3310
219 Ga0207683_10093241 3300026121 Bacteria 2683
220 Ga0207683_10205889 3300026121 Bacteria 1789
221 Ga0207428_10000797 3300027907 Bacteria 35667
222 Ga0207428_10092274 3300027907 Bacteria 2350
223 Ga0207428_10098459 3300027907 Bacteria 2263
224 Ga0268266_10027582 3300028379 Bacteria 4828
225 Ga0268266_10037300 3300028379 Bacteria 4141
226 Ga0268266_10114017 3300028379 Bacteria 2398
227 Ga0268265_10030826 3300028380 Bacteria 3867
228 Ga0268265_10147174 3300028380 Bacteria 1981
229 Ga0268265_10379624 3300028380 Bacteria 1300
230 Ga0268264_10041771 3300028381 Bacteria 3794
231 Ga0268264_10049807 3300028381 Bacteria 3487
232 Ga0307408_100015554 3300031548 Bacteria 5066
233 Ga0307408_100024932 3300031548 Bacteria 4090
234 Ga0265314_10111206 3300031711 Bacteria 1741
235 Ga0307410_10305995 3300031852 Bacteria 1256
236 Ga0307412_10134368 3300031911 Bacteria 1802
237 Ga0307409_100136873 3300031995 Bacteria 2103
238 Ga0307416_100021319 3300032002 Bacteria 4649
239 Ga0307416_100024132 3300032002 Bacteria 4431
240 Ga0307416_100067581 3300032002 Bacteria 2949
241 Ga0307416_100141303 3300032002 Bacteria 2189
242 Ga0307416_100264039 3300032002 Bacteria 1685
243 Ga0307416_100375120 3300032002 Bacteria 1450
244 Ga0307416_100632207 3300032002 Bacteria 1153
245 Ga0307411_10031183 3300032005 Bacteria 3276
246 Ga0307415_100078248 3300032126 Bacteria 2352
247 Ga0307415_100358740 3300032126 Bacteria 1230
248 Ga0373930_0011115 3300034816 Bacteria 1621
249 Ga0373948_0002304 3300034817 Bacteria 2801
250 Ga0373958_0005545 3300034819 Bacteria 1923
251 Ga0373938_0010258 3300034957 Bacteria 1717
252 Ga0373928_0000667 3300035084 Bacteria 6748
253 Ga0373929_0001181 3300035085 Bacteria 5044
254 Ga0373940_0023457 3300035088 Bacteria 1592
255 Ga0373949_0001022 3300035090 Bacteria 8629
256 Ga0373951_0000437 3300035091 Bacteria 12172
257 Ga0373952_0001181 3300035092 Bacteria 4766
258 Ga0373932_0000260 3300035112 Bacteria 16071
259 Ga0373939_0002507 3300035114 Bacteria 4326
260 Ga0373939_0013054 3300035114 Bacteria 2130
261 Ga0373941_0001741 3300035115 Bacteria 4674
262 Ga0373941_0035857 3300035115 Bacteria 1505
263 Ga0373953_0126301 3300035117 Bacteria 1089
264 Ga0373960_0005132 3300035121 Bacteria 3020
265 Ga0373946_0094790 3300035171 Bacteria 1329
266 Ga0373942_0002033 3300035207 Bacteria 5023
267 Ga0373961_0000739 3300035241 Bacteria 11301
268 Ga0373924_0032754 3300035410 Bacteria 2095
269 Ga0373931_0000499 3300035691 Bacteria 16005
270 Ga0373931_0206031 3300035691 Bacteria 1177
271 Ga0373935_0069255 3300035692 Bacteria 2272
272 Ga0373927_0305458 3300035695 Bacteria 1047
273 Ga0373933_0127409 3300035724 Bacteria 1598
274 Ga0373947_0018033 3300035725 Bacteria 4062
275 Ga0373937_0069370 3300036401 Bacteria 3250
276 Ga0373925_0143985 3300037068 Bacteria 1867
277 Ga0373925_0166252 3300037068 Bacteria 1740
278 Ga0373925_0530467 3300037068 Bacteria 967
279 Ga0439453_0017157 3300041408 Bacteria 1269
280 Ga0439431_0000960 3300041997 Bacteria 6263
281 Ga0439433_0005747 3300041999 Bacteria 2667
282 Ga0439450_055852 3300042008 Bacteria 946
283 Ga0439464_0004592 3300042439 Bacteria 3539
284 Ga0451576_0027797 3300045051 Bacteria 6070
285 Ga0451576_0042753 3300045051 Bacteria 4784
286 Ga0495592_0119274 3300046454 Bacteria 1858
287 Ga0495603_0075621 3300046455 Bacteria 1977
288 Ga0495662_0146094 3300046476 Bacteria 1164
289 Ga0495662_0179591 3300046476 Bacteria 1043
290 Ga0495608_0035613 3300046511 Bacteria 3356
291 Ga0495598_0054545 3300046537 Bacteria 1214
292 Ga0495645_0045725 3300046543 Bacteria 3194
293 Ga0495599_0200548 3300046678 Bacteria 1226
294 Ga0495658_0010929 3300046683 Bacteria 4550
295 Ga0495600_0120288 3300046809 Bacteria 1708
296 Ga0495604_0282999 3300047317 Unclassified 1120
297 Ga0495674_0085903 3300047319 Bacteria 2695
298 Ga0496101_0168099 3300048904 Bacteria 1684
299 Ga0496102_0017629 3300048905 Bacteria 6258
300 Ga0496102_0048879 3300048905 Bacteria 3847
301 Ga0496104_0005267 3300048907 Bacteria 11305
302 Ga0496104_0169254 3300048907 Bacteria 2095
303 Ga0496104_0270835 3300048907 Bacteria 1611
304 Ga0496104_0532387 3300048907 Bacteria 1086
305 Ga0496108_0002719 3300048911 Bacteria 14136
306 Ga0496108_0044265 3300048911 Bacteria 3717
307 Ga0496108_0103897 3300048911 Bacteria 2424
308 Ga0496109_0000824 3300048912 Bacteria 25874
309 Ga0496109_0058002 3300048912 Bacteria 3536
310 Ga0496109_0163182 3300048912 Bacteria 2088
311 Ga0496110_0000173 3300048913 Bacteria 39810
312 Ga0496110_0079952 3300048913 Bacteria 2912
313 Ga0496110_0104833 3300048913 Bacteria 2537
314 Ga0496111_0112616 3300048914 Bacteria 2004
315 Ga0496112_0002440 3300048915 Bacteria 14986
316 Ga0496112_0020556 3300048915 Bacteria 6259
317 Ga0496112_0092195 3300048915 Bacteria 2999
318 Ga0496112_0337204 3300048915 Bacteria 1451
319 Ga0496113_0197884 3300048916 Bacteria 1597
