F441649
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 428 | 230 | 428 | 329 |
Family's Representative Sequence
| Representative Sequence | 3300006846|Ga0075430_100017727|Ga0075430_1000177276 |
| Length | 345 |
| Sequence | VTDRFLRACRLEPVDATPVWFMRQAGRYMSDYRALRERYSLLEICRHPDLAVAVTLQPVDVIEVDAAILFSDLLLPFTPLGLEFDFVKGEGPSVENPIRSAADVDRLRRFEPRDELAHVIETIHILRTELTGRVPLIGFGGAPFTLAAYAIEGGPSTTYARTKTFMYAHPRAWHRLCEDYMRAQIEAGAQAIQIFDSWAGSLSRSDYREFAYPHTRAIFDRLADAGVPLIHFGVGTTAILPDLAAAGGDVIGVDWRLPLDEAWGRIGHDRGIQGNLDPTLLLGPADRVFSAAHEVLRTANGRPGHVFNLGHGVLPATPLERVQELARYVHRTSARPVDAGAPLGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 130 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 134 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 135 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 137 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 138 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 151 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 153 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 155 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 160 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 161 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 162 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 163 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 182 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 207 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 216 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 217 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.5 |
| Nodule | 0 |
| Rhizoplane | 6.07 |
| Rhizosphere | 90.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_2782814 | 2162886011 | Bacteria | 1650 |
| 2 | JGI24751J29686_10004094 | 3300002459 | Bacteria | 2954 |
| 3 | Ga0065712_10080398 | 3300005290 | Bacteria | 3107 |
| 4 | Ga0065712_10082128 | 3300005290 | Bacteria | 2946 |
| 5 | Ga0065715_10002603 | 3300005293 | Bacteria | 4629 |
| 6 | Ga0065715_10019668 | 3300005293 | Bacteria | 2669 |
| 7 | Ga0065715_10127086 | 3300005293 | Bacteria | 2095 |
| 8 | Ga0065707_10119652 | 3300005295 | Bacteria | 2154 |
| 9 | Ga0065707_10226284 | 3300005295 | Bacteria | 1205 |
| 10 | Ga0070676_10037313 | 3300005328 | Bacteria | 2802 |
| 11 | Ga0070683_100011332 | 3300005329 | Bacteria | 7703 |
| 12 | Ga0070683_100048998 | 3300005329 | Bacteria | 3906 |
| 13 | Ga0070690_100016427 | 3300005330 | Bacteria | 4434 |
| 14 | Ga0070670_100006131 | 3300005331 | Bacteria | 10167 |
| 15 | Ga0070670_100017684 | 3300005331 | Bacteria | 6116 |
| 16 | Ga0070670_100069025 | 3300005331 | Bacteria | 3034 |
| 17 | Ga0070670_100251413 | 3300005331 | Bacteria | 1540 |
| 18 | Ga0068869_100006316 | 3300005334 | Bacteria | 7503 |
| 19 | Ga0070666_10014454 | 3300005335 | Bacteria | 5026 |
| 20 | Ga0070666_10231665 | 3300005335 | Bacteria | 1305 |
| 21 | Ga0070680_100047016 | 3300005336 | Bacteria | 3513 |
| 22 | Ga0070660_100284580 | 3300005339 | Bacteria | 1353 |
| 23 | Ga0070689_100012244 | 3300005340 | Bacteria | 6172 |
| 24 | Ga0070691_10021813 | 3300005341 | Bacteria | 2966 |
| 25 | Ga0070687_100047971 | 3300005343 | Bacteria | 2194 |
| 26 | Ga0070661_100129984 | 3300005344 | Bacteria | 1891 |
| 27 | Ga0070692_10041738 | 3300005345 | Bacteria | 2352 |
| 28 | Ga0070669_100003679 | 3300005353 | Bacteria | 11063 |
| 29 | Ga0070669_100206277 | 3300005353 | Bacteria | 1549 |
| 30 | Ga0070675_100004928 | 3300005354 | Bacteria | 10178 |
| 31 | Ga0070675_100117888 | 3300005354 | Bacteria | 2253 |
| 32 | Ga0070671_100011793 | 3300005355 | Bacteria | 7031 |
| 33 | Ga0070671_100018521 | 3300005355 | Bacteria | 5657 |
| 34 | Ga0070674_100011399 | 3300005356 | Bacteria | 5413 |
| 35 | Ga0070674_100031663 | 3300005356 | Bacteria | 3506 |
| 36 | Ga0070673_100004033 | 3300005364 | Bacteria | 9246 |
| 37 | Ga0070673_100036395 | 3300005364 | Bacteria | 3741 |
| 38 | Ga0070659_100163113 | 3300005366 | Bacteria | 1823 |
| 39 | Ga0070713_100151946 | 3300005436 | Bacteria | 2060 |
| 40 | Ga0070711_100268977 | 3300005439 | Bacteria | 1344 |
| 41 | Ga0070700_100029773 | 3300005441 | Bacteria | 3257 |
| 42 | Ga0070681_10011426 | 3300005458 | Bacteria | 8790 |
| 43 | Ga0068867_100008307 | 3300005459 | Bacteria | 7329 |
| 44 | Ga0070679_100122824 | 3300005530 | Bacteria | 2580 |
| 45 | Ga0070679_100438563 | 3300005530 | Bacteria | 1251 |
| 46 | Ga0070684_100063056 | 3300005535 | Bacteria | 3248 |
| 47 | Ga0070672_100019602 | 3300005543 | Bacteria | 4912 |
| 48 | Ga0070686_100001249 | 3300005544 | Bacteria | 14442 |
| 49 | Ga0070693_100005285 | 3300005547 | Bacteria | 6187 |
| 50 | Ga0070665_100007922 | 3300005548 | Bacteria | 10770 |
| 51 | Ga0070665_100012476 | 3300005548 | Bacteria | 8564 |
| 52 | Ga0070665_100066304 | 3300005548 | Bacteria | 3622 |
| 53 | Ga0070665_100538835 | 3300005548 | Bacteria | 1179 |
| 54 | Ga0070664_100000163 | 3300005564 | Bacteria | 45912 |
| 55 | Ga0070664_100041475 | 3300005564 | Bacteria | 3884 |
| 56 | Ga0068857_100010905 | 3300005577 | Bacteria | 7910 |
| 57 | Ga0068857_100015109 | 3300005577 | Bacteria | 6739 |
| 58 | Ga0068854_100080885 | 3300005578 | Bacteria | 2398 |
| 59 | Ga0068852_100045249 | 3300005616 | Bacteria | 3743 |
| 60 | Ga0068864_100008563 | 3300005618 | Bacteria | 8442 |
| 61 | Ga0068866_10003380 | 3300005718 | Bacteria | 6545 |
| 62 | Ga0068861_100067241 | 3300005719 | Bacteria | 2765 |
| 63 | Ga0068861_100217320 | 3300005719 | Bacteria | 1613 |
| 64 | Ga0068863_100174089 | 3300005841 | Bacteria | 2065 |
| 65 | Ga0068858_100012005 | 3300005842 | Bacteria | 8166 |
| 66 | Ga0068858_100018512 | 3300005842 | Bacteria | 6520 |
| 67 | Ga0068860_100146411 | 3300005843 | Bacteria | 2273 |
| 68 | Ga0068862_100040480 | 3300005844 | Bacteria | 3961 |
| 69 | Ga0070717_10355112 | 3300006028 | Bacteria | 1311 |
| 70 | Ga0075365_10029970 | 3300006038 | Bacteria | 3481 |
| 71 | Ga0075368_10005104 | 3300006042 | Bacteria | 4496 |
| 72 | Ga0075368_10014910 | 3300006042 | Bacteria | 2877 |
| 73 | Ga0075364_10014158 | 3300006051 | Bacteria | 4923 |
| 74 | Ga0075364_10027912 | 3300006051 | Bacteria | 3609 |
| 75 | Ga0070716_100073686 | 3300006173 | Bacteria | 2015 |
| 76 | Ga0075362_10006433 | 3300006177 | Bacteria | 4379 |
| 77 | Ga0075367_10056358 | 3300006178 | Bacteria | 2334 |
| 78 | Ga0075366_10006971 | 3300006195 | Bacteria | 6222 |
| 79 | Ga0075366_10021123 | 3300006195 | Bacteria | 3785 |
| 80 | Ga0097621_100025619 | 3300006237 | Bacteria | 4616 |
| 81 | Ga0068871_100002793 | 3300006358 | Bacteria | 11934 |
| 82 | Ga0075428_100000865 | 3300006844 | Bacteria | 31862 |
| 83 | Ga0075428_100015779 | 3300006844 | Bacteria | 8366 |
| 84 | Ga0075428_100018567 | 3300006844 | Bacteria | 7687 |
| 85 | Ga0075430_100017727 | 3300006846 | Bacteria | 6061 |
| 86 | Ga0075430_100018331 | 3300006846 | Bacteria | 5958 |
| 87 | Ga0075430_100061891 | 3300006846 | Bacteria | 3144 |
| 88 | Ga0075430_100083775 | 3300006846 | Bacteria | 2671 |
| 89 | Ga0075431_100010327 | 3300006847 | Bacteria | 9381 |
| 90 | Ga0075431_100026582 | 3300006847 | Bacteria | 5938 |
| 91 | Ga0075433_10004871 | 3300006852 | Bacteria | 10500 |
| 92 | Ga0075433_10027110 | 3300006852 | Bacteria | 4857 |
| 93 | Ga0075433_10083393 | 3300006852 | Bacteria | 2821 |
| 94 | Ga0075433_10176549 | 3300006852 | Bacteria | 1901 |
| 95 | Ga0075433_10230380 | 3300006852 | Bacteria | 1645 |
| 96 | Ga0075434_100003115 | 3300006871 | Bacteria | 14769 |
| 97 | Ga0075434_100030631 | 3300006871 | Bacteria | 5300 |
| 98 | Ga0075434_100113581 | 3300006871 | Bacteria | 2720 |
| 99 | Ga0075434_100147871 | 3300006871 | Bacteria | 2370 |
| 100 | Ga0075429_100003645 | 3300006880 | Bacteria | 13117 |
| 101 | Ga0075429_100103847 | 3300006880 | Bacteria | 2482 |
| 102 | Ga0075429_100114323 | 3300006880 | Bacteria | 2359 |
| 103 | Ga0068865_100004678 | 3300006881 | Bacteria | 8267 |
| 104 | Ga0075435_100006656 | 3300007076 | Bacteria | 8190 |
| 105 | Ga0075435_100013180 | 3300007076 | Bacteria | 6143 |
| 106 | Ga0075435_100054796 | 3300007076 | Bacteria | 3219 |
| 107 | Ga0075435_100059349 | 3300007076 | Bacteria | 3101 |
| 108 | Ga0105240_10007971 | 3300009093 | Bacteria | 15273 |
| 109 | Ga0105240_10231775 | 3300009093 | Bacteria | 2145 |
| 110 | Ga0105240_10491360 | 3300009093 | Bacteria | 1366 |
| 111 | Ga0111539_10003820 | 3300009094 | Bacteria | 19828 |
| 112 | Ga0111539_10010872 | 3300009094 | Bacteria | 11455 |
| 113 | Ga0111539_10116951 | 3300009094 | Unclassified | 3126 |
| 114 | Ga0111539_10133435 | 3300009094 | Bacteria | 2907 |
| 115 | Ga0111539_10259112 | 3300009094 | Bacteria | 2025 |
| 116 | Ga0111539_10312790 | 3300009094 | Bacteria | 1828 |
| 117 | Ga0105245_10020467 | 3300009098 | Bacteria | 5802 |
| 118 | Ga0105245_10136225 | 3300009098 | Bacteria | 2308 |
| 119 | Ga0105247_10020269 | 3300009101 | Bacteria | 3998 |
| 120 | Ga0105247_10061636 | 3300009101 | Bacteria | 2326 |
| 121 | Ga0114129_10000076 | 3300009147 | Bacteria | 90985 |
| 122 | Ga0114129_10000973 | 3300009147 | Bacteria | 37498 |
| 123 | Ga0114129_10001069 | 3300009147 | Bacteria | 36016 |
| 124 | Ga0114129_10017015 | 3300009147 | Bacteria | 10352 |
| 125 | Ga0114129_10032236 | 3300009147 | Bacteria | 7406 |
| 126 | Ga0114129_10039413 | 3300009147 | Bacteria | 6660 |
| 127 | Ga0114129_10047615 | 3300009147 | Bacteria | 6024 |
| 128 | Ga0114129_10788467 | 3300009147 | Bacteria | 1213 |
| 129 | Ga0105241_10039422 | 3300009174 | Bacteria | 3563 |
| 130 | Ga0105241_10058203 | 3300009174 | Bacteria | 2967 |
| 131 | Ga0105242_10007403 | 3300009176 | Bacteria | 8452 |
| 132 | Ga0105242_10019556 | 3300009176 | Bacteria | 5308 |
| 133 | Ga0105242_10067044 | 3300009176 | Bacteria | 2966 |
| 134 | Ga0105248_10048515 | 3300009177 | Bacteria | 4763 |
| 135 | Ga0105248_10058376 | 3300009177 | Bacteria | 4334 |
| 136 | Ga0105248_10107154 | 3300009177 | Bacteria | 3151 |
| 137 | Ga0105248_10540828 | 3300009177 | Bacteria | 1314 |
| 138 | Ga0105248_10639817 | 3300009177 | Bacteria | 1200 |
| 139 | Ga0105248_10722663 | 3300009177 | Bacteria | 1124 |
| 140 | Ga0105249_10000796 | 3300009553 | Bacteria | 28325 |
| 141 | Ga0105249_10341407 | 3300009553 | Bacteria | 1514 |
| 142 | Ga0105249_10395811 | 3300009553 | Bacteria | 1411 |
| 143 | Ga0105249_10444965 | 3300009553 | Bacteria | 1334 |
| 144 | Ga0105239_10088428 | 3300010375 | Bacteria | 3416 |
| 145 | Ga0157374_10043351 | 3300013296 | Bacteria | 4156 |
| 146 | Ga0157378_10133295 | 3300013297 | Bacteria | 2302 |
| 147 | Ga0157372_10080668 | 3300013307 | Bacteria | 3682 |
| 148 | Ga0157372_10305951 | 3300013307 | Bacteria | 1849 |
| 149 | Ga0157375_10849072 | 3300013308 | Bacteria | 1060 |
| 150 | Ga0163163_10011542 | 3300014325 | Bacteria | 8023 |
| 151 | Ga0163163_10063826 | 3300014325 | Bacteria | 3654 |
| 152 | Ga0163163_10374113 | 3300014325 | Bacteria | 1482 |
| 153 | Ga0157380_10023556 | 3300014326 | Bacteria | 4645 |
| 154 | Ga0157380_10115114 | 3300014326 | Bacteria | 2267 |
| 155 | Ga0157379_10011356 | 3300014968 | Bacteria | 7767 |
| 156 | Ga0157379_10019175 | 3300014968 | Bacteria | 6039 |
| 157 | Ga0157379_10115860 | 3300014968 | Bacteria | 2409 |
| 158 | Ga0157376_10012899 | 3300014969 | Bacteria | 6218 |
| 159 | Ga0157376_10029487 | 3300014969 | Bacteria | 4370 |
| 160 | Ga0157376_10085986 | 3300014969 | Bacteria | 2711 |
| 161 | Ga0157376_10224652 | 3300014969 | Bacteria | 1741 |
| 162 | Ga0207697_10031722 | 3300025315 | Bacteria | 2161 |
| 163 | Ga0207682_10025605 | 3300025893 | Bacteria | 2340 |
| 164 | Ga0207642_10005530 | 3300025899 | Bacteria | 4128 |
| 165 | Ga0207710_10009810 | 3300025900 | Bacteria | 4024 |
| 166 | Ga0207688_10012350 | 3300025901 | Bacteria | 4647 |
| 167 | Ga0207688_10060450 | 3300025901 | Bacteria | 2134 |
| 168 | Ga0207680_10087401 | 3300025903 | Bacteria | 1974 |
| 169 | Ga0207680_10117267 | 3300025903 | Bacteria | 1736 |
| 170 | Ga0207645_10062601 | 3300025907 | Bacteria | 2377 |
| 171 | Ga0207654_10043032 | 3300025911 | Bacteria | 2558 |
| 172 | Ga0207695_10104626 | 3300025913 | Bacteria | 2819 |
| 173 | Ga0207662_10001397 | 3300025918 | Bacteria | 11669 |
| 174 | Ga0207649_10101284 | 3300025920 | Bacteria | 1907 |
| 175 | Ga0207652_10190745 | 3300025921 | Bacteria | 1843 |
| 176 | Ga0207681_10024833 | 3300025923 | Bacteria | 3848 |
| 177 | Ga0207650_10009789 | 3300025925 | Bacteria | 6552 |
| 178 | Ga0207650_10016918 | 3300025925 | Bacteria | 5100 |
| 179 | Ga0207650_10050350 | 3300025925 | Bacteria | 3080 |
| 180 | Ga0207650_10120689 | 3300025925 | Bacteria | 2041 |
| 181 | Ga0207650_10210499 | 3300025925 | Bacteria | 1561 |
| 182 | Ga0207659_10000637 | 3300025926 | Bacteria | 20834 |
| 183 | Ga0207659_10133145 | 3300025926 | Bacteria | 1921 |
| 184 | Ga0207687_10108704 | 3300025927 | Bacteria | 2054 |
| 185 | Ga0207644_10090993 | 3300025931 | Bacteria | 2274 |
| 186 | Ga0207690_10160025 | 3300025932 | Bacteria | 1678 |
| 187 | Ga0207706_10163082 | 3300025933 | Bacteria | 1959 |
| 188 | Ga0207686_10013332 | 3300025934 | Bacteria | 4546 |
| 189 | Ga0207686_10062164 | 3300025934 | Bacteria | 2370 |
| 190 | Ga0207670_10034094 | 3300025936 | Bacteria | 3286 |
| 191 | Ga0207669_10067752 | 3300025937 | Bacteria | 2226 |
| 192 | Ga0207691_10014887 | 3300025940 | Bacteria | 7411 |
| 193 | Ga0207711_10016817 | 3300025941 | Bacteria | 6075 |
| 194 | Ga0207711_10502449 | 3300025941 | Bacteria | 1130 |
| 195 | Ga0207689_10018657 | 3300025942 | Bacteria | 5852 |
| 196 | Ga0207689_10023982 | 3300025942 | Bacteria | 5118 |
| 197 | Ga0207661_10032033 | 3300025944 | Bacteria | 4069 |
| 198 | Ga0207679_10011000 | 3300025945 | Bacteria | 5840 |
| 199 | Ga0207651_10037343 | 3300025960 | Bacteria | 3181 |
| 200 | Ga0207651_10059348 | 3300025960 | Bacteria | 2650 |
| 201 | Ga0207640_10158573 | 3300025981 | Bacteria | 1671 |
| 202 | Ga0207658_10147003 | 3300025986 | Bacteria | 1916 |
| 203 | Ga0207703_10036045 | 3300026035 | Bacteria | 3934 |
| 204 | Ga0207703_10352103 | 3300026035 | Bacteria | 1356 |
| 205 | Ga0207708_10114552 | 3300026075 | Bacteria | 2096 |
| 206 | Ga0207641_10219824 | 3300026088 | Bacteria | 1761 |
| 207 | Ga0207648_10076494 | 3300026089 | Bacteria | 2918 |
| 208 | Ga0207648_10105001 | 3300026089 | Bacteria | 2478 |
| 209 | Ga0207648_10116998 | 3300026089 | Bacteria | 2343 |
| 210 | Ga0207648_10400018 | 3300026089 | Bacteria | 1244 |
| 211 | Ga0207676_10038195 | 3300026095 | Bacteria | 3662 |
| 212 | Ga0207674_10017271 | 3300026116 | Bacteria | 7872 |
| 213 | Ga0207674_10067564 | 3300026116 | Bacteria | 3599 |
| 214 | Ga0207674_10138960 | 3300026116 | Bacteria | 2390 |
| 215 | Ga0207675_100042523 | 3300026118 | Bacteria | 4243 |
| 216 | Ga0207675_100056439 | 3300026118 | Bacteria | 3663 |
| 217 | Ga0207675_100173170 | 3300026118 | Bacteria | 2064 |
| 218 | Ga0207683_10061290 | 3300026121 | Bacteria | 3310 |
| 219 | Ga0207683_10093241 | 3300026121 | Bacteria | 2683 |
| 220 | Ga0207683_10205889 | 3300026121 | Bacteria | 1789 |
| 221 | Ga0207428_10000797 | 3300027907 | Bacteria | 35667 |
| 222 | Ga0207428_10092274 | 3300027907 | Bacteria | 2350 |
| 223 | Ga0207428_10098459 | 3300027907 | Bacteria | 2263 |
| 224 | Ga0268266_10027582 | 3300028379 | Bacteria | 4828 |
| 225 | Ga0268266_10037300 | 3300028379 | Bacteria | 4141 |
| 226 | Ga0268266_10114017 | 3300028379 | Bacteria | 2398 |
| 227 | Ga0268265_10030826 | 3300028380 | Bacteria | 3867 |