320 Ga0496113_0203871 3300048916 Bacteria 1573
321 Ga0496114_0090483 3300048917 Bacteria 2598
322 Ga0496114_0142369 3300048917 Bacteria 2077
323 Ga0496115_0148018 3300048918 Bacteria 1938
324 Ga0501299_009981 3300049522 Bacteria 1577
325 Ga0501034_0206714 3300049571 Bacteria 1919
326 Ga0501036_0024197 3300049572 Bacteria 5119
327 Ga0501036_0157054 3300049572 Bacteria 1918
328 Ga0501038_0069731 3300049574 Bacteria 2986
329 Ga0501038_0076961 3300049574 Bacteria 2818
330 Ga0501039_0103043 3300049575 Bacteria 2228
331 Ga0501039_0428948 3300049575 Unclassified 1038
332 Ga0501040_0015889 3300049576 Bacteria 4976
333 Ga0501040_0057741 3300049576 Bacteria 2665
334 Ga0501040_0313076 3300049576 Unclassified 1122
335 Ga0501041_0165389 3300049577 Unclassified 1383
336 Ga0501042_0146095 3300049578 Bacteria 1705
337 Ga0501042_0200374 3300049578 Bacteria 1439
338 Ga0501042_0299312 3300049578 Bacteria 1162
339 Ga0501043_0034695 3300049579 Bacteria 3968
340 Ga0501046_0009901 3300049580 Bacteria 8212
341 Ga0501046_0119049 3300049580 Bacteria 2011
342 Ga0501048_0017593 3300049582 Bacteria 5263
343 Ga0501048_0028806 3300049582 Bacteria 4031
344 Ga0501048_0116800 3300049582 Bacteria 1885
345 Ga0501048_0270664 3300049582 Bacteria 1207
346 Ga0501067_0033115 3300049583 Bacteria 2868
347 Ga0501068_0028922 3300049584 Unclassified 3280
348 Ga0501071_0046330 3300049587 Bacteria 3123
349 Ga0501071_0065675 3300049587 Bacteria 2635
350 Ga0501071_0221086 3300049587 Bacteria 1425
351 Ga0501071_0353649 3300049587 Bacteria 1118
352 Ga0501072_0011382 3300049588 Bacteria 6799
353 Ga0501072_0102127 3300049588 Bacteria 2279
354 Ga0501073_0267671 3300049589 Bacteria 1179
355 Ga0501075_0046976 3300049591 Bacteria 3244
356 Ga0501075_0047634 3300049591 Bacteria 3221
357 Ga0501075_0215193 3300049591 Bacteria 1465
358 Ga0501076_0009434 3300049592 Bacteria 7207
359 Ga0501076_0068140 3300049592 Bacteria 2842
360 Ga0501077_0154043 3300049593 Bacteria 1458
361 Ga0501233_035014 3300049668 Bacteria 1155
362 Ga0501079_0026203 3300049741 Bacteria 4469
363 Ga0501079_0468917 3300049741 Bacteria 989
364 Ga0501080_0195389 3300049742 Bacteria 1858
365 Ga0501080_0255038 3300049742 Bacteria 1599
366 Ga0501080_0422652 3300049742 Bacteria 1197
367 Ga0501081_0001723 3300049743 Bacteria 13581
368 Ga0501035_0052943 3300049822 Bacteria 3631
369 Ga0501044_0403730 3300049823 Bacteria 1279
370 Ga0501045_0026100 3300049824 Bacteria 4200
371 Ga0501045_0063197 3300049824 Bacteria 2716
372 Ga0501045_0214527 3300049824 Bacteria 1433
373 nmdc:mga03683_2319_c1 3300050489 Bacteria 5887
374 nmdc:mga00v17_61150_c1 3300050491 Bacteria 2315
375 nmdc:mga0k408_3217_c2 3300050493 Bacteria 5879
376 nmdc:mga0k408_8796_c1 3300050493 Bacteria 5433
377 nmdc:mga04h51_84397_c1 3300050495 Bacteria 1133
378 nmdc:mga07m45_44387_c1 3300050496 Bacteria 2495
379 nmdc:mga05p37_1014_c1 3300050507 Bacteria 31952
380 nmdc:mga05p37_281750_c1 3300050507 Bacteria 1982
381 nmdc:mga05p37_33124_c1 3300050507 Bacteria 6328
382 nmdc:mga05p37_343270_c1 3300050507 Bacteria 1760
383 nmdc:mga05p37_368807_c1 3300050507 Bacteria 1686
384 nmdc:mga05p37_4374_c2 3300050507 Bacteria 15031
385 nmdc:mga05p37_609295_c1 3300050507 Bacteria 1231
386 nmdc:mga05p37_85235_c1 3300050507 Bacteria 3893
387 nmdc:mga05p37_91_c1 3300050507 Bacteria 80826
388 nmdc:mga09592_22030_c1 3300050508 Bacteria 5257
389 nmdc:mga09592_52715_c1 3300050508 Bacteria 3433
390 nmdc:mga0qj67_113593_c1 3300050509 Bacteria 2187
391 nmdc:mga0qj67_4199_c1 3300050509 Bacteria 10434
392 nmdc:mga0qj67_68537_c1 3300050509 Bacteria 2828
393 nmdc:mga0qj67_9679_c1 3300050509 Bacteria 7179
394 nmdc:mga06r32_18050_c1 3300050510 Bacteria 6451
395 nmdc:mga06r32_244059_c1 3300050510 Bacteria 1783
396 nmdc:mga08y16_106612_c1 3300050511 Bacteria 2917
397 nmdc:mga08y16_130087_c1 3300050511 Unclassified 2618
398 nmdc:mga08y16_152115_c1 3300050511 Bacteria 2405
399 nmdc:mga08y16_387_c1 3300050511 Bacteria 40294
400 nmdc:mga08y16_531864_c1 3300050511 Bacteria 1191
401 nmdc:mga08y16_63128_c1 3300050511 Unclassified 3868
402 nmdc:mga0n895_148750_c1 3300050512 Bacteria 2371
403 nmdc:mga0n895_188078_c1 3300050512 Bacteria 2096
404 nmdc:mga0n895_27791_c1 3300050512 Bacteria 5377
405 nmdc:mga0n895_287836_c1 3300050512 Bacteria 1666
406 nmdc:mga0n895_439147_c1 3300050512 Unclassified 1318
407 nmdc:mga0rr50_23442_c1 3300050513 Bacteria 4257
408 nmdc:mga0rr50_26985_c1 3300050513 Bacteria 4016
409 nmdc:mga0rr50_45182_c1 3300050513 Bacteria 3235
410 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
411 nmdc:mga08x19_108049_c1 3300050514 Bacteria 1853
412 nmdc:mga0a205_14495_c1 3300050515 Bacteria 7354
413 nmdc:mga0a205_347853_c1 3300050515 Bacteria 1350
414 nmdc:mga0a205_5863_c1 3300050515 Bacteria 11064
415 nmdc:mga0a205_73015_c1 3300050515 Bacteria 3315