| 228 | Ga0268265_10147174 | 3300028380 | Bacteria | 1981 |
| 229 | Ga0268265_10379624 | 3300028380 | Bacteria | 1300 |
| 230 | Ga0268264_10041771 | 3300028381 | Bacteria | 3794 |
| 231 | Ga0268264_10049807 | 3300028381 | Bacteria | 3487 |
| 232 | Ga0307408_100015554 | 3300031548 | Bacteria | 5066 |
| 233 | Ga0307408_100024932 | 3300031548 | Bacteria | 4090 |
| 234 | Ga0265314_10111206 | 3300031711 | Bacteria | 1741 |
| 235 | Ga0307410_10305995 | 3300031852 | Bacteria | 1256 |
| 236 | Ga0307412_10134368 | 3300031911 | Bacteria | 1802 |
| 237 | Ga0307409_100136873 | 3300031995 | Bacteria | 2103 |
| 238 | Ga0307416_100021319 | 3300032002 | Bacteria | 4649 |
| 239 | Ga0307416_100024132 | 3300032002 | Bacteria | 4431 |
| 240 | Ga0307416_100067581 | 3300032002 | Bacteria | 2949 |
| 241 | Ga0307416_100141303 | 3300032002 | Bacteria | 2189 |
| 242 | Ga0307416_100264039 | 3300032002 | Bacteria | 1685 |
| 243 | Ga0307416_100375120 | 3300032002 | Bacteria | 1450 |
| 244 | Ga0307416_100632207 | 3300032002 | Bacteria | 1153 |
| 245 | Ga0307411_10031183 | 3300032005 | Bacteria | 3276 |
| 246 | Ga0307415_100078248 | 3300032126 | Bacteria | 2352 |
| 247 | Ga0307415_100358740 | 3300032126 | Bacteria | 1230 |
| 248 | Ga0373930_0011115 | 3300034816 | Bacteria | 1621 |
| 249 | Ga0373948_0002304 | 3300034817 | Bacteria | 2801 |
| 250 | Ga0373958_0005545 | 3300034819 | Bacteria | 1923 |
| 251 | Ga0373938_0010258 | 3300034957 | Bacteria | 1717 |
| 252 | Ga0373928_0000667 | 3300035084 | Bacteria | 6748 |
| 253 | Ga0373929_0001181 | 3300035085 | Bacteria | 5044 |
| 254 | Ga0373940_0023457 | 3300035088 | Bacteria | 1592 |
| 255 | Ga0373949_0001022 | 3300035090 | Bacteria | 8629 |
| 256 | Ga0373951_0000437 | 3300035091 | Bacteria | 12172 |
| 257 | Ga0373952_0001181 | 3300035092 | Bacteria | 4766 |
| 258 | Ga0373932_0000260 | 3300035112 | Bacteria | 16071 |
| 259 | Ga0373939_0002507 | 3300035114 | Bacteria | 4326 |
| 260 | Ga0373939_0013054 | 3300035114 | Bacteria | 2130 |
| 261 | Ga0373941_0001741 | 3300035115 | Bacteria | 4674 |
| 262 | Ga0373941_0035857 | 3300035115 | Bacteria | 1505 |
| 263 | Ga0373953_0126301 | 3300035117 | Bacteria | 1089 |
| 264 | Ga0373960_0005132 | 3300035121 | Bacteria | 3020 |
| 265 | Ga0373946_0094790 | 3300035171 | Bacteria | 1329 |
| 266 | Ga0373942_0002033 | 3300035207 | Bacteria | 5023 |
| 267 | Ga0373961_0000739 | 3300035241 | Bacteria | 11301 |
| 268 | Ga0373924_0032754 | 3300035410 | Bacteria | 2095 |
| 269 | Ga0373931_0000499 | 3300035691 | Bacteria | 16005 |
| 270 | Ga0373931_0206031 | 3300035691 | Bacteria | 1177 |
| 271 | Ga0373935_0069255 | 3300035692 | Bacteria | 2272 |
| 272 | Ga0373927_0305458 | 3300035695 | Bacteria | 1047 |
| 273 | Ga0373933_0127409 | 3300035724 | Bacteria | 1598 |
| 274 | Ga0373947_0018033 | 3300035725 | Bacteria | 4062 |
| 275 | Ga0373937_0069370 | 3300036401 | Bacteria | 3250 |
| 276 | Ga0373925_0143985 | 3300037068 | Bacteria | 1867 |
| 277 | Ga0373925_0166252 | 3300037068 | Bacteria | 1740 |
| 278 | Ga0373925_0530467 | 3300037068 | Bacteria | 967 |
| 279 | Ga0439453_0017157 | 3300041408 | Bacteria | 1269 |
| 280 | Ga0439431_0000960 | 3300041997 | Bacteria | 6263 |
| 281 | Ga0439433_0005747 | 3300041999 | Bacteria | 2667 |
| 282 | Ga0439450_055852 | 3300042008 | Bacteria | 946 |
| 283 | Ga0439464_0004592 | 3300042439 | Bacteria | 3539 |
| 284 | Ga0451576_0027797 | 3300045051 | Bacteria | 6070 |
| 285 | Ga0451576_0042753 | 3300045051 | Bacteria | 4784 |
| 286 | Ga0495592_0119274 | 3300046454 | Bacteria | 1858 |
| 287 | Ga0495603_0075621 | 3300046455 | Bacteria | 1977 |
| 288 | Ga0495662_0146094 | 3300046476 | Bacteria | 1164 |
| 289 | Ga0495662_0179591 | 3300046476 | Bacteria | 1043 |
| 290 | Ga0495608_0035613 | 3300046511 | Bacteria | 3356 |
| 291 | Ga0495598_0054545 | 3300046537 | Bacteria | 1214 |
| 292 | Ga0495645_0045725 | 3300046543 | Bacteria | 3194 |
| 293 | Ga0495599_0200548 | 3300046678 | Bacteria | 1226 |
| 294 | Ga0495658_0010929 | 3300046683 | Bacteria | 4550 |
| 295 | Ga0495600_0120288 | 3300046809 | Bacteria | 1708 |
| 296 | Ga0495604_0282999 | 3300047317 | Unclassified | 1120 |
| 297 | Ga0495674_0085903 | 3300047319 | Bacteria | 2695 |
| 298 | Ga0496101_0168099 | 3300048904 | Bacteria | 1684 |
| 299 | Ga0496102_0017629 | 3300048905 | Bacteria | 6258 |
| 300 | Ga0496102_0048879 | 3300048905 | Bacteria | 3847 |
| 301 | Ga0496104_0005267 | 3300048907 | Bacteria | 11305 |
| 302 | Ga0496104_0169254 | 3300048907 | Bacteria | 2095 |
| 303 | Ga0496104_0270835 | 3300048907 | Bacteria | 1611 |
| 304 | Ga0496104_0532387 | 3300048907 | Bacteria | 1086 |
| 305 | Ga0496108_0002719 | 3300048911 | Bacteria | 14136 |
| 306 | Ga0496108_0044265 | 3300048911 | Bacteria | 3717 |
| 307 | Ga0496108_0103897 | 3300048911 | Bacteria | 2424 |
| 308 | Ga0496109_0000824 | 3300048912 | Bacteria | 25874 |
| 309 | Ga0496109_0058002 | 3300048912 | Bacteria | 3536 |
| 310 | Ga0496109_0163182 | 3300048912 | Bacteria | 2088 |
| 311 | Ga0496110_0000173 | 3300048913 | Bacteria | 39810 |
| 312 | Ga0496110_0079952 | 3300048913 | Bacteria | 2912 |
| 313 | Ga0496110_0104833 | 3300048913 | Bacteria | 2537 |
| 314 | Ga0496111_0112616 | 3300048914 | Bacteria | 2004 |
| 315 | Ga0496112_0002440 | 3300048915 | Bacteria | 14986 |
| 316 | Ga0496112_0020556 | 3300048915 | Bacteria | 6259 |
| 317 | Ga0496112_0092195 | 3300048915 | Bacteria | 2999 |
| 318 | Ga0496112_0337204 | 3300048915 | Bacteria | 1451 |
| 319 | Ga0496113_0197884 | 3300048916 | Bacteria | 1597 |
| 320 | Ga0496113_0203871 | 3300048916 | Bacteria | 1573 |
| 321 | Ga0496114_0090483 | 3300048917 | Bacteria | 2598 |
| 322 | Ga0496114_0142369 | 3300048917 | Bacteria | 2077 |
| 323 | Ga0496115_0148018 | 3300048918 | Bacteria | 1938 |
| 324 | Ga0501299_009981 | 3300049522 | Bacteria | 1577 |
| 325 | Ga0501034_0206714 | 3300049571 | Bacteria | 1919 |
| 326 | Ga0501036_0024197 | 3300049572 | Bacteria | 5119 |
| 327 | Ga0501036_0157054 | 3300049572 | Bacteria | 1918 |
| 328 | Ga0501038_0069731 | 3300049574 | Bacteria | 2986 |
| 329 | Ga0501038_0076961 | 3300049574 | Bacteria | 2818 |
| 330 | Ga0501039_0103043 | 3300049575 | Bacteria | 2228 |
| 331 | Ga0501039_0428948 | 3300049575 | Unclassified | 1038 |
| 332 | Ga0501040_0015889 | 3300049576 | Bacteria | 4976 |
| 333 | Ga0501040_0057741 | 3300049576 | Bacteria | 2665 |
| 334 | Ga0501040_0313076 | 3300049576 | Unclassified | 1122 |
| 335 | Ga0501041_0165389 | 3300049577 | Unclassified | 1383 |
| 336 | Ga0501042_0146095 | 3300049578 | Bacteria | 1705 |
| 337 | Ga0501042_0200374 | 3300049578 | Bacteria | 1439 |
| 338 | Ga0501042_0299312 | 3300049578 | Bacteria | 1162 |
| 339 | Ga0501043_0034695 | 3300049579 | Bacteria | 3968 |
| 340 | Ga0501046_0009901 | 3300049580 | Bacteria | 8212 |
| 341 | Ga0501046_0119049 | 3300049580 | Bacteria | 2011 |
| 342 | Ga0501048_0017593 | 3300049582 | Bacteria | 5263 |
| 343 | Ga0501048_0028806 | 3300049582 | Bacteria | 4031 |
| 344 | Ga0501048_0116800 | 3300049582 | Bacteria | 1885 |
| 345 | Ga0501048_0270664 | 3300049582 | Bacteria | 1207 |
| 346 | Ga0501067_0033115 | 3300049583 | Bacteria | 2868 |
| 347 | Ga0501068_0028922 | 3300049584 | Unclassified | 3280 |
| 348 | Ga0501071_0046330 | 3300049587 | Bacteria | 3123 |
| 349 | Ga0501071_0065675 | 3300049587 | Bacteria | 2635 |
| 350 | Ga0501071_0221086 | 3300049587 | Bacteria | 1425 |
| 351 | Ga0501071_0353649 | 3300049587 | Bacteria | 1118 |
| 352 | Ga0501072_0011382 | 3300049588 | Bacteria | 6799 |
| 353 | Ga0501072_0102127 | 3300049588 | Bacteria | 2279 |
| 354 | Ga0501073_0267671 | 3300049589 | Bacteria | 1179 |
| 355 | Ga0501075_0046976 | 3300049591 | Bacteria | 3244 |
| 356 | Ga0501075_0047634 | 3300049591 | Bacteria | 3221 |
| 357 | Ga0501075_0215193 | 3300049591 | Bacteria | 1465 |
| 358 | Ga0501076_0009434 | 3300049592 | Bacteria | 7207 |
| 359 | Ga0501076_0068140 | 3300049592 | Bacteria | 2842 |
| 360 | Ga0501077_0154043 | 3300049593 | Bacteria | 1458 |
| 361 | Ga0501233_035014 | 3300049668 | Bacteria | 1155 |
| 362 | Ga0501079_0026203 | 3300049741 | Bacteria | 4469 |
| 363 | Ga0501079_0468917 | 3300049741 | Bacteria | 989 |
| 364 | Ga0501080_0195389 | 3300049742 | Bacteria | 1858 |
| 365 | Ga0501080_0255038 | 3300049742 | Bacteria | 1599 |
| 366 | Ga0501080_0422652 | 3300049742 | Bacteria | 1197 |
| 367 | Ga0501081_0001723 | 3300049743 | Bacteria | 13581 |
| 368 | Ga0501035_0052943 | 3300049822 | Bacteria | 3631 |
| 369 | Ga0501044_0403730 | 3300049823 | Bacteria | 1279 |
| 370 | Ga0501045_0026100 | 3300049824 | Bacteria | 4200 |
| 371 | Ga0501045_0063197 | 3300049824 | Bacteria | 2716 |
| 372 | Ga0501045_0214527 | 3300049824 | Bacteria | 1433 |
| 373 | nmdc:mga03683_2319_c1 | 3300050489 | Bacteria | 5887 |
| 374 | nmdc:mga00v17_61150_c1 | 3300050491 | Bacteria | 2315 |
| 375 | nmdc:mga0k408_3217_c2 | 3300050493 | Bacteria | 5879 |
| 376 | nmdc:mga0k408_8796_c1 | 3300050493 | Bacteria | 5433 |
| 377 | nmdc:mga04h51_84397_c1 | 3300050495 | Bacteria | 1133 |
| 378 | nmdc:mga07m45_44387_c1 | 3300050496 | Bacteria | 2495 |
| 379 | nmdc:mga05p37_1014_c1 | 3300050507 | Bacteria | 31952 |
| 380 | nmdc:mga05p37_281750_c1 | 3300050507 | Bacteria | 1982 |
| 381 | nmdc:mga05p37_33124_c1 | 3300050507 | Bacteria | 6328 |
| 382 | nmdc:mga05p37_343270_c1 | 3300050507 | Bacteria | 1760 |
| 383 | nmdc:mga05p37_368807_c1 | 3300050507 | Bacteria | 1686 |
| 384 | nmdc:mga05p37_4374_c2 | 3300050507 | Bacteria | 15031 |
| 385 | nmdc:mga05p37_609295_c1 | 3300050507 | Bacteria | 1231 |
| 386 | nmdc:mga05p37_85235_c1 | 3300050507 | Bacteria | 3893 |
| 387 | nmdc:mga05p37_91_c1 | 3300050507 | Bacteria | 80826 |
| 388 | nmdc:mga09592_22030_c1 | 3300050508 | Bacteria | 5257 |
| 389 | nmdc:mga09592_52715_c1 | 3300050508 | Bacteria | 3433 |
| 390 | nmdc:mga0qj67_113593_c1 | 3300050509 | Bacteria | 2187 |
| 391 | nmdc:mga0qj67_4199_c1 | 3300050509 | Bacteria | 10434 |
| 392 | nmdc:mga0qj67_68537_c1 | 3300050509 | Bacteria | 2828 |
| 393 | nmdc:mga0qj67_9679_c1 | 3300050509 | Bacteria | 7179 |
| 394 | nmdc:mga06r32_18050_c1 | 3300050510 | Bacteria | 6451 |
| 395 | nmdc:mga06r32_244059_c1 | 3300050510 | Bacteria | 1783 |
| 396 | nmdc:mga08y16_106612_c1 | 3300050511 | Bacteria | 2917 |
| 397 | nmdc:mga08y16_130087_c1 | 3300050511 | Unclassified | 2618 |
| 398 | nmdc:mga08y16_152115_c1 | 3300050511 | Bacteria | 2405 |
| 399 | nmdc:mga08y16_387_c1 | 3300050511 | Bacteria | 40294 |
| 400 | nmdc:mga08y16_531864_c1 | 3300050511 | Bacteria | 1191 |
| 401 | nmdc:mga08y16_63128_c1 | 3300050511 | Unclassified | 3868 |
| 402 | nmdc:mga0n895_148750_c1 | 3300050512 | Bacteria | 2371 |
| 403 | nmdc:mga0n895_188078_c1 | 3300050512 | Bacteria | 2096 |
| 404 | nmdc:mga0n895_27791_c1 | 3300050512 | Bacteria | 5377 |
| 405 | nmdc:mga0n895_287836_c1 | 3300050512 | Bacteria | 1666 |
| 406 | nmdc:mga0n895_439147_c1 | 3300050512 | Unclassified | 1318 |
| 407 | nmdc:mga0rr50_23442_c1 | 3300050513 | Bacteria | 4257 |
| 408 | nmdc:mga0rr50_26985_c1 | 3300050513 | Bacteria | 4016 |
| 409 | nmdc:mga0rr50_45182_c1 | 3300050513 | Bacteria | 3235 |
| 410 | nmdc:mga0rr50_673_c1 | 3300050513 | Bacteria | 18292 |
| 411 | nmdc:mga08x19_108049_c1 | 3300050514 | Bacteria | 1853 |
| 412 | nmdc:mga0a205_14495_c1 | 3300050515 | Bacteria | 7354 |
| 413 | nmdc:mga0a205_347853_c1 | 3300050515 | Bacteria | 1350 |
| 414 | nmdc:mga0a205_5863_c1 | 3300050515 | Bacteria | 11064 |
| 415 | nmdc:mga0a205_73015_c1 | 3300050515 | Bacteria | 3315 |
| 416 | nmdc:mga0a205_8826_c1 | 3300050515 | Bacteria | 9180 |
| 417 | nmdc:mga0a205_95890_c1 | 3300050515 | Bacteria | 2865 |
| 418 | nmdc:mga0a205_95960_c1 | 3300050515 | Bacteria | 2864 |
| 419 | Ga0495619_0019689 | 3300053085 | Bacteria | 4293 |
| 420 | Ga0495619_0038074 | 3300053085 | Bacteria | 3136 |
| 421 | Ga0495619_0076630 | 3300053085 | Bacteria | 2245 |
| 422 | Ga0495619_0291524 | 3300053085 | Bacteria | 1130 |
| 423 | Ga0501084_0081458 | 3300054114 | Bacteria | 2715 |
| 424 | Ga0501084_0137664 | 3300054114 | Bacteria | 2055 |
| 425 | Ga0501082_0243801 | 3300060353 | Bacteria | 1564 |
| 426 | Ga0501082_0344075 | 3300060353 | Bacteria | 1299 |
| 427 | Ga0501082_0350426 | 3300060353 | Bacteria | 1287 |
| 428 | Ga0530510_0252080 | 3300061734 | Unclassified | 1315 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042008 | Ga0439450_055852 | Ga0439450_055852_16_900 | 277 |
| 2 | 3300035695 | Ga0373927_0305458 | Ga0373927_0305458_12_875 | 287 |
| 3 | 3300037068 | Ga0373925_0530467 | Ga0373925_0530467_52_915 | 287 |
| 4 | 3300047317 | Ga0495604_0282999 | Ga0495604_0282999_234_1097 | 287 |
| 5 | 3300049741 | Ga0501079_0468917 | Ga0501079_0468917_20_901 | 287 |
| 6 | 3300053085 | Ga0495619_0291524 | Ga0495619_0291524_253_1119 | 287 |
| 7 | 3300049587 | Ga0501071_0221086 | Ga0501071_0221086_34_960 | 301 |
| 8 | 3300006844 | Ga0075428_100000865 | Ga0075428_1000008657 | 307 |
| 9 | 3300009094 | Ga0111539_10003820 | Ga0111539_100038202 | 307 |
| 10 | 3300009147 | Ga0114129_10000076 | Ga0114129_1000007634 | 307 |
| 11 | 3300050507 | nmdc:mga05p37_91_c1 | nmdc:mga05p37_91_c1_66921_67895 | 307 |
| 12 | 3300050508 | nmdc:mga09592_22030_c1 | nmdc:mga09592_22030_c1_2829_3803 | 307 |
| 13 | 3300050509 | nmdc:mga0qj67_68537_c1 | nmdc:mga0qj67_68537_c1_187_1161 | 307 |
| 14 | 3300050511 | nmdc:mga08y16_387_c1 | nmdc:mga08y16_387_c1_29674_30648 | 307 |
| 15 | 3300046476 | Ga0495662_0179591 | Ga0495662_0179591_101_1030 | 308 |
| 16 | 3300009094 | Ga0111539_10133435 | Ga0111539_101334352 | 310 |
| 17 | 3300027907 | Ga0207428_10098459 | Ga0207428_100984593 | 310 |
| 18 | 3300050511 | nmdc:mga08y16_106612_c1 | nmdc:mga08y16_106612_c1_1315_2373 | 310 |
| 19 | 3300005331 | Ga0070670_100069025 | Ga0070670_1000690251 | 312 |
| 20 | 3300025925 | Ga0207650_10210499 | Ga0207650_102104992 | 312 |
| 21 | 3300041408 | Ga0439453_0017157 | Ga0439453_0017157_271_1215 | 313 |
| 22 | 3300002459 | JGI24751J29686_10004094 | JGI24751J29686_100040942 | 314 |
| 23 | 3300005436 | Ga0070713_100151946 | Ga0070713_1001519462 | 314 |
| 24 | 3300005548 | Ga0070665_100012476 | Ga0070665_1000124761 | 314 |
| 25 | 3300005548 | Ga0070665_100538835 | Ga0070665_1005388351 | 314 |
| 26 | 3300005842 | Ga0068858_100012005 | Ga0068858_1000120054 | 314 |
| 27 | 3300006173 | Ga0070716_100073686 | Ga0070716_1000736863 | 314 |
| 28 | 3300006237 | Ga0097621_100025619 | Ga0097621_1000256192 | 314 |
| 29 | 3300006358 | Ga0068871_100002793 | Ga0068871_1000027937 | 314 |
| 30 | 3300006846 | Ga0075430_100017727 | Ga0075430_1000177276 | 314 |
| 31 | 3300006847 | Ga0075431_100010327 | Ga0075431_1000103273 | 314 |
| 32 | 3300006852 | Ga0075433_10004871 | Ga0075433_100048718 | 314 |
| 33 | 3300006880 | Ga0075429_100003645 | Ga0075429_1000036457 | 314 |
| 34 | 3300006881 | Ga0068865_100004678 | Ga0068865_1000046789 | 314 |
| 35 | 3300009098 | Ga0105245_10136225 | Ga0105245_101362253 | 314 |
| 36 | 3300009147 | Ga0114129_10000973 | Ga0114129_1000097324 | 314 |
| 37 | 3300009176 | Ga0105242_10019556 | Ga0105242_100195565 | 314 |
| 38 | 3300009177 | Ga0105248_10722663 | Ga0105248_107226631 | 314 |
| 39 | 3300009553 | Ga0105249_10395811 | Ga0105249_103958112 | 314 |
| 40 | 3300014325 | Ga0163163_10374113 | Ga0163163_103741131 | 314 |
| 41 | 3300014969 | Ga0157376_10085986 | Ga0157376_100859864 | 314 |
| 42 | 3300014969 | Ga0157376_10224652 | Ga0157376_102246522 | 314 |