416 nmdc:mga0a205_8826_c1 3300050515 Bacteria 9180
417 nmdc:mga0a205_95890_c1 3300050515 Bacteria 2865
418 nmdc:mga0a205_95960_c1 3300050515 Bacteria 2864
419 Ga0495619_0019689 3300053085 Bacteria 4293
420 Ga0495619_0038074 3300053085 Bacteria 3136
421 Ga0495619_0076630 3300053085 Bacteria 2245
422 Ga0495619_0291524 3300053085 Bacteria 1130
423 Ga0501084_0081458 3300054114 Bacteria 2715
424 Ga0501084_0137664 3300054114 Bacteria 2055
425 Ga0501082_0243801 3300060353 Bacteria 1564
426 Ga0501082_0344075 3300060353 Bacteria 1299
427 Ga0501082_0350426 3300060353 Bacteria 1287
428 Ga0530510_0252080 3300061734 Unclassified 1315

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042008 Ga0439450_055852 Ga0439450_055852_16_900 277
2 3300035695 Ga0373927_0305458 Ga0373927_0305458_12_875 287
3 3300037068 Ga0373925_0530467 Ga0373925_0530467_52_915 287
4 3300047317 Ga0495604_0282999 Ga0495604_0282999_234_1097 287
5 3300049741 Ga0501079_0468917 Ga0501079_0468917_20_901 287
6 3300053085 Ga0495619_0291524 Ga0495619_0291524_253_1119 287
7 3300049587 Ga0501071_0221086 Ga0501071_0221086_34_960 301
8 3300006844 Ga0075428_100000865 Ga0075428_1000008657 307
9 3300009094 Ga0111539_10003820 Ga0111539_100038202 307
10 3300009147 Ga0114129_10000076 Ga0114129_1000007634 307
11 3300050507 nmdc:mga05p37_91_c1 nmdc:mga05p37_91_c1_66921_67895 307
12 3300050508 nmdc:mga09592_22030_c1 nmdc:mga09592_22030_c1_2829_3803 307
13 3300050509 nmdc:mga0qj67_68537_c1 nmdc:mga0qj67_68537_c1_187_1161 307
14 3300050511 nmdc:mga08y16_387_c1 nmdc:mga08y16_387_c1_29674_30648 307
15 3300046476 Ga0495662_0179591 Ga0495662_0179591_101_1030 308
16 3300009094 Ga0111539_10133435 Ga0111539_101334352 310
17 3300027907 Ga0207428_10098459 Ga0207428_100984593 310
18 3300050511 nmdc:mga08y16_106612_c1 nmdc:mga08y16_106612_c1_1315_2373 310
19 3300005331 Ga0070670_100069025 Ga0070670_1000690251 312
20 3300025925 Ga0207650_10210499 Ga0207650_102104992 312
21 3300041408 Ga0439453_0017157 Ga0439453_0017157_271_1215 313
22 3300002459 JGI24751J29686_10004094 JGI24751J29686_100040942 314
23 3300005436 Ga0070713_100151946 Ga0070713_1001519462 314
24 3300005548 Ga0070665_100012476 Ga0070665_1000124761 314
25 3300005548 Ga0070665_100538835 Ga0070665_1005388351 314
26 3300005842 Ga0068858_100012005 Ga0068858_1000120054 314
27 3300006173 Ga0070716_100073686 Ga0070716_1000736863 314
28 3300006237 Ga0097621_100025619 Ga0097621_1000256192 314
29 3300006358 Ga0068871_100002793 Ga0068871_1000027937 314
30 3300006846 Ga0075430_100017727 Ga0075430_1000177276 314
31 3300006847 Ga0075431_100010327 Ga0075431_1000103273 314
32 3300006852 Ga0075433_10004871 Ga0075433_100048718 314
33 3300006880 Ga0075429_100003645 Ga0075429_1000036457 314
34 3300006881 Ga0068865_100004678 Ga0068865_1000046789 314
35 3300009098 Ga0105245_10136225 Ga0105245_101362253 314
36 3300009147 Ga0114129_10000973 Ga0114129_1000097324 314
37 3300009176 Ga0105242_10019556 Ga0105242_100195565 314
38 3300009177 Ga0105248_10722663 Ga0105248_107226631 314
39 3300009553 Ga0105249_10395811 Ga0105249_103958112 314
40 3300014325 Ga0163163_10374113 Ga0163163_103741131 314
41 3300014969 Ga0157376_10085986 Ga0157376_100859864 314
42 3300014969 Ga0157376_10224652 Ga0157376_102246522 314
43 3300026035 Ga0207703_10036045 Ga0207703_100360455 314
44 3300026035 Ga0207703_10352103 Ga0207703_103521032 314
45 3300026089 Ga0207648_10076494 Ga0207648_100764942 314
46 3300027907 Ga0207428_10000797 Ga0207428_100007973 314
47 3300028381 Ga0268264_10049807 Ga0268264_100498073 314
48 3300031548 Ga0307408_100015554 Ga0307408_1000155546 314
49 3300031548 Ga0307408_100024932 Ga0307408_1000249323 314
50 3300032002 Ga0307416_100021319 Ga0307416_1000213193 314
51 3300032005 Ga0307411_10031183 Ga0307411_100311832 314
52 3300032126 Ga0307415_100358740 Ga0307415_1003587401 314
53 3300035410 Ga0373924_0032754 Ga0373924_0032754_628_1572 314
54 3300036401 Ga0373937_0069370 Ga0373937_0069370_1188_2132 314
55 3300042439 Ga0439464_0004592 Ga0439464_0004592_666_1640 314
56 3300046543 Ga0495645_0045725 Ga0495645_0045725_22_966 314
57 3300046683 Ga0495658_0010929 Ga0495658_0010929_1883_2827 314
58 3300046809 Ga0495600_0120288 Ga0495600_0120288_370_1314 314
59 3300047319 Ga0495674_0085903 Ga0495674_0085903_1011_1955 314
60 3300048907 Ga0496104_0532387 Ga0496104_0532387_109_1053 314
61 3300048915 Ga0496112_0092195 Ga0496112_0092195_423_1367 314
62 3300048916 Ga0496113_0203871 Ga0496113_0203871_77_1021 314
63 3300048917 Ga0496114_0090483 Ga0496114_0090483_1629_2579 314
64 3300049522 Ga0501299_009981 Ga0501299_009981_74_1081 314
65 3300049572 Ga0501036_0024197 Ga0501036_0024197_3963_4907 314
66 3300049574 Ga0501038_0076961 Ga0501038_0076961_1332_2276 314
67 3300049575 Ga0501039_0428948 Ga0501039_0428948_70_1014 314
68 3300049576 Ga0501040_0313076 Ga0501040_0313076_162_1106 314
69 3300049577 Ga0501041_0165389 Ga0501041_0165389_208_1152 314
70 3300049578 Ga0501042_0200374 Ga0501042_0200374_233_1177 314
71 3300049579 Ga0501043_0034695 Ga0501043_0034695_2277_3221 314
72 3300049580 Ga0501046_0009901 Ga0501046_0009901_110_1054 314
73 3300049582 Ga0501048_0028806 Ga0501048_0028806_748_1692 314
74 3300049584 Ga0501068_0028922 Ga0501068_0028922_368_1312 314
75 3300049587 Ga0501071_0065675 Ga0501071_0065675_1555_2499 314
76 3300049588 Ga0501072_0102127 Ga0501072_0102127_166_1110 314
77 3300049591 Ga0501075_0215193 Ga0501075_0215193_187_1131 314
78 3300049592 Ga0501076_0009434 Ga0501076_0009434_768_1712 314
79 3300049593 Ga0501077_0154043 Ga0501077_0154043_102_1046 314
80 3300049741 Ga0501079_0026203 Ga0501079_0026203_179_1123 314
81 3300049742 Ga0501080_0255038 Ga0501080_0255038_237_1181 314
82 3300049743 Ga0501081_0001723 Ga0501081_0001723_11631_12575 314
83 3300049822 Ga0501035_0052943 Ga0501035_0052943_2351_3295 314
84 3300049824 Ga0501045_0214527 Ga0501045_0214527_179_1123 314
85 3300054114 Ga0501084_0137664 Ga0501084_0137664_887_1831 314
86 3300060353 Ga0501082_0344075 Ga0501082_0344075_136_1080 314
87 3300061734 Ga0530510_0252080 Ga0530510_0252080_236_1180 314
88 3300035171 Ga0373946_0094790 Ga0373946_0094790_267_1226 319
89 3300048915 Ga0496112_0337204 Ga0496112_0337204_179_1138 319
90 3300005290 Ga0065712_10080398 Ga0065712_100803983 320
91 3300005293 Ga0065715_10002603 Ga0065715_100026032 320
92 3300005293 Ga0065715_10127086 Ga0065715_101270861 320
93 3300005295 Ga0065707_10119652 Ga0065707_101196523 320
94 3300005329 Ga0070683_100011332 Ga0070683_1000113326 320
95 3300005329 Ga0070683_100048998 Ga0070683_1000489984 320
96 3300005344 Ga0070661_100129984 Ga0070661_1001299842 320
97 3300005353 Ga0070669_100003679 Ga0070669_10000367910 320
98 3300005355 Ga0070671_100018521 Ga0070671_1000185212 320
99 3300005535 Ga0070684_100063056 Ga0070684_1000630562 320
100 3300005547 Ga0070693_100005285 Ga0070693_1000052856 320
101 3300005564 Ga0070664_100000163 Ga0070664_10000016317 320
102 3300005577 Ga0068857_100015109 Ga0068857_1000151095 320
103 3300005844 Ga0068862_100040480 Ga0068862_1000404802 320
104 3300006038 Ga0075365_10029970 Ga0075365_100299703 320
105 3300006042 Ga0075368_10014910 Ga0075368_100149102 320
106 3300006051 Ga0075364_10014158 Ga0075364_100141584 320
107 3300006051 Ga0075364_10027912 Ga0075364_100279122 320
108 3300006177 Ga0075362_10006433 Ga0075362_100064334 320
109 3300006195 Ga0075366_10006971 Ga0075366_100069717 320
110 3300006844 Ga0075428_100015779 Ga0075428_1000157795 320
111 3300006847 Ga0075431_100026582 Ga0075431_1000265825 320
112 3300006852 Ga0075433_10083393 Ga0075433_100833932 320
113 3300006871 Ga0075434_100147871 Ga0075434_1001478712 320
114 3300006880 Ga0075429_100103847 Ga0075429_1001038474 320
115 3300007076 Ga0075435_100054796 Ga0075435_1000547962 320
116 3300009094 Ga0111539_10010872 Ga0111539_100108722 320
117 3300009094 Ga0111539_10116951 Ga0111539_101169511 320
118 3300009094 Ga0111539_10259112 Ga0111539_102591123 320
119 3300009094 Ga0111539_10312790 Ga0111539_103127902 320
120 3300009147 Ga0114129_10047615 Ga0114129_100476155 320
121 3300009553 Ga0105249_10000796 Ga0105249_100007969 320
122 3300009553 Ga0105249_10341407 Ga0105249_103414072 320
123 3300014325 Ga0163163_10011542 Ga0163163_100115423 320
124 3300025315 Ga0207697_10031722 Ga0207697_100317222 320
125 3300025920 Ga0207649_10101284 Ga0207649_101012842 320
126 3300025923 Ga0207681_10024833 Ga0207681_100248332 320
127 3300025925 Ga0207650_10050350 Ga0207650_100503503 320
128 3300025931 Ga0207644_10090993 Ga0207644_100909932 320
129 3300025944 Ga0207661_10032033 Ga0207661_100320332 320
130 3300025945 Ga0207679_10011000 Ga0207679_100110004 320
131 3300027907 Ga0207428_10092274 Ga0207428_100922742 320
132 3300028380 Ga0268265_10030826 Ga0268265_100308264 320
133 3300048907 Ga0496104_0005267 Ga0496104_0005267_3694_4656 320
134 3300048911 Ga0496108_0002719 Ga0496108_0002719_9555_10517 320
135 3300048912 Ga0496109_0000824 Ga0496109_0000824_17968_18930 320
136 3300048913 Ga0496110_0000173 Ga0496110_0000173_36429_37391 320
137 3300048915 Ga0496112_0002440 Ga0496112_0002440_1024_1986 320
138 3300049824 Ga0501045_0026100 Ga0501045_0026100_2815_3840 320
139 3300050489 nmdc:mga03683_2319_c1 nmdc:mga03683_2319_c1_4841_5866 320
140 3300050491 nmdc:mga00v17_61150_c1 nmdc:mga00v17_61150_c1_805_1830 320
141 3300050493 nmdc:mga0k408_3217_c2 nmdc:mga0k408_3217_c2_889_1914 320
142 3300050493 nmdc:mga0k408_8796_c1 nmdc:mga0k408_8796_c1_3412_4437 320
143 3300050495 nmdc:mga04h51_84397_c1 nmdc:mga04h51_84397_c1_30_992 320
144 3300050496 nmdc:mga07m45_44387_c1 nmdc:mga07m45_44387_c1_1131_2156 320
145 3300050507 nmdc:mga05p37_281750_c1 nmdc:mga05p37_281750_c1_945_1907 320
146 3300050510 nmdc:mga06r32_18050_c1 nmdc:mga06r32_18050_c1_2262_3287 320