| 43 | 3300026035 | Ga0207703_10036045 | Ga0207703_100360455 | 314 |
| 44 | 3300026035 | Ga0207703_10352103 | Ga0207703_103521032 | 314 |
| 45 | 3300026089 | Ga0207648_10076494 | Ga0207648_100764942 | 314 |
| 46 | 3300027907 | Ga0207428_10000797 | Ga0207428_100007973 | 314 |
| 47 | 3300028381 | Ga0268264_10049807 | Ga0268264_100498073 | 314 |
| 48 | 3300031548 | Ga0307408_100015554 | Ga0307408_1000155546 | 314 |
| 49 | 3300031548 | Ga0307408_100024932 | Ga0307408_1000249323 | 314 |
| 50 | 3300032002 | Ga0307416_100021319 | Ga0307416_1000213193 | 314 |
| 51 | 3300032005 | Ga0307411_10031183 | Ga0307411_100311832 | 314 |
| 52 | 3300032126 | Ga0307415_100358740 | Ga0307415_1003587401 | 314 |
| 53 | 3300035410 | Ga0373924_0032754 | Ga0373924_0032754_628_1572 | 314 |
| 54 | 3300036401 | Ga0373937_0069370 | Ga0373937_0069370_1188_2132 | 314 |
| 55 | 3300042439 | Ga0439464_0004592 | Ga0439464_0004592_666_1640 | 314 |
| 56 | 3300046543 | Ga0495645_0045725 | Ga0495645_0045725_22_966 | 314 |
| 57 | 3300046683 | Ga0495658_0010929 | Ga0495658_0010929_1883_2827 | 314 |
| 58 | 3300046809 | Ga0495600_0120288 | Ga0495600_0120288_370_1314 | 314 |
| 59 | 3300047319 | Ga0495674_0085903 | Ga0495674_0085903_1011_1955 | 314 |
| 60 | 3300048907 | Ga0496104_0532387 | Ga0496104_0532387_109_1053 | 314 |
| 61 | 3300048915 | Ga0496112_0092195 | Ga0496112_0092195_423_1367 | 314 |
| 62 | 3300048916 | Ga0496113_0203871 | Ga0496113_0203871_77_1021 | 314 |
| 63 | 3300048917 | Ga0496114_0090483 | Ga0496114_0090483_1629_2579 | 314 |
| 64 | 3300049522 | Ga0501299_009981 | Ga0501299_009981_74_1081 | 314 |
| 65 | 3300049572 | Ga0501036_0024197 | Ga0501036_0024197_3963_4907 | 314 |
| 66 | 3300049574 | Ga0501038_0076961 | Ga0501038_0076961_1332_2276 | 314 |
| 67 | 3300049575 | Ga0501039_0428948 | Ga0501039_0428948_70_1014 | 314 |
| 68 | 3300049576 | Ga0501040_0313076 | Ga0501040_0313076_162_1106 | 314 |
| 69 | 3300049577 | Ga0501041_0165389 | Ga0501041_0165389_208_1152 | 314 |
| 70 | 3300049578 | Ga0501042_0200374 | Ga0501042_0200374_233_1177 | 314 |
| 71 | 3300049579 | Ga0501043_0034695 | Ga0501043_0034695_2277_3221 | 314 |
| 72 | 3300049580 | Ga0501046_0009901 | Ga0501046_0009901_110_1054 | 314 |
| 73 | 3300049582 | Ga0501048_0028806 | Ga0501048_0028806_748_1692 | 314 |
| 74 | 3300049584 | Ga0501068_0028922 | Ga0501068_0028922_368_1312 | 314 |
| 75 | 3300049587 | Ga0501071_0065675 | Ga0501071_0065675_1555_2499 | 314 |
| 76 | 3300049588 | Ga0501072_0102127 | Ga0501072_0102127_166_1110 | 314 |
| 77 | 3300049591 | Ga0501075_0215193 | Ga0501075_0215193_187_1131 | 314 |
| 78 | 3300049592 | Ga0501076_0009434 | Ga0501076_0009434_768_1712 | 314 |
| 79 | 3300049593 | Ga0501077_0154043 | Ga0501077_0154043_102_1046 | 314 |
| 80 | 3300049741 | Ga0501079_0026203 | Ga0501079_0026203_179_1123 | 314 |
| 81 | 3300049742 | Ga0501080_0255038 | Ga0501080_0255038_237_1181 | 314 |
| 82 | 3300049743 | Ga0501081_0001723 | Ga0501081_0001723_11631_12575 | 314 |
| 83 | 3300049822 | Ga0501035_0052943 | Ga0501035_0052943_2351_3295 | 314 |
| 84 | 3300049824 | Ga0501045_0214527 | Ga0501045_0214527_179_1123 | 314 |
| 85 | 3300054114 | Ga0501084_0137664 | Ga0501084_0137664_887_1831 | 314 |
| 86 | 3300060353 | Ga0501082_0344075 | Ga0501082_0344075_136_1080 | 314 |
| 87 | 3300061734 | Ga0530510_0252080 | Ga0530510_0252080_236_1180 | 314 |
| 88 | 3300035171 | Ga0373946_0094790 | Ga0373946_0094790_267_1226 | 319 |
| 89 | 3300048915 | Ga0496112_0337204 | Ga0496112_0337204_179_1138 | 319 |
| 90 | 3300005290 | Ga0065712_10080398 | Ga0065712_100803983 | 320 |
| 91 | 3300005293 | Ga0065715_10002603 | Ga0065715_100026032 | 320 |
| 92 | 3300005293 | Ga0065715_10127086 | Ga0065715_101270861 | 320 |
| 93 | 3300005295 | Ga0065707_10119652 | Ga0065707_101196523 | 320 |
| 94 | 3300005329 | Ga0070683_100011332 | Ga0070683_1000113326 | 320 |
| 95 | 3300005329 | Ga0070683_100048998 | Ga0070683_1000489984 | 320 |
| 96 | 3300005344 | Ga0070661_100129984 | Ga0070661_1001299842 | 320 |
| 97 | 3300005353 | Ga0070669_100003679 | Ga0070669_10000367910 | 320 |
| 98 | 3300005355 | Ga0070671_100018521 | Ga0070671_1000185212 | 320 |
| 99 | 3300005535 | Ga0070684_100063056 | Ga0070684_1000630562 | 320 |
| 100 | 3300005547 | Ga0070693_100005285 | Ga0070693_1000052856 | 320 |
| 101 | 3300005564 | Ga0070664_100000163 | Ga0070664_10000016317 | 320 |
| 102 | 3300005577 | Ga0068857_100015109 | Ga0068857_1000151095 | 320 |
| 103 | 3300005844 | Ga0068862_100040480 | Ga0068862_1000404802 | 320 |
| 104 | 3300006038 | Ga0075365_10029970 | Ga0075365_100299703 | 320 |
| 105 | 3300006042 | Ga0075368_10014910 | Ga0075368_100149102 | 320 |
| 106 | 3300006051 | Ga0075364_10014158 | Ga0075364_100141584 | 320 |
| 107 | 3300006051 | Ga0075364_10027912 | Ga0075364_100279122 | 320 |
| 108 | 3300006177 | Ga0075362_10006433 | Ga0075362_100064334 | 320 |
| 109 | 3300006195 | Ga0075366_10006971 | Ga0075366_100069717 | 320 |
| 110 | 3300006844 | Ga0075428_100015779 | Ga0075428_1000157795 | 320 |
| 111 | 3300006847 | Ga0075431_100026582 | Ga0075431_1000265825 | 320 |
| 112 | 3300006852 | Ga0075433_10083393 | Ga0075433_100833932 | 320 |
| 113 | 3300006871 | Ga0075434_100147871 | Ga0075434_1001478712 | 320 |
| 114 | 3300006880 | Ga0075429_100103847 | Ga0075429_1001038474 | 320 |
| 115 | 3300007076 | Ga0075435_100054796 | Ga0075435_1000547962 | 320 |
| 116 | 3300009094 | Ga0111539_10010872 | Ga0111539_100108722 | 320 |
| 117 | 3300009094 | Ga0111539_10116951 | Ga0111539_101169511 | 320 |
| 118 | 3300009094 | Ga0111539_10259112 | Ga0111539_102591123 | 320 |
| 119 | 3300009094 | Ga0111539_10312790 | Ga0111539_103127902 | 320 |
| 120 | 3300009147 | Ga0114129_10047615 | Ga0114129_100476155 | 320 |
| 121 | 3300009553 | Ga0105249_10000796 | Ga0105249_100007969 | 320 |
| 122 | 3300009553 | Ga0105249_10341407 | Ga0105249_103414072 | 320 |
| 123 | 3300014325 | Ga0163163_10011542 | Ga0163163_100115423 | 320 |
| 124 | 3300025315 | Ga0207697_10031722 | Ga0207697_100317222 | 320 |
| 125 | 3300025920 | Ga0207649_10101284 | Ga0207649_101012842 | 320 |
| 126 | 3300025923 | Ga0207681_10024833 | Ga0207681_100248332 | 320 |
| 127 | 3300025925 | Ga0207650_10050350 | Ga0207650_100503503 | 320 |
| 128 | 3300025931 | Ga0207644_10090993 | Ga0207644_100909932 | 320 |
| 129 | 3300025944 | Ga0207661_10032033 | Ga0207661_100320332 | 320 |
| 130 | 3300025945 | Ga0207679_10011000 | Ga0207679_100110004 | 320 |
| 131 | 3300027907 | Ga0207428_10092274 | Ga0207428_100922742 | 320 |
| 132 | 3300028380 | Ga0268265_10030826 | Ga0268265_100308264 | 320 |
| 133 | 3300048907 | Ga0496104_0005267 | Ga0496104_0005267_3694_4656 | 320 |
| 134 | 3300048911 | Ga0496108_0002719 | Ga0496108_0002719_9555_10517 | 320 |
| 135 | 3300048912 | Ga0496109_0000824 | Ga0496109_0000824_17968_18930 | 320 |
| 136 | 3300048913 | Ga0496110_0000173 | Ga0496110_0000173_36429_37391 | 320 |
| 137 | 3300048915 | Ga0496112_0002440 | Ga0496112_0002440_1024_1986 | 320 |
| 138 | 3300049824 | Ga0501045_0026100 | Ga0501045_0026100_2815_3840 | 320 |
| 139 | 3300050489 | nmdc:mga03683_2319_c1 | nmdc:mga03683_2319_c1_4841_5866 | 320 |
| 140 | 3300050491 | nmdc:mga00v17_61150_c1 | nmdc:mga00v17_61150_c1_805_1830 | 320 |
| 141 | 3300050493 | nmdc:mga0k408_3217_c2 | nmdc:mga0k408_3217_c2_889_1914 | 320 |
| 142 | 3300050493 | nmdc:mga0k408_8796_c1 | nmdc:mga0k408_8796_c1_3412_4437 | 320 |
| 143 | 3300050495 | nmdc:mga04h51_84397_c1 | nmdc:mga04h51_84397_c1_30_992 | 320 |
| 144 | 3300050496 | nmdc:mga07m45_44387_c1 | nmdc:mga07m45_44387_c1_1131_2156 | 320 |
| 145 | 3300050507 | nmdc:mga05p37_281750_c1 | nmdc:mga05p37_281750_c1_945_1907 | 320 |
| 146 | 3300050510 | nmdc:mga06r32_18050_c1 | nmdc:mga06r32_18050_c1_2262_3287 | 320 |