147 3300050511 nmdc:mga08y16_130087_c1 nmdc:mga08y16_130087_c1_1406_2431 320
148 3300050511 nmdc:mga08y16_531864_c1 nmdc:mga08y16_531864_c1_83_1045 320
149 3300050511 nmdc:mga08y16_63128_c1 nmdc:mga08y16_63128_c1_1173_2198 320
150 3300050512 nmdc:mga0n895_148750_c1 nmdc:mga0n895_148750_c1_497_1522 320
151 3300050512 nmdc:mga0n895_188078_c1 nmdc:mga0n895_188078_c1_1115_2077 320
152 3300050512 nmdc:mga0n895_439147_c1 nmdc:mga0n895_439147_c1_256_1281 320
153 3300050513 nmdc:mga0rr50_45182_c1 nmdc:mga0rr50_45182_c1_2023_3048 320
154 3300050515 nmdc:mga0a205_5863_c1 nmdc:mga0a205_5863_c1_5408_6433 320
155 3300050515 nmdc:mga0a205_95960_c1 nmdc:mga0a205_95960_c1_542_1567 320
156 2162886011 MRS1b_contig_2782814 MRS1b_0626.00000900 321
157 3300005290 Ga0065712_10082128 Ga0065712_100821282 321
158 3300005293 Ga0065715_10019668 Ga0065715_100196682 321
159 3300005295 Ga0065707_10226284 Ga0065707_102262841 321
160 3300005328 Ga0070676_10037313 Ga0070676_100373133 321
161 3300005330 Ga0070690_100016427 Ga0070690_1000164275 321
162 3300005331 Ga0070670_100006131 Ga0070670_1000061316 321
163 3300005331 Ga0070670_100017684 Ga0070670_1000176843 321
164 3300005331 Ga0070670_100251413 Ga0070670_1002514131 321
165 3300005334 Ga0068869_100006316 Ga0068869_1000063165 321
166 3300005335 Ga0070666_10014454 Ga0070666_100144542 321
167 3300005335 Ga0070666_10231665 Ga0070666_102316651 321
168 3300005336 Ga0070680_100047016 Ga0070680_1000470164 321
169 3300005339 Ga0070660_100284580 Ga0070660_1002845802 321
170 3300005340 Ga0070689_100012244 Ga0070689_1000122446 321
171 3300005341 Ga0070691_10021813 Ga0070691_100218134 321
172 3300005343 Ga0070687_100047971 Ga0070687_1000479711 321
173 3300005345 Ga0070692_10041738 Ga0070692_100417383 321
174 3300005353 Ga0070669_100206277 Ga0070669_1002062771 321
175 3300005354 Ga0070675_100004928 Ga0070675_10000492811 321
176 3300005354 Ga0070675_100117888 Ga0070675_1001178882 321
177 3300005355 Ga0070671_100011793 Ga0070671_1000117936 321
178 3300005356 Ga0070674_100011399 Ga0070674_1000113995 321
179 3300005356 Ga0070674_100031663 Ga0070674_1000316633 321
180 3300005364 Ga0070673_100004033 Ga0070673_1000040336 321
181 3300005364 Ga0070673_100036395 Ga0070673_1000363953 321
182 3300005366 Ga0070659_100163113 Ga0070659_1001631133 321
183 3300005439 Ga0070711_100268977 Ga0070711_1002689771 321
184 3300005441 Ga0070700_100029773 Ga0070700_1000297731 321
185 3300005458 Ga0070681_10011426 Ga0070681_100114264 321
186 3300005459 Ga0068867_100008307 Ga0068867_1000083076 321
187 3300005530 Ga0070679_100122824 Ga0070679_1001228243 321
188 3300005530 Ga0070679_100438563 Ga0070679_1004385632 321
189 3300005543 Ga0070672_100019602 Ga0070672_1000196025 321
190 3300005544 Ga0070686_100001249 Ga0070686_10000124913 321
191 3300005548 Ga0070665_100007922 Ga0070665_1000079229 321
192 3300005548 Ga0070665_100066304 Ga0070665_1000663043 321
193 3300005564 Ga0070664_100041475 Ga0070664_1000414753 321
194 3300005577 Ga0068857_100010905 Ga0068857_1000109055 321
195 3300005578 Ga0068854_100080885 Ga0068854_1000808853 321
196 3300005616 Ga0068852_100045249 Ga0068852_1000452493 321
197 3300005618 Ga0068864_100008563 Ga0068864_1000085634 321
198 3300005718 Ga0068866_10003380 Ga0068866_100033804 321
199 3300005719 Ga0068861_100067241 Ga0068861_1000672414 321
200 3300005719 Ga0068861_100217320 Ga0068861_1002173202 321
201 3300005841 Ga0068863_100174089 Ga0068863_1001740892 321
202 3300005842 Ga0068858_100018512 Ga0068858_1000185123 321
203 3300005843 Ga0068860_100146411 Ga0068860_1001464111 321
204 3300006028 Ga0070717_10355112 Ga0070717_103551122 321
205 3300006042 Ga0075368_10005104 Ga0075368_100051043 321
206 3300006178 Ga0075367_10056358 Ga0075367_100563582 321
207 3300006195 Ga0075366_10021123 Ga0075366_100211232 321
208 3300006844 Ga0075428_100018567 Ga0075428_1000185674 321
209 3300006846 Ga0075430_100018331 Ga0075430_1000183313 321
210 3300006846 Ga0075430_100061891 Ga0075430_1000618912 321
211 3300006846 Ga0075430_100083775 Ga0075430_1000837752 321
212 3300006852 Ga0075433_10027110 Ga0075433_100271105 321
213 3300006852 Ga0075433_10176549 Ga0075433_101765492 321
214 3300006852 Ga0075433_10230380 Ga0075433_102303802 321
215 3300006871 Ga0075434_100003115 Ga0075434_10000311512 321
216 3300006871 Ga0075434_100030631 Ga0075434_1000306316 321
217 3300006871 Ga0075434_100113581 Ga0075434_1001135812 321
218 3300006880 Ga0075429_100114323 Ga0075429_1001143232 321
219 3300007076 Ga0075435_100006656 Ga0075435_1000066568 321
220 3300007076 Ga0075435_100013180 Ga0075435_1000131803 321
221 3300007076 Ga0075435_100059349 Ga0075435_1000593492 321
222 3300009093 Ga0105240_10007971 Ga0105240_100079718 321
223 3300009093 Ga0105240_10231775 Ga0105240_102317752 321
224 3300009093 Ga0105240_10491360 Ga0105240_104913602 321
225 3300009098 Ga0105245_10020467 Ga0105245_100204677 321
226 3300009101 Ga0105247_10020269 Ga0105247_100202693 321
227 3300009101 Ga0105247_10061636 Ga0105247_100616362 321
228 3300009147 Ga0114129_10001069 Ga0114129_1000106933 321
229 3300009147 Ga0114129_10017015 Ga0114129_100170158 321
230 3300009147 Ga0114129_10032236 Ga0114129_100322367 321
231 3300009147 Ga0114129_10039413 Ga0114129_100394136 321
232 3300009147 Ga0114129_10788467 Ga0114129_107884672 321
233 3300009174 Ga0105241_10039422 Ga0105241_100394221 321
234 3300009174 Ga0105241_10058203 Ga0105241_100582032 321
235 3300009176 Ga0105242_10007403 Ga0105242_100074032 321
236 3300009176 Ga0105242_10067044 Ga0105242_100670443 321
237 3300009177 Ga0105248_10048515 Ga0105248_100485151 321
238 3300009177 Ga0105248_10058376 Ga0105248_100583765 321
239 3300009177 Ga0105248_10107154 Ga0105248_101071544 321
240 3300009177 Ga0105248_10540828 Ga0105248_105408281 321
241 3300009177 Ga0105248_10639817 Ga0105248_106398171 321
242 3300009553 Ga0105249_10444965 Ga0105249_104449652 321
243 3300010375 Ga0105239_10088428 Ga0105239_100884282 321
244 3300013296 Ga0157374_10043351 Ga0157374_100433511 321
245 3300013297 Ga0157378_10133295 Ga0157378_101332952 321
246 3300013307 Ga0157372_10080668 Ga0157372_100806685 321
247 3300013307 Ga0157372_10305951 Ga0157372_103059512 321
248 3300013308 Ga0157375_10849072 Ga0157375_108490721 321
249 3300014325 Ga0163163_10063826 Ga0163163_100638265 321
250 3300014326 Ga0157380_10023556 Ga0157380_100235565 321
251 3300014326 Ga0157380_10115114 Ga0157380_101151141 321
252 3300014968 Ga0157379_10011356 Ga0157379_100113569 321
253 3300014968 Ga0157379_10019175 Ga0157379_100191756 321
254 3300014968 Ga0157379_10115860 Ga0157379_101158602 321
255 3300014969 Ga0157376_10012899 Ga0157376_100128995 321
256 3300014969 Ga0157376_10029487 Ga0157376_100294874 321
257 3300025893 Ga0207682_10025605 Ga0207682_100256052 321
258 3300025899 Ga0207642_10005530 Ga0207642_100055302 321
259 3300025900 Ga0207710_10009810 Ga0207710_100098104 321
260 3300025901 Ga0207688_10012350 Ga0207688_100123505 321
261 3300025901 Ga0207688_10060450 Ga0207688_100604503 321
262 3300025903 Ga0207680_10087401 Ga0207680_100874013 321
263 3300025903 Ga0207680_10117267 Ga0207680_101172672 321
264 3300025907 Ga0207645_10062601 Ga0207645_100626013 321
265 3300025911 Ga0207654_10043032 Ga0207654_100430324 321
266 3300025913 Ga0207695_10104626 Ga0207695_101046264 321
267 3300025918 Ga0207662_10001397 Ga0207662_100013976 321
268 3300025921 Ga0207652_10190745 Ga0207652_101907452 321
269 3300025925 Ga0207650_10009789 Ga0207650_100097892 321
270 3300025925 Ga0207650_10016918 Ga0207650_100169186 321
271 3300025925 Ga0207650_10120689 Ga0207650_101206893 321
272 3300025926 Ga0207659_10000637 Ga0207659_1000063720 321
273 3300025926 Ga0207659_10133145 Ga0207659_101331453 321
274 3300025927 Ga0207687_10108704 Ga0207687_101087042 321
275 3300025932 Ga0207690_10160025 Ga0207690_101600252 321
276 3300025933 Ga0207706_10163082 Ga0207706_101630822 321
277 3300025934 Ga0207686_10013332 Ga0207686_100133321 321
278 3300025934 Ga0207686_10062164 Ga0207686_100621642 321
279 3300025936 Ga0207670_10034094 Ga0207670_100340944 321
280 3300025937 Ga0207669_10067752 Ga0207669_100677523 321
281 3300025940 Ga0207691_10014887 Ga0207691_100148875 321
282 3300025941 Ga0207711_10016817 Ga0207711_100168176 321
283 3300025941 Ga0207711_10502449 Ga0207711_105024492 321
284 3300025942 Ga0207689_10018657 Ga0207689_100186576 321
285 3300025942 Ga0207689_10023982 Ga0207689_100239822 321
286 3300025960 Ga0207651_10037343 Ga0207651_100373432 321
287 3300025960 Ga0207651_10059348 Ga0207651_100593482 321
288 3300025981 Ga0207640_10158573 Ga0207640_101585732 321
289 3300025986 Ga0207658_10147003 Ga0207658_101470032 321
290 3300026075 Ga0207708_10114552 Ga0207708_101145522 321
291 3300026088 Ga0207641_10219824 Ga0207641_102198242 321
292 3300026089 Ga0207648_10105001 Ga0207648_101050013 321
293 3300026089 Ga0207648_10116998 Ga0207648_101169983 321
294 3300026089 Ga0207648_10400018 Ga0207648_104000182 321
295 3300026095 Ga0207676_10038195 Ga0207676_100381954 321
296 3300026116 Ga0207674_10017271 Ga0207674_100172712 321
297 3300026116 Ga0207674_10067564 Ga0207674_100675643 321
298 3300026116 Ga0207674_10138960 Ga0207674_101389603 321
299 3300026118 Ga0207675_100042523 Ga0207675_1000425232 321
300 3300026118 Ga0207675_100056439 Ga0207675_1000564393 321
301 3300026118 Ga0207675_100173170 Ga0207675_1001731702 321
302 3300026121 Ga0207683_10061290 Ga0207683_100612902 321
303 3300026121 Ga0207683_10093241 Ga0207683_100932412 321
304 3300026121 Ga0207683_10205889 Ga0207683_102058891 321
305 3300028379 Ga0268266_10027582 Ga0268266_100275825 321
306 3300028379 Ga0268266_10037300 Ga0268266_100373004 321