| 147 | 3300050511 | nmdc:mga08y16_130087_c1 | nmdc:mga08y16_130087_c1_1406_2431 | 320 |
| 148 | 3300050511 | nmdc:mga08y16_531864_c1 | nmdc:mga08y16_531864_c1_83_1045 | 320 |
| 149 | 3300050511 | nmdc:mga08y16_63128_c1 | nmdc:mga08y16_63128_c1_1173_2198 | 320 |
| 150 | 3300050512 | nmdc:mga0n895_148750_c1 | nmdc:mga0n895_148750_c1_497_1522 | 320 |
| 151 | 3300050512 | nmdc:mga0n895_188078_c1 | nmdc:mga0n895_188078_c1_1115_2077 | 320 |
| 152 | 3300050512 | nmdc:mga0n895_439147_c1 | nmdc:mga0n895_439147_c1_256_1281 | 320 |
| 153 | 3300050513 | nmdc:mga0rr50_45182_c1 | nmdc:mga0rr50_45182_c1_2023_3048 | 320 |
| 154 | 3300050515 | nmdc:mga0a205_5863_c1 | nmdc:mga0a205_5863_c1_5408_6433 | 320 |
| 155 | 3300050515 | nmdc:mga0a205_95960_c1 | nmdc:mga0a205_95960_c1_542_1567 | 320 |
| 156 | 2162886011 | MRS1b_contig_2782814 | MRS1b_0626.00000900 | 321 |
| 157 | 3300005290 | Ga0065712_10082128 | Ga0065712_100821282 | 321 |
| 158 | 3300005293 | Ga0065715_10019668 | Ga0065715_100196682 | 321 |
| 159 | 3300005295 | Ga0065707_10226284 | Ga0065707_102262841 | 321 |
| 160 | 3300005328 | Ga0070676_10037313 | Ga0070676_100373133 | 321 |
| 161 | 3300005330 | Ga0070690_100016427 | Ga0070690_1000164275 | 321 |
| 162 | 3300005331 | Ga0070670_100006131 | Ga0070670_1000061316 | 321 |
| 163 | 3300005331 | Ga0070670_100017684 | Ga0070670_1000176843 | 321 |
| 164 | 3300005331 | Ga0070670_100251413 | Ga0070670_1002514131 | 321 |
| 165 | 3300005334 | Ga0068869_100006316 | Ga0068869_1000063165 | 321 |
| 166 | 3300005335 | Ga0070666_10014454 | Ga0070666_100144542 | 321 |
| 167 | 3300005335 | Ga0070666_10231665 | Ga0070666_102316651 | 321 |
| 168 | 3300005336 | Ga0070680_100047016 | Ga0070680_1000470164 | 321 |
| 169 | 3300005339 | Ga0070660_100284580 | Ga0070660_1002845802 | 321 |
| 170 | 3300005340 | Ga0070689_100012244 | Ga0070689_1000122446 | 321 |
| 171 | 3300005341 | Ga0070691_10021813 | Ga0070691_100218134 | 321 |
| 172 | 3300005343 | Ga0070687_100047971 | Ga0070687_1000479711 | 321 |
| 173 | 3300005345 | Ga0070692_10041738 | Ga0070692_100417383 | 321 |
| 174 | 3300005353 | Ga0070669_100206277 | Ga0070669_1002062771 | 321 |
| 175 | 3300005354 | Ga0070675_100004928 | Ga0070675_10000492811 | 321 |
| 176 | 3300005354 | Ga0070675_100117888 | Ga0070675_1001178882 | 321 |
| 177 | 3300005355 | Ga0070671_100011793 | Ga0070671_1000117936 | 321 |
| 178 | 3300005356 | Ga0070674_100011399 | Ga0070674_1000113995 | 321 |
| 179 | 3300005356 | Ga0070674_100031663 | Ga0070674_1000316633 | 321 |
| 180 | 3300005364 | Ga0070673_100004033 | Ga0070673_1000040336 | 321 |
| 181 | 3300005364 | Ga0070673_100036395 | Ga0070673_1000363953 | 321 |
| 182 | 3300005366 | Ga0070659_100163113 | Ga0070659_1001631133 | 321 |
| 183 | 3300005439 | Ga0070711_100268977 | Ga0070711_1002689771 | 321 |
| 184 | 3300005441 | Ga0070700_100029773 | Ga0070700_1000297731 | 321 |
| 185 | 3300005458 | Ga0070681_10011426 | Ga0070681_100114264 | 321 |
| 186 | 3300005459 | Ga0068867_100008307 | Ga0068867_1000083076 | 321 |
| 187 | 3300005530 | Ga0070679_100122824 | Ga0070679_1001228243 | 321 |
| 188 | 3300005530 | Ga0070679_100438563 | Ga0070679_1004385632 | 321 |
| 189 | 3300005543 | Ga0070672_100019602 | Ga0070672_1000196025 | 321 |
| 190 | 3300005544 | Ga0070686_100001249 | Ga0070686_10000124913 | 321 |
| 191 | 3300005548 | Ga0070665_100007922 | Ga0070665_1000079229 | 321 |
| 192 | 3300005548 | Ga0070665_100066304 | Ga0070665_1000663043 | 321 |
| 193 | 3300005564 | Ga0070664_100041475 | Ga0070664_1000414753 | 321 |
| 194 | 3300005577 | Ga0068857_100010905 | Ga0068857_1000109055 | 321 |
| 195 | 3300005578 | Ga0068854_100080885 | Ga0068854_1000808853 | 321 |
| 196 | 3300005616 | Ga0068852_100045249 | Ga0068852_1000452493 | 321 |
| 197 | 3300005618 | Ga0068864_100008563 | Ga0068864_1000085634 | 321 |
| 198 | 3300005718 | Ga0068866_10003380 | Ga0068866_100033804 | 321 |
| 199 | 3300005719 | Ga0068861_100067241 | Ga0068861_1000672414 | 321 |
| 200 | 3300005719 | Ga0068861_100217320 | Ga0068861_1002173202 | 321 |
| 201 | 3300005841 | Ga0068863_100174089 | Ga0068863_1001740892 | 321 |
| 202 | 3300005842 | Ga0068858_100018512 | Ga0068858_1000185123 | 321 |
| 203 | 3300005843 | Ga0068860_100146411 | Ga0068860_1001464111 | 321 |
| 204 | 3300006028 | Ga0070717_10355112 | Ga0070717_103551122 | 321 |
| 205 | 3300006042 | Ga0075368_10005104 | Ga0075368_100051043 | 321 |
| 206 | 3300006178 | Ga0075367_10056358 | Ga0075367_100563582 | 321 |
| 207 | 3300006195 | Ga0075366_10021123 | Ga0075366_100211232 | 321 |
| 208 | 3300006844 | Ga0075428_100018567 | Ga0075428_1000185674 | 321 |
| 209 | 3300006846 | Ga0075430_100018331 | Ga0075430_1000183313 | 321 |
| 210 | 3300006846 | Ga0075430_100061891 | Ga0075430_1000618912 | 321 |
| 211 | 3300006846 | Ga0075430_100083775 | Ga0075430_1000837752 | 321 |
| 212 | 3300006852 | Ga0075433_10027110 | Ga0075433_100271105 | 321 |
| 213 | 3300006852 | Ga0075433_10176549 | Ga0075433_101765492 | 321 |
| 214 | 3300006852 | Ga0075433_10230380 | Ga0075433_102303802 | 321 |
| 215 | 3300006871 | Ga0075434_100003115 | Ga0075434_10000311512 | 321 |
| 216 | 3300006871 | Ga0075434_100030631 | Ga0075434_1000306316 | 321 |
| 217 | 3300006871 | Ga0075434_100113581 | Ga0075434_1001135812 | 321 |
| 218 | 3300006880 | Ga0075429_100114323 | Ga0075429_1001143232 | 321 |
| 219 | 3300007076 | Ga0075435_100006656 | Ga0075435_1000066568 | 321 |
| 220 | 3300007076 | Ga0075435_100013180 | Ga0075435_1000131803 | 321 |
| 221 | 3300007076 | Ga0075435_100059349 | Ga0075435_1000593492 | 321 |
| 222 | 3300009093 | Ga0105240_10007971 | Ga0105240_100079718 | 321 |
| 223 | 3300009093 | Ga0105240_10231775 | Ga0105240_102317752 | 321 |
| 224 | 3300009093 | Ga0105240_10491360 | Ga0105240_104913602 | 321 |
| 225 | 3300009098 | Ga0105245_10020467 | Ga0105245_100204677 | 321 |
| 226 | 3300009101 | Ga0105247_10020269 | Ga0105247_100202693 | 321 |
| 227 | 3300009101 | Ga0105247_10061636 | Ga0105247_100616362 | 321 |
| 228 | 3300009147 | Ga0114129_10001069 | Ga0114129_1000106933 | 321 |
| 229 | 3300009147 | Ga0114129_10017015 | Ga0114129_100170158 | 321 |
| 230 | 3300009147 | Ga0114129_10032236 | Ga0114129_100322367 | 321 |
| 231 | 3300009147 | Ga0114129_10039413 | Ga0114129_100394136 | 321 |
| 232 | 3300009147 | Ga0114129_10788467 | Ga0114129_107884672 | 321 |
| 233 | 3300009174 | Ga0105241_10039422 | Ga0105241_100394221 | 321 |
| 234 | 3300009174 | Ga0105241_10058203 | Ga0105241_100582032 | 321 |
| 235 | 3300009176 | Ga0105242_10007403 | Ga0105242_100074032 | 321 |
| 236 | 3300009176 | Ga0105242_10067044 | Ga0105242_100670443 | 321 |
| 237 | 3300009177 | Ga0105248_10048515 | Ga0105248_100485151 | 321 |
| 238 | 3300009177 | Ga0105248_10058376 | Ga0105248_100583765 | 321 |
| 239 | 3300009177 | Ga0105248_10107154 | Ga0105248_101071544 | 321 |
| 240 | 3300009177 | Ga0105248_10540828 | Ga0105248_105408281 | 321 |
| 241 | 3300009177 | Ga0105248_10639817 | Ga0105248_106398171 | 321 |
| 242 | 3300009553 | Ga0105249_10444965 | Ga0105249_104449652 | 321 |
| 243 | 3300010375 | Ga0105239_10088428 | Ga0105239_100884282 | 321 |
| 244 | 3300013296 | Ga0157374_10043351 | Ga0157374_100433511 | 321 |
| 245 | 3300013297 | Ga0157378_10133295 | Ga0157378_101332952 | 321 |
| 246 | 3300013307 | Ga0157372_10080668 | Ga0157372_100806685 | 321 |
| 247 | 3300013307 | Ga0157372_10305951 | Ga0157372_103059512 | 321 |
| 248 | 3300013308 | Ga0157375_10849072 | Ga0157375_108490721 | 321 |
| 249 | 3300014325 | Ga0163163_10063826 | Ga0163163_100638265 | 321 |
| 250 | 3300014326 | Ga0157380_10023556 | Ga0157380_100235565 | 321 |
| 251 | 3300014326 | Ga0157380_10115114 | Ga0157380_101151141 | 321 |
| 252 | 3300014968 | Ga0157379_10011356 | Ga0157379_100113569 | 321 |
| 253 | 3300014968 | Ga0157379_10019175 | Ga0157379_100191756 | 321 |
| 254 | 3300014968 | Ga0157379_10115860 | Ga0157379_101158602 | 321 |
| 255 | 3300014969 | Ga0157376_10012899 | Ga0157376_100128995 | 321 |
| 256 | 3300014969 | Ga0157376_10029487 | Ga0157376_100294874 | 321 |
| 257 | 3300025893 | Ga0207682_10025605 | Ga0207682_100256052 | 321 |
| 258 | 3300025899 | Ga0207642_10005530 | Ga0207642_100055302 | 321 |
| 259 | 3300025900 | Ga0207710_10009810 | Ga0207710_100098104 | 321 |
| 260 | 3300025901 | Ga0207688_10012350 | Ga0207688_100123505 | 321 |
| 261 | 3300025901 | Ga0207688_10060450 | Ga0207688_100604503 | 321 |
| 262 | 3300025903 | Ga0207680_10087401 | Ga0207680_100874013 | 321 |
| 263 | 3300025903 | Ga0207680_10117267 | Ga0207680_101172672 | 321 |
| 264 | 3300025907 | Ga0207645_10062601 | Ga0207645_100626013 | 321 |
| 265 | 3300025911 | Ga0207654_10043032 | Ga0207654_100430324 | 321 |
| 266 | 3300025913 | Ga0207695_10104626 | Ga0207695_101046264 | 321 |
| 267 | 3300025918 | Ga0207662_10001397 | Ga0207662_100013976 | 321 |
| 268 | 3300025921 | Ga0207652_10190745 | Ga0207652_101907452 | 321 |
| 269 | 3300025925 | Ga0207650_10009789 | Ga0207650_100097892 | 321 |
| 270 | 3300025925 | Ga0207650_10016918 | Ga0207650_100169186 | 321 |
| 271 | 3300025925 | Ga0207650_10120689 | Ga0207650_101206893 | 321 |
| 272 | 3300025926 | Ga0207659_10000637 | Ga0207659_1000063720 | 321 |
| 273 | 3300025926 | Ga0207659_10133145 | Ga0207659_101331453 | 321 |
| 274 | 3300025927 | Ga0207687_10108704 | Ga0207687_101087042 | 321 |
| 275 | 3300025932 | Ga0207690_10160025 | Ga0207690_101600252 | 321 |
| 276 | 3300025933 | Ga0207706_10163082 | Ga0207706_101630822 | 321 |
| 277 | 3300025934 | Ga0207686_10013332 | Ga0207686_100133321 | 321 |
| 278 | 3300025934 | Ga0207686_10062164 | Ga0207686_100621642 | 321 |
| 279 | 3300025936 | Ga0207670_10034094 | Ga0207670_100340944 | 321 |
| 280 | 3300025937 | Ga0207669_10067752 | Ga0207669_100677523 | 321 |
| 281 | 3300025940 | Ga0207691_10014887 | Ga0207691_100148875 | 321 |
| 282 | 3300025941 | Ga0207711_10016817 | Ga0207711_100168176 | 321 |
| 283 | 3300025941 | Ga0207711_10502449 | Ga0207711_105024492 | 321 |
| 284 | 3300025942 | Ga0207689_10018657 | Ga0207689_100186576 | 321 |
| 285 | 3300025942 | Ga0207689_10023982 | Ga0207689_100239822 | 321 |
| 286 | 3300025960 | Ga0207651_10037343 | Ga0207651_100373432 | 321 |
| 287 | 3300025960 | Ga0207651_10059348 | Ga0207651_100593482 | 321 |
| 288 | 3300025981 | Ga0207640_10158573 | Ga0207640_101585732 | 321 |
| 289 | 3300025986 | Ga0207658_10147003 | Ga0207658_101470032 | 321 |
| 290 | 3300026075 | Ga0207708_10114552 | Ga0207708_101145522 | 321 |
| 291 | 3300026088 | Ga0207641_10219824 | Ga0207641_102198242 | 321 |
| 292 | 3300026089 | Ga0207648_10105001 | Ga0207648_101050013 | 321 |
| 293 | 3300026089 | Ga0207648_10116998 | Ga0207648_101169983 | 321 |
| 294 | 3300026089 | Ga0207648_10400018 | Ga0207648_104000182 | 321 |
| 295 | 3300026095 | Ga0207676_10038195 | Ga0207676_100381954 | 321 |
| 296 | 3300026116 | Ga0207674_10017271 | Ga0207674_100172712 | 321 |
| 297 | 3300026116 | Ga0207674_10067564 | Ga0207674_100675643 | 321 |
| 298 | 3300026116 | Ga0207674_10138960 | Ga0207674_101389603 | 321 |
| 299 | 3300026118 | Ga0207675_100042523 | Ga0207675_1000425232 | 321 |
| 300 | 3300026118 | Ga0207675_100056439 | Ga0207675_1000564393 | 321 |
| 301 | 3300026118 | Ga0207675_100173170 | Ga0207675_1001731702 | 321 |
| 302 | 3300026121 | Ga0207683_10061290 | Ga0207683_100612902 | 321 |
| 303 | 3300026121 | Ga0207683_10093241 | Ga0207683_100932412 | 321 |
| 304 | 3300026121 | Ga0207683_10205889 | Ga0207683_102058891 | 321 |
| 305 | 3300028379 | Ga0268266_10027582 | Ga0268266_100275825 | 321 |
| 306 | 3300028379 | Ga0268266_10037300 | Ga0268266_100373004 | 321 |
| 307 | 3300028379 | Ga0268266_10114017 | Ga0268266_101140172 | 321 |
| 308 | 3300028380 | Ga0268265_10147174 | Ga0268265_101471742 | 321 |
| 309 | 3300028380 | Ga0268265_10379624 | Ga0268265_103796242 | 321 |
| 310 | 3300028381 | Ga0268264_10041771 | Ga0268264_100417715 | 321 |
| 311 | 3300031711 | Ga0265314_10111206 | Ga0265314_101112062 | 321 |
| 312 | 3300031852 | Ga0307410_10305995 | Ga0307410_103059952 | 321 |
| 313 | 3300031911 | Ga0307412_10134368 | Ga0307412_101343682 | 321 |
| 314 | 3300031995 | Ga0307409_100136873 | Ga0307409_1001368732 | 321 |
| 315 | 3300032002 | Ga0307416_100024132 | Ga0307416_1000241322 | 321 |
| 316 | 3300032002 | Ga0307416_100067581 | Ga0307416_1000675813 | 321 |
| 317 | 3300032002 | Ga0307416_100141303 | Ga0307416_1001413032 | 321 |
| 318 | 3300032002 | Ga0307416_100264039 | Ga0307416_1002640392 | 321 |
| 319 | 3300032002 | Ga0307416_100375120 | Ga0307416_1003751201 | 321 |
| 320 | 3300032002 | Ga0307416_100632207 | Ga0307416_1006322071 | 321 |
| 321 | 3300032126 | Ga0307415_100078248 | Ga0307415_1000782482 | 321 |
| 322 | 3300034816 | Ga0373930_0011115 | Ga0373930_0011115_32_997 | 321 |
| 323 | 3300034817 | Ga0373948_0002304 | Ga0373948_0002304_437_1402 | 321 |
| 324 | 3300034819 | Ga0373958_0005545 | Ga0373958_0005545_63_1028 | 321 |
| 325 | 3300034957 | Ga0373938_0010258 | Ga0373938_0010258_556_1521 | 321 |
| 326 | 3300035084 | Ga0373928_0000667 | Ga0373928_0000667_5754_6719 | 321 |
| 327 | 3300035085 | Ga0373929_0001181 | Ga0373929_0001181_3742_4707 | 321 |
| 328 | 3300035088 | Ga0373940_0023457 | Ga0373940_0023457_478_1443 | 321 |
| 329 | 3300035090 | Ga0373949_0001022 | Ga0373949_0001022_7604_8569 | 321 |
| 330 | 3300035091 | Ga0373951_0000437 | Ga0373951_0000437_4653_5618 | 321 |
| 331 | 3300035092 | Ga0373952_0001181 | Ga0373952_0001181_279_1244 | 321 |
| 332 | 3300035112 | Ga0373932_0000260 | Ga0373932_0000260_12389_13354 | 321 |
| 333 | 3300035114 | Ga0373939_0002507 | Ga0373939_0002507_443_1408 | 321 |
| 334 | 3300035114 | Ga0373939_0013054 | Ga0373939_0013054_787_1752 | 321 |
| 335 | 3300035115 | Ga0373941_0001741 | Ga0373941_0001741_1709_2674 | 321 |
| 336 | 3300035115 | Ga0373941_0035857 | Ga0373941_0035857_340_1413 | 321 |
| 337 | 3300035117 | Ga0373953_0126301 | Ga0373953_0126301_72_1037 | 321 |
| 338 | 3300035121 | Ga0373960_0005132 | Ga0373960_0005132_233_1198 | 321 |
| 339 | 3300035207 | Ga0373942_0002033 | Ga0373942_0002033_120_1085 | 321 |
| 340 | 3300035241 | Ga0373961_0000739 | Ga0373961_0000739_10042_11007 | 321 |
| 341 | 3300035691 | Ga0373931_0000499 | Ga0373931_0000499_11564_12529 | 321 |
| 342 | 3300035691 | Ga0373931_0206031 | Ga0373931_0206031_63_1124 | 321 |
| 343 | 3300035692 | Ga0373935_0069255 | Ga0373935_0069255_1249_2214 | 321 |
| 344 | 3300035724 | Ga0373933_0127409 | Ga0373933_0127409_38_1003 | 321 |
| 345 | 3300035725 | Ga0373947_0018033 | Ga0373947_0018033_2090_3055 | 321 |
| 346 | 3300037068 | Ga0373925_0143985 | Ga0373925_0143985_134_1099 | 321 |
| 347 | 3300037068 | Ga0373925_0166252 | Ga0373925_0166252_727_1692 | 321 |
| 348 | 3300041997 | Ga0439431_0000960 | Ga0439431_0000960_1302_2333 | 321 |
| 349 | 3300041999 | Ga0439433_0005747 | Ga0439433_0005747_159_1190 | 321 |
| 350 | 3300045051 | Ga0451576_0027797 | Ga0451576_0027797_4633_5598 | 321 |
| 351 | 3300045051 | Ga0451576_0042753 | Ga0451576_0042753_3723_4688 | 321 |
| 352 | 3300046454 | Ga0495592_0119274 | Ga0495592_0119274_474_1439 | 321 |
| 353 | 3300046455 | Ga0495603_0075621 | Ga0495603_0075621_207_1172 | 321 |
| 354 | 3300046476 | Ga0495662_0146094 | Ga0495662_0146094_90_1058 | 321 |
| 355 | 3300046511 | Ga0495608_0035613 | Ga0495608_0035613_278_1306 | 321 |
| 356 | 3300046537 | Ga0495598_0054545 | Ga0495598_0054545_137_1102 | 321 |