307 3300028379 Ga0268266_10114017 Ga0268266_101140172 321
308 3300028380 Ga0268265_10147174 Ga0268265_101471742 321
309 3300028380 Ga0268265_10379624 Ga0268265_103796242 321
310 3300028381 Ga0268264_10041771 Ga0268264_100417715 321
311 3300031711 Ga0265314_10111206 Ga0265314_101112062 321
312 3300031852 Ga0307410_10305995 Ga0307410_103059952 321
313 3300031911 Ga0307412_10134368 Ga0307412_101343682 321
314 3300031995 Ga0307409_100136873 Ga0307409_1001368732 321
315 3300032002 Ga0307416_100024132 Ga0307416_1000241322 321
316 3300032002 Ga0307416_100067581 Ga0307416_1000675813 321
317 3300032002 Ga0307416_100141303 Ga0307416_1001413032 321
318 3300032002 Ga0307416_100264039 Ga0307416_1002640392 321
319 3300032002 Ga0307416_100375120 Ga0307416_1003751201 321
320 3300032002 Ga0307416_100632207 Ga0307416_1006322071 321
321 3300032126 Ga0307415_100078248 Ga0307415_1000782482 321
322 3300034816 Ga0373930_0011115 Ga0373930_0011115_32_997 321
323 3300034817 Ga0373948_0002304 Ga0373948_0002304_437_1402 321
324 3300034819 Ga0373958_0005545 Ga0373958_0005545_63_1028 321
325 3300034957 Ga0373938_0010258 Ga0373938_0010258_556_1521 321
326 3300035084 Ga0373928_0000667 Ga0373928_0000667_5754_6719 321
327 3300035085 Ga0373929_0001181 Ga0373929_0001181_3742_4707 321
328 3300035088 Ga0373940_0023457 Ga0373940_0023457_478_1443 321
329 3300035090 Ga0373949_0001022 Ga0373949_0001022_7604_8569 321
330 3300035091 Ga0373951_0000437 Ga0373951_0000437_4653_5618 321
331 3300035092 Ga0373952_0001181 Ga0373952_0001181_279_1244 321
332 3300035112 Ga0373932_0000260 Ga0373932_0000260_12389_13354 321
333 3300035114 Ga0373939_0002507 Ga0373939_0002507_443_1408 321
334 3300035114 Ga0373939_0013054 Ga0373939_0013054_787_1752 321
335 3300035115 Ga0373941_0001741 Ga0373941_0001741_1709_2674 321
336 3300035115 Ga0373941_0035857 Ga0373941_0035857_340_1413 321
337 3300035117 Ga0373953_0126301 Ga0373953_0126301_72_1037 321
338 3300035121 Ga0373960_0005132 Ga0373960_0005132_233_1198 321
339 3300035207 Ga0373942_0002033 Ga0373942_0002033_120_1085 321
340 3300035241 Ga0373961_0000739 Ga0373961_0000739_10042_11007 321
341 3300035691 Ga0373931_0000499 Ga0373931_0000499_11564_12529 321
342 3300035691 Ga0373931_0206031 Ga0373931_0206031_63_1124 321
343 3300035692 Ga0373935_0069255 Ga0373935_0069255_1249_2214 321
344 3300035724 Ga0373933_0127409 Ga0373933_0127409_38_1003 321
345 3300035725 Ga0373947_0018033 Ga0373947_0018033_2090_3055 321
346 3300037068 Ga0373925_0143985 Ga0373925_0143985_134_1099 321
347 3300037068 Ga0373925_0166252 Ga0373925_0166252_727_1692 321
348 3300041997 Ga0439431_0000960 Ga0439431_0000960_1302_2333 321
349 3300041999 Ga0439433_0005747 Ga0439433_0005747_159_1190 321
350 3300045051 Ga0451576_0027797 Ga0451576_0027797_4633_5598 321
351 3300045051 Ga0451576_0042753 Ga0451576_0042753_3723_4688 321
352 3300046454 Ga0495592_0119274 Ga0495592_0119274_474_1439 321
353 3300046455 Ga0495603_0075621 Ga0495603_0075621_207_1172 321
354 3300046476 Ga0495662_0146094 Ga0495662_0146094_90_1058 321
355 3300046511 Ga0495608_0035613 Ga0495608_0035613_278_1306 321
356 3300046537 Ga0495598_0054545 Ga0495598_0054545_137_1102 321
357 3300046678 Ga0495599_0200548 Ga0495599_0200548_76_1041 321
358 3300048904 Ga0496101_0168099 Ga0496101_0168099_81_1109 321
359 3300048905 Ga0496102_0017629 Ga0496102_0017629_489_1517 321
360 3300048905 Ga0496102_0048879 Ga0496102_0048879_2571_3536 321
361 3300048907 Ga0496104_0169254 Ga0496104_0169254_786_1751 321
362 3300048907 Ga0496104_0270835 Ga0496104_0270835_168_1196 321
363 3300048911 Ga0496108_0044265 Ga0496108_0044265_1391_2419 321
364 3300048911 Ga0496108_0103897 Ga0496108_0103897_92_1057 321
365 3300048912 Ga0496109_0058002 Ga0496109_0058002_35_1078 321
366 3300048912 Ga0496109_0163182 Ga0496109_0163182_81_1109 321
367 3300048913 Ga0496110_0079952 Ga0496110_0079952_1848_2891 321
368 3300048913 Ga0496110_0104833 Ga0496110_0104833_150_1115 321
369 3300048914 Ga0496111_0112616 Ga0496111_0112616_202_1230 321
370 3300048915 Ga0496112_0020556 Ga0496112_0020556_1420_2385 321
371 3300048916 Ga0496113_0197884 Ga0496113_0197884_565_1530 321
372 3300048917 Ga0496114_0142369 Ga0496114_0142369_417_1382 321
373 3300048918 Ga0496115_0148018 Ga0496115_0148018_174_1139 321
374 3300049571 Ga0501034_0206714 Ga0501034_0206714_366_1334 321
375 3300049572 Ga0501036_0157054 Ga0501036_0157054_89_1117 321
376 3300049574 Ga0501038_0069731 Ga0501038_0069731_474_1502 321
377 3300049575 Ga0501039_0103043 Ga0501039_0103043_740_1705 321
378 3300049576 Ga0501040_0015889 Ga0501040_0015889_3610_4668 321
379 3300049576 Ga0501040_0057741 Ga0501040_0057741_785_1771 321
380 3300049578 Ga0501042_0146095 Ga0501042_0146095_426_1454 321
381 3300049578 Ga0501042_0299312 Ga0501042_0299312_63_1097 321
382 3300049580 Ga0501046_0119049 Ga0501046_0119049_581_1639 321
383 3300049582 Ga0501048_0017593 Ga0501048_0017593_2133_3161 321
384 3300049582 Ga0501048_0116800 Ga0501048_0116800_307_1356 321
385 3300049582 Ga0501048_0270664 Ga0501048_0270664_52_1098 321
386 3300049583 Ga0501067_0033115 Ga0501067_0033115_370_1341 321
387 3300049587 Ga0501071_0046330 Ga0501071_0046330_1863_2891 321
388 3300049587 Ga0501071_0353649 Ga0501071_0353649_48_1094 321
389 3300049588 Ga0501072_0011382 Ga0501072_0011382_4528_5514 321
390 3300049589 Ga0501073_0267671 Ga0501073_0267671_112_1080 321
391 3300049591 Ga0501075_0046976 Ga0501075_0046976_1289_2275 321
392 3300049591 Ga0501075_0047634 Ga0501075_0047634_319_1347 321
393 3300049592 Ga0501076_0068140 Ga0501076_0068140_154_1212 321
394 3300049668 Ga0501233_035014 Ga0501233_035014_62_1120 321
395 3300049742 Ga0501080_0195389 Ga0501080_0195389_736_1764 321
396 3300049742 Ga0501080_0422652 Ga0501080_0422652_81_1112 321
397 3300049823 Ga0501044_0403730 Ga0501044_0403730_196_1224 321
398 3300049824 Ga0501045_0063197 Ga0501045_0063197_370_1428 321
399 3300050507 nmdc:mga05p37_1014_c1 nmdc:mga05p37_1014_c1_13062_14048 321
400 3300050507 nmdc:mga05p37_33124_c1 nmdc:mga05p37_33124_c1_1692_2657 321
401 3300050507 nmdc:mga05p37_343270_c1 nmdc:mga05p37_343270_c1_360_1430 321
402 3300050507 nmdc:mga05p37_368807_c1 nmdc:mga05p37_368807_c1_672_1667 321
403 3300050507 nmdc:mga05p37_4374_c2 nmdc:mga05p37_4374_c2_4048_5019 321
404 3300050507 nmdc:mga05p37_609295_c1 nmdc:mga05p37_609295_c1_95_1129 321
405 3300050507 nmdc:mga05p37_85235_c1 nmdc:mga05p37_85235_c1_501_1466 321
406 3300050508 nmdc:mga09592_52715_c1 nmdc:mga09592_52715_c1_795_1853 321
407 3300050509 nmdc:mga0qj67_113593_c1 nmdc:mga0qj67_113593_c1_309_1304 321
408 3300050509 nmdc:mga0qj67_4199_c1 nmdc:mga0qj67_4199_c1_2604_3575 321
409 3300050509 nmdc:mga0qj67_9679_c1 nmdc:mga0qj67_9679_c1_632_1690 321
410 3300050510 nmdc:mga06r32_244059_c1 nmdc:mga06r32_244059_c1_358_1419 321
411 3300050511 nmdc:mga08y16_152115_c1 nmdc:mga08y16_152115_c1_1388_2383 321
412 3300050512 nmdc:mga0n895_27791_c1 nmdc:mga0n895_27791_c1_4314_5312 321
413 3300050512 nmdc:mga0n895_287836_c1 nmdc:mga0n895_287836_c1_159_1220 321
414 3300050513 nmdc:mga0rr50_23442_c1 nmdc:mga0rr50_23442_c1_1545_2606 321
415 3300050513 nmdc:mga0rr50_26985_c1 nmdc:mga0rr50_26985_c1_715_1713 321
416 3300050513 nmdc:mga0rr50_673_c1 nmdc:mga0rr50_673_c1_10046_11011 321
417 3300050514 nmdc:mga08x19_108049_c1 nmdc:mga08x19_108049_c1_606_1604 321
418 3300050515 nmdc:mga0a205_14495_c1 nmdc:mga0a205_14495_c1_6316_7311 321
419 3300050515 nmdc:mga0a205_347853_c1 nmdc:mga0a205_347853_c1_188_1171 321
420 3300050515 nmdc:mga0a205_73015_c1 nmdc:mga0a205_73015_c1_700_1668 321
421 3300050515 nmdc:mga0a205_8826_c1 nmdc:mga0a205_8826_c1_3568_4566 321
422 3300050515 nmdc:mga0a205_95890_c1 nmdc:mga0a205_95890_c1_354_1391 321
423 3300053085 Ga0495619_0019689 Ga0495619_0019689_1032_1997 321
424 3300053085 Ga0495619_0038074 Ga0495619_0038074_109_1074 321
425 3300053085 Ga0495619_0076630 Ga0495619_0076630_389_1354 321
426 3300054114 Ga0501084_0081458 Ga0501084_0081458_1646_2674 321
427 3300060353 Ga0501082_0243801 Ga0501082_0243801_17_1045 321
428 3300060353 Ga0501082_0350426 Ga0501082_0350426_203_1237 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

1

332

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9676 1 319
4wsh-assembly1.cif.gz_A crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa 0.9601 1 319
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9587 1 319
1j93-assembly1.cif.gz_A-2 crystal structure and substrate binding modeling of the uroporphyrinogen-iii decarboxylase from nicotiana tabacum: implications for the catalytic mechanism 0.9571 1 317
1jpi-assembly1.cif.gz_A-2 phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9569 1 320
ID Description Score Start End Superfamily
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9684 1 317 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9616 1 317 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.954 1 320 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.954 1 321 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9536 1 317 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A354BI13-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9937 18 321 GO:0004853
GO:0005829
GO:0006782
AF-A0A354BI13-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9905 18 321 GO:0004853
GO:0005829
GO:0006782
AF-A0A536EM00-F1-model_v4 Uroporphyrinogen decarboxylase 0.9899 145 316 GO:0004853
GO:0005829
GO:0006783
AF-A0A3D1SUV1-F1-model_v4 Uroporphyrinogen decarboxylase 0.9897 159 321 GO:0004853
GO:0005829
GO:0006783
AF-A0A1E4DGZ5-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9889 1 317 GO:0004853
GO:0005829
GO:0006782

Feature Viewer

pLDDT pTM Quality
93.01 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map