| 357 | 3300046678 | Ga0495599_0200548 | Ga0495599_0200548_76_1041 | 321 |
| 358 | 3300048904 | Ga0496101_0168099 | Ga0496101_0168099_81_1109 | 321 |
| 359 | 3300048905 | Ga0496102_0017629 | Ga0496102_0017629_489_1517 | 321 |
| 360 | 3300048905 | Ga0496102_0048879 | Ga0496102_0048879_2571_3536 | 321 |
| 361 | 3300048907 | Ga0496104_0169254 | Ga0496104_0169254_786_1751 | 321 |
| 362 | 3300048907 | Ga0496104_0270835 | Ga0496104_0270835_168_1196 | 321 |
| 363 | 3300048911 | Ga0496108_0044265 | Ga0496108_0044265_1391_2419 | 321 |
| 364 | 3300048911 | Ga0496108_0103897 | Ga0496108_0103897_92_1057 | 321 |
| 365 | 3300048912 | Ga0496109_0058002 | Ga0496109_0058002_35_1078 | 321 |
| 366 | 3300048912 | Ga0496109_0163182 | Ga0496109_0163182_81_1109 | 321 |
| 367 | 3300048913 | Ga0496110_0079952 | Ga0496110_0079952_1848_2891 | 321 |
| 368 | 3300048913 | Ga0496110_0104833 | Ga0496110_0104833_150_1115 | 321 |
| 369 | 3300048914 | Ga0496111_0112616 | Ga0496111_0112616_202_1230 | 321 |
| 370 | 3300048915 | Ga0496112_0020556 | Ga0496112_0020556_1420_2385 | 321 |
| 371 | 3300048916 | Ga0496113_0197884 | Ga0496113_0197884_565_1530 | 321 |
| 372 | 3300048917 | Ga0496114_0142369 | Ga0496114_0142369_417_1382 | 321 |
| 373 | 3300048918 | Ga0496115_0148018 | Ga0496115_0148018_174_1139 | 321 |
| 374 | 3300049571 | Ga0501034_0206714 | Ga0501034_0206714_366_1334 | 321 |
| 375 | 3300049572 | Ga0501036_0157054 | Ga0501036_0157054_89_1117 | 321 |
| 376 | 3300049574 | Ga0501038_0069731 | Ga0501038_0069731_474_1502 | 321 |
| 377 | 3300049575 | Ga0501039_0103043 | Ga0501039_0103043_740_1705 | 321 |
| 378 | 3300049576 | Ga0501040_0015889 | Ga0501040_0015889_3610_4668 | 321 |
| 379 | 3300049576 | Ga0501040_0057741 | Ga0501040_0057741_785_1771 | 321 |
| 380 | 3300049578 | Ga0501042_0146095 | Ga0501042_0146095_426_1454 | 321 |
| 381 | 3300049578 | Ga0501042_0299312 | Ga0501042_0299312_63_1097 | 321 |
| 382 | 3300049580 | Ga0501046_0119049 | Ga0501046_0119049_581_1639 | 321 |
| 383 | 3300049582 | Ga0501048_0017593 | Ga0501048_0017593_2133_3161 | 321 |
| 384 | 3300049582 | Ga0501048_0116800 | Ga0501048_0116800_307_1356 | 321 |
| 385 | 3300049582 | Ga0501048_0270664 | Ga0501048_0270664_52_1098 | 321 |
| 386 | 3300049583 | Ga0501067_0033115 | Ga0501067_0033115_370_1341 | 321 |
| 387 | 3300049587 | Ga0501071_0046330 | Ga0501071_0046330_1863_2891 | 321 |
| 388 | 3300049587 | Ga0501071_0353649 | Ga0501071_0353649_48_1094 | 321 |
| 389 | 3300049588 | Ga0501072_0011382 | Ga0501072_0011382_4528_5514 | 321 |
| 390 | 3300049589 | Ga0501073_0267671 | Ga0501073_0267671_112_1080 | 321 |
| 391 | 3300049591 | Ga0501075_0046976 | Ga0501075_0046976_1289_2275 | 321 |
| 392 | 3300049591 | Ga0501075_0047634 | Ga0501075_0047634_319_1347 | 321 |
| 393 | 3300049592 | Ga0501076_0068140 | Ga0501076_0068140_154_1212 | 321 |
| 394 | 3300049668 | Ga0501233_035014 | Ga0501233_035014_62_1120 | 321 |
| 395 | 3300049742 | Ga0501080_0195389 | Ga0501080_0195389_736_1764 | 321 |
| 396 | 3300049742 | Ga0501080_0422652 | Ga0501080_0422652_81_1112 | 321 |
| 397 | 3300049823 | Ga0501044_0403730 | Ga0501044_0403730_196_1224 | 321 |
| 398 | 3300049824 | Ga0501045_0063197 | Ga0501045_0063197_370_1428 | 321 |
| 399 | 3300050507 | nmdc:mga05p37_1014_c1 | nmdc:mga05p37_1014_c1_13062_14048 | 321 |
| 400 | 3300050507 | nmdc:mga05p37_33124_c1 | nmdc:mga05p37_33124_c1_1692_2657 | 321 |
| 401 | 3300050507 | nmdc:mga05p37_343270_c1 | nmdc:mga05p37_343270_c1_360_1430 | 321 |
| 402 | 3300050507 | nmdc:mga05p37_368807_c1 | nmdc:mga05p37_368807_c1_672_1667 | 321 |
| 403 | 3300050507 | nmdc:mga05p37_4374_c2 | nmdc:mga05p37_4374_c2_4048_5019 | 321 |
| 404 | 3300050507 | nmdc:mga05p37_609295_c1 | nmdc:mga05p37_609295_c1_95_1129 | 321 |
| 405 | 3300050507 | nmdc:mga05p37_85235_c1 | nmdc:mga05p37_85235_c1_501_1466 | 321 |
| 406 | 3300050508 | nmdc:mga09592_52715_c1 | nmdc:mga09592_52715_c1_795_1853 | 321 |
| 407 | 3300050509 | nmdc:mga0qj67_113593_c1 | nmdc:mga0qj67_113593_c1_309_1304 | 321 |
| 408 | 3300050509 | nmdc:mga0qj67_4199_c1 | nmdc:mga0qj67_4199_c1_2604_3575 | 321 |
| 409 | 3300050509 | nmdc:mga0qj67_9679_c1 | nmdc:mga0qj67_9679_c1_632_1690 | 321 |
| 410 | 3300050510 | nmdc:mga06r32_244059_c1 | nmdc:mga06r32_244059_c1_358_1419 | 321 |
| 411 | 3300050511 | nmdc:mga08y16_152115_c1 | nmdc:mga08y16_152115_c1_1388_2383 | 321 |
| 412 | 3300050512 | nmdc:mga0n895_27791_c1 | nmdc:mga0n895_27791_c1_4314_5312 | 321 |
| 413 | 3300050512 | nmdc:mga0n895_287836_c1 | nmdc:mga0n895_287836_c1_159_1220 | 321 |
| 414 | 3300050513 | nmdc:mga0rr50_23442_c1 | nmdc:mga0rr50_23442_c1_1545_2606 | 321 |
| 415 | 3300050513 | nmdc:mga0rr50_26985_c1 | nmdc:mga0rr50_26985_c1_715_1713 | 321 |
| 416 | 3300050513 | nmdc:mga0rr50_673_c1 | nmdc:mga0rr50_673_c1_10046_11011 | 321 |
| 417 | 3300050514 | nmdc:mga08x19_108049_c1 | nmdc:mga08x19_108049_c1_606_1604 | 321 |
| 418 | 3300050515 | nmdc:mga0a205_14495_c1 | nmdc:mga0a205_14495_c1_6316_7311 | 321 |
| 419 | 3300050515 | nmdc:mga0a205_347853_c1 | nmdc:mga0a205_347853_c1_188_1171 | 321 |
| 420 | 3300050515 | nmdc:mga0a205_73015_c1 | nmdc:mga0a205_73015_c1_700_1668 | 321 |
| 421 | 3300050515 | nmdc:mga0a205_8826_c1 | nmdc:mga0a205_8826_c1_3568_4566 | 321 |
| 422 | 3300050515 | nmdc:mga0a205_95890_c1 | nmdc:mga0a205_95890_c1_354_1391 | 321 |
| 423 | 3300053085 | Ga0495619_0019689 | Ga0495619_0019689_1032_1997 | 321 |
| 424 | 3300053085 | Ga0495619_0038074 | Ga0495619_0038074_109_1074 | 321 |
| 425 | 3300053085 | Ga0495619_0076630 | Ga0495619_0076630_389_1354 | 321 |
| 426 | 3300054114 | Ga0501084_0081458 | Ga0501084_0081458_1646_2674 | 321 |
| 427 | 3300060353 | Ga0501082_0243801 | Ga0501082_0243801_17_1045 | 321 |
| 428 | 3300060353 | Ga0501082_0350426 | Ga0501082_0350426_203_1237 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cyv-assembly1.cif.gz_A-2 | crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism | 0.9676 | 1 | 319 |
| 4wsh-assembly1.cif.gz_A | crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa | 0.9601 | 1 | 319 |
| 3cyv-assembly1.cif.gz_A-2 | crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism | 0.9587 | 1 | 319 |
| 1j93-assembly1.cif.gz_A-2 | crystal structure and substrate binding modeling of the uroporphyrinogen-iii decarboxylase from nicotiana tabacum: implications for the catalytic mechanism | 0.9571 | 1 | 317 |
| 1jpi-assembly1.cif.gz_A-2 | phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase | 0.9569 | 1 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6TEE8_35_387_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9684 | 1 | 317 | 3.20.20.210 |
| af_P9WFE1_2_357_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9616 | 1 | 317 | 3.20.20.210 |
| 1r3sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.954 | 1 | 320 | 3.20.20.210 |
| af_P32347_4_362_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.954 | 1 | 321 | 3.20.20.210 |
| af_C6TEE8_35_387_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9536 | 1 | 317 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354BI13-F1-model_v4 | Uroporphyrinogen decarboxylase (EC 4.1.1.37) | 0.9937 | 18 | 321 |
GO:0004853
GO:0005829 GO:0006782 |
| AF-A0A354BI13-F1-model_v4 | Uroporphyrinogen decarboxylase (EC 4.1.1.37) | 0.9905 | 18 | 321 |
GO:0004853
GO:0005829 GO:0006782 |
| AF-A0A536EM00-F1-model_v4 | Uroporphyrinogen decarboxylase | 0.9899 | 145 | 316 |
GO:0004853
GO:0005829 GO:0006783 |
| AF-A0A3D1SUV1-F1-model_v4 | Uroporphyrinogen decarboxylase | 0.9897 | 159 | 321 |
GO:0004853
GO:0005829 GO:0006783 |
| AF-A0A1E4DGZ5-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9889 | 1 | 317 |
GO:0004853
GO:0005829 GO:0006782 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar