F441689

General Info

Members Datasets Scaffolds Average Seq Length
428 241 856 267

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10005320|Ga0224712_100053203
Length 303
Sequence MKEWMDNPANDETGASETRPAVGNADTSAILVTGGTGTLGRLVVQRLHDNGRKVRVLSRRRGEAGAGVEFVTGDLATGEGIEAAVAGTEIIVHCAGSNKGDEEKARNLVRAASRAGVRHLVYISVVGSDRIPVASGVDRAMFGYFASKLAAERVVADSGLPWTTLRATQFHDLVLLVAQQMVKLPVIPLPAGFRFQPIDAGDVATRLVELALGTPAGLVPDVAGPKVYTMAELLNGYLRASHRHRPIIPIWLPGNAARAVRAGANLNPERAVGRRTWEEFLADRVTSPNYSKSRTGFGNQQGA

Samples

Sample ID Description Type Environment
1 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
227 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
228 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
229 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
230 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
234 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
235 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
239 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
240 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
241 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 1.64
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 1.87
Rhizosphere 91.12
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224712_10005320 3300022467 Bacteria 3573
2 JGI25406J46586_10023223 3300003203 Bacteria 2454
3 Ga0070658_10042270 3300005327 Bacteria 3680
4 Ga0070683_100011587 3300005329 Bacteria 7630
5 Ga0070683_100035589 3300005329 Bacteria 4551
6 Ga0070683_100173075 3300005329 Bacteria 2049
7 Ga0070683_100390337 3300005329 Bacteria 1327
8 Ga0068869_100077024 3300005334 Bacteria 2480
9 Ga0070680_100007558 3300005336 Bacteria 8286
10 Ga0070660_100094909 3300005339 Bacteria 2357
11 Ga0070691_10005560 3300005341 Bacteria 5735
12 Ga0070661_100313668 3300005344 Bacteria 1223
13 Ga0070659_100576997 3300005366 Bacteria 965
14 Ga0070709_10008202 3300005434 Bacteria 5735
15 Ga0070714_100006566 3300005435 Bacteria 8998
16 Ga0070714_100017218 3300005435 Bacteria 5852
17 Ga0070714_100042870 3300005435 Bacteria 3825
18 Ga0070713_100000334 3300005436 Bacteria 30792
19 Ga0070713_100047770 3300005436 Bacteria 3520
20 Ga0070713_100261312 3300005436 Bacteria 1582
21 Ga0070713_100368359 3300005436 Bacteria 1336
22 Ga0070710_10012283 3300005437 Bacteria 4248
23 Ga0070711_100252911 3300005439 Bacteria 1383
24 Ga0070711_100356027 3300005439 Bacteria 1178
25 Ga0070708_100008382 3300005445 Bacteria 8300
26 Ga0070708_100034442 3300005445 Bacteria 4406
27 Ga0070708_100120658 3300005445 Bacteria 2418
28 Ga0070708_100238568 3300005445 Bacteria 1707
29 Ga0070663_100071585 3300005455 Bacteria 2523
30 Ga0070681_10014016 3300005458 Bacteria 7978
31 Ga0070681_10430911 3300005458 Bacteria 1231
32 Ga0070706_100001982 3300005467 Bacteria 21112
33 Ga0070706_100007825 3300005467 Bacteria 9992
34 Ga0070706_100089169 3300005467 Bacteria 2860
35 Ga0070706_100100008 3300005467 Bacteria 2694
36 Ga0070707_100003579 3300005468 Bacteria 14651
37 Ga0070707_100005815 3300005468 Bacteria 11502
38 Ga0070707_100032155 3300005468 Bacteria 4998
39 Ga0070707_100046420 3300005468 Bacteria 4157
40 Ga0070707_100081765 3300005468 Bacteria 3119
41 Ga0070698_100000708 3300005471 Bacteria 35672
42 Ga0070698_100009668 3300005471 Bacteria 10314
43 Ga0070698_100027041 3300005471 Bacteria 5965
44 Ga0070698_100073619 3300005471 Bacteria 3422
45 Ga0070698_100128883 3300005471 Bacteria 2486
46 Ga0070699_100000040 3300005518 Bacteria 130355
47 Ga0070699_100040913 3300005518 Bacteria 4012
48 Ga0070699_100116576 3300005518 Bacteria 2347
49 Ga0070679_100009417 3300005530 Bacteria 9237
50 Ga0070679_100125388 3300005530 Bacteria 2550
51 Ga0070679_100128242 3300005530 Bacteria 2518
52 Ga0070684_100000435 3300005535 Bacteria 28728
53 Ga0070686_100564304 3300005544 Bacteria 892
54 Ga0070665_100307154 3300005548 Bacteria 1589
55 Ga0070664_100017627 3300005564 Bacteria 5865
56 Ga0070664_100080424 3300005564 Bacteria 2807
57 Ga0068857_100000569 3300005577 Bacteria 26962
58 Ga0068857_100192831 3300005577 Bacteria 1856
59 Ga0068857_100351762 3300005577 Bacteria 1364
60 Ga0068856_100000373 3300005614 Bacteria 49232
61 Ga0068852_100197237 3300005616 Bacteria 1903
62 Ga0068861_100470529 3300005719 Bacteria 1130
63 Ga0068862_100476010 3300005844 Bacteria 1181
64 Ga0081455_10002946 3300005937 Bacteria 19937
65 Ga0081455_10019428 3300005937 Bacteria 6429
66 Ga0081455_10062507 3300005937 Bacteria 3129
67 Ga0081455_10092284 3300005937 Bacteria 2450
68 Ga0081455_10172517 3300005937 Bacteria 1646
69 Ga0081538_10003584 3300005981 Bacteria 14601
70 Ga0081538_10005661 3300005981 Bacteria 11193
71 Ga0081538_10006935 3300005981 Bacteria 9856
72 Ga0081538_10007373 3300005981 Bacteria 9526
73 Ga0081540_1002033 3300005983 Bacteria 16870
74 Ga0081540_1071424 3300005983 Bacteria 1604
75 Ga0081540_1075620 3300005983 Bacteria 1538
76 Ga0081540_1088844 3300005983 Bacteria 1365
77 Ga0081539_10000520 3300005985 Bacteria 80305
78 Ga0081539_10014469 3300005985 Bacteria 5832
79 Ga0081539_10015392 3300005985 Bacteria 5561
80 Ga0081539_10030757 3300005985 Bacteria 3326
81 Ga0081539_10033986 3300005985 Bacteria 3094
82 Ga0070717_10000435 3300006028 Bacteria 26586
83 Ga0070717_10002189 3300006028 Bacteria 13722
84 Ga0070717_10006592 3300006028 Bacteria 8552
85 Ga0070717_10012976 3300006028 Bacteria 6365
86 Ga0070717_10044495 3300006028 Bacteria 3625
87 Ga0070717_10151122 3300006028 Unclassified 2009
88 Ga0070717_10490184 3300006028 Bacteria 1110
89 Ga0070716_100011325 3300006173 Bacteria 4491
90 Ga0070712_100006798 3300006175 Bacteria 7117
91 Ga0068871_100080587 3300006358 Bacteria 2695
92 Ga0075428_100002071 3300006844 Bacteria 21640
93 Ga0075428_100036974 3300006844 Bacteria 5376
94 Ga0075428_100046468 3300006844 Bacteria 4769
95 Ga0075428_100055993 3300006844 Bacteria 4320
96 Ga0075428_100453247 3300006844 Bacteria 1374
97 Ga0075428_100584292 3300006844 Bacteria 1193
98 Ga0075428_100657097 3300006844 Bacteria 1118
99 Ga0075430_100054524 3300006846 Bacteria 3363
100 Ga0075431_100003101 3300006847 Bacteria 16090
101 Ga0075431_100008849 3300006847 Bacteria 10087
102 Ga0075431_100093242 3300006847 Bacteria 3108
103 Ga0075431_100114495 3300006847 Bacteria 2784
104 Ga0075431_100393686 3300006847 Bacteria 1387
105 Ga0075431_100661469 3300006847 Bacteria 1024
106 Ga0075434_100122916 3300006871 Bacteria 2611
107 Ga0075434_100522942 3300006871 Bacteria 1207
108 Ga0075429_100006548 3300006880 Bacteria 10085
109 Ga0075429_100178713 3300006880 Bacteria 1860
110 Ga0075429_100526212 3300006880 Bacteria 1036
111 Ga0068865_100107045 3300006881 Bacteria 2056
112 Ga0075436_100002386 3300006914 Bacteria 12941
113 Ga0075436_100115359 3300006914 Bacteria 1876
114 Ga0111539_10151224 3300009094 Bacteria 2717
115 Ga0105247_10312526 3300009101 Bacteria 1094
116 Ga0114129_10062973 3300009147 Bacteria 5181
117 Ga0114129_10737045 3300009147 Bacteria 1263
118 Ga0105238_10096207 3300009551 Bacteria 2947
119 Ga0105238_10169212 3300009551 Bacteria 2161
120 Ga0105238_10597573 3300009551 Bacteria 1111
121 Ga0105249_10731271 3300009553 Bacteria 1051
122 Ga0157370_10013866 3300013104 Bacteria 8277
123 Ga0157369_10001178 3300013105 Bacteria 32585
124 Ga0157369_10014794 3300013105 Bacteria 8804
125 Ga0157372_10222082 3300013307 Bacteria 2190
126 Ga0206355_1076157 3300020076 Bacteria 1217
127 Ga0206352_10960030 3300020078 Bacteria 877
128 Ga0206350_10592936 3300020080 Bacteria 3771
129 Ga0206353_10597035 3300020082 Bacteria 2638
130 Ga0206353_11851845 3300020082 Bacteria 2549
131 Ga0224712_10041286 3300022467 Bacteria 1741
132 Ga0207699_10010084 3300025906 Bacteria 4726
133 Ga0207699_10042751 3300025906 Bacteria 2628
134 Ga0207705_10070757 3300025909 Bacteria 2528
135 Ga0207684_10000855 3300025910 Bacteria 34965
136 Ga0207684_10005848 3300025910 Bacteria 11264
137 Ga0207684_10017984 3300025910 Bacteria 6057
138 Ga0207684_10125197 3300025910 Bacteria 2205
139 Ga0207707_10555246 3300025912 Bacteria 975
140 Ga0207693_10016330 3300025915 Bacteria 5935
141 Ga0207693_10239520 3300025915 Bacteria 1424
142 Ga0207663_10015471 3300025916 Bacteria 4209
143 Ga0207660_10016244 3300025917 Bacteria 4926
144 Ga0207657_10092013 3300025919 Bacteria 2528
145 Ga0207652_10032835 3300025921 Bacteria 4367
146 Ga0207646_10008894 3300025922 Bacteria 10003
147 Ga0207646_10021321 3300025922 Bacteria 5988
148 Ga0207646_10147559 3300025922 Bacteria 2120
149 Ga0207646_10179498 3300025922 Bacteria 1912
150 Ga0207694_10203402 3300025924 Bacteria 1611
151 Ga0207700_10021309 3300025928 Bacteria 4423
152 Ga0207700_10044820 3300025928 Bacteria 3259
153 Ga0207700_10048212 3300025928 Bacteria 3162
154 Ga0207700_10301704 3300025928 Bacteria 1383
155 Ga0207664_10005161 3300025929 Bacteria 8901
156 Ga0207664_10028864 3300025929 Bacteria 4220
157 Ga0207664_10032440 3300025929 Bacteria 4002
158 Ga0207664_10114931 3300025929 Bacteria 2243
159 Ga0207704_10350988 3300025938 Bacteria 1148
160 Ga0207665_10016049 3300025939 Bacteria 4919
161 Ga0207665_10064229 3300025939 Bacteria 2494
162 Ga0207689_10166702 3300025942 Bacteria 1815
163 Ga0207661_10008773 3300025944 Bacteria 7232
164 Ga0207661_10108598 3300025944 Bacteria 2343
165 Ga0207661_10202666 3300025944 Bacteria 1745
166 Ga0207679_10015205 3300025945 Bacteria 5078
167 Ga0207679_10063974 3300025945 Bacteria 2748
168 Ga0207712_10578261 3300025961 Bacteria 969
169 Ga0207678_10039131 3300026067 Bacteria 4116
170 Ga0207678_10241074 3300026067 Bacteria 1548
171 Ga0207702_10007067 3300026078 Bacteria 9601
172 Ga0207676_10807687 3300026095 Bacteria 915
173 Ga0207674_10005044 3300026116 Bacteria 15758
174 Ga0207674_10183587 3300026116 Bacteria 2043
175 Ga0207675_100460228 3300026118 Bacteria 1262
176 Ga0207698_10446201 3300026142 Bacteria 1248
177 Ga0207428_10006711 3300027907 Bacteria 10568
178 Ga0207428_10094908 3300027907 Bacteria 2311
179 Ga0268266_10219783 3300028379 Bacteria 1746
180 Ga0268265_10647733 3300028380 Bacteria 1015
181 Ga0265336_10006041 3300028666 Bacteria 4402
182 Ga0307517_10002046 3300028786 Bacteria 32818
183 Ga0307517_10194752 3300028786 Bacteria 1279
184 Ga0265338_10001380 3300028800 Bacteria 39522
185 Ga0307512_10007812 3300030522 Bacteria 10523
186 Ga0307513_10003872 3300031456 Bacteria 20136
187 Ga0307513_10011105 3300031456 Bacteria 11228
188 Ga0307509_10253825 3300031507 Bacteria 1540
189 Ga0307508_10012655 3300031616 Bacteria 7716
190 Ga0307508_10044635 3300031616 Bacteria 3963
191 Ga0307514_10003450 3300031649 Bacteria 15193
192 Ga0307514_10151595 3300031649 Bacteria 1554
193 Ga0307516_10008029 3300031730 Bacteria 12008
194 Ga0307516_10009068 3300031730 Bacteria 11142
195 Ga0307405_10035786 3300031731 Bacteria 2969
196 Ga0307413_10119395 3300031824 Bacteria 1782
197 Ga0307410_10269107 3300031852 Bacteria 1332
198 Ga0307410_10327368 3300031852 Bacteria 1218
199 Ga0307410_10461148 3300031852 Unclassified 1038
200 Ga0307406_10055498 3300031901 Bacteria 2533
201 Ga0307406_10077128 3300031901 Bacteria 2204
202 Ga0307406_10181340 3300031901 Bacteria 1533
203 Ga0307406_10547577 3300031901 Bacteria 946
204 Ga0307409_100052991 3300031995 Bacteria 3115
205 Ga0307409_100064216 3300031995 Bacteria 2883
206 Ga0307409_100171980 3300031995 Bacteria 1908
207 Ga0307409_100322399 3300031995 Bacteria 1446
208 Ga0307416_100064758 3300032002 Bacteria 3000
209 Ga0307416_100288955 3300032002 Bacteria 1622
210 Ga0307414_10323136 3300032004 Bacteria 1314
211 Ga0307411_10295650 3300032005 Unclassified 1296
212 Ga0307411_10419707 3300032005 Bacteria 1111
213 Ga0307411_10629975 3300032005 Bacteria 926
214 Ga0307415_100055868 3300032126 Bacteria 2704
215 Ga0307507_10067232 3300033179 Bacteria 3279
216 Ga0307507_10110600 3300033179 Bacteria 2248
217 Ga0373934_0001139 3300035086 Bacteria 9672
218 Ga0373944_0028161 3300035089 Bacteria 1671
219 Ga0373951_0015285 3300035091 Bacteria 1728
220 Ga0373923_0011274 3300035111 Bacteria 3274
221 Ga0373936_0031856 3300035113 Bacteria 2083
222 Ga0373936_0040820 3300035113 Bacteria 1860
223 Ga0373953_0000345 3300035117 Bacteria 12534
224 Ga0373953_0013361 3300035117 Bacteria 2932
225 Ga0373954_0026881 3300035118 Bacteria 2640
226 Ga0373954_0062486 3300035118 Bacteria 1759
227 Ga0373956_0022681 3300035119 Bacteria 2688
228 Ga0373957_0000141 3300035120 Bacteria 18065
229 Ga0373957_0049944 3300035120 Bacteria 1597
230 Ga0373943_0074217 3300035170 Bacteria 1729
231 Ga0373946_0016059 3300035171 Bacteria 2847
232 Ga0373955_0000044 3300035172 Bacteria 49733
233 Ga0373955_0003590 3300035172 Bacteria 6825
234 Ga0373962_0014951 3300035242 Bacteria 1984
235 Ga0373924_0005277 3300035410 Bacteria 4567
236 Ga0373924_0013461 3300035410 Bacteria 3074
237 Ga0373933_0000025 3300035724 Bacteria 90735
238 Ga0373933_0004913 3300035724 Bacteria 7297
239 Ga0373947_0248901 3300035725 Bacteria 1175
240 Ga0373937_0000370 3300036401 Bacteria 41780
241 Ga0373937_0014310 3300036401 Bacteria 7002
242 Ga0373925_0004555 3300037068 Bacteria 10470
243 Ga0373925_0012469 3300037068 Bacteria 6155
244 Ga0373925_0077732 3300037068 Bacteria 2519
245 Ga0373925_0444231 3300037068 Bacteria 1061
246 Ga0395899_0064923 3300037312 Bacteria 2683
247 Ga0395899_0109786 3300037312 Bacteria 1984
248 Ga0395899_0186450 3300037312 Bacteria 1454
249 Ga0395899_0197176 3300037312 Bacteria 1406
250 Ga0395900_0002127 3300037418 Bacteria 22170
251 Ga0395900_0093142 3300037418 Bacteria 3095
252 Ga0395900_0134569 3300037418 Bacteria 2532
253 Ga0395900_0141223 3300037418 Bacteria 2466
254 Ga0395900_0187959 3300037418 Bacteria 2096
255 Ga0395898_0006265 3300037466 Bacteria 12729
256 Ga0395898_0036183 3300037466 Bacteria 4903
257 Ga0395898_0059598 3300037466 Bacteria 3712
258 Ga0395898_0104244 3300037466 Bacteria 2720
259 Ga0395898_0223231 3300037466 Bacteria 1797
260 Ga0395898_0422704 3300037466 Bacteria 1270
261 Ga0395898_0514896 3300037466 Bacteria 1138
262 Ga0395905_0002509 3300037471 Bacteria 20276
263 Ga0436364_1168676 3300037853 Bacteria 3227
264 Ga0436364_1329099 3300037853 Bacteria 1516
265 Ga0395901_0003924 3300038443 Bacteria 14959
266 Ga0395901_0006076 3300038443 Bacteria 12237
267 Ga0395901_0008914 3300038443 Bacteria 10161
268 Ga0395901_0015227 3300038443 Bacteria 7825
269 Ga0395901_0015899 3300038443 Bacteria 7668
270 Ga0395901_0022022 3300038443 Bacteria 6532
271 Ga0395901_0039368 3300038443 Bacteria 4891
272 Ga0395901_0078711 3300038443 Bacteria 3442
273 Ga0395901_0080822 3300038443 Bacteria 3394
274 Ga0436362_0356910 3300039453 Bacteria 1222
275 Ga0439443_009766 3300042003 Bacteria 1383
276 Ga0439454_007820 3300042011 Bacteria 1350
277 Ga0439463_041696 3300042016 Bacteria 1167
278 Ga0466966_0054403 3300044684 Unclassified 2537
279 Ga0466966_0177046 3300044684 Bacteria 1295
280 Ga0466968_0125188 3300044735 Bacteria 1166
281 Ga0466959_0034259 3300045049 Unclassified 3756
282 Ga0466959_0382548 3300045049 Bacteria 958
283 Ga0466967_0002511 3300045976 Bacteria 11464
284 Ga0495592_0000016 3300046454 Bacteria 144922
285 Ga0495603_0074992 3300046455 Bacteria 1986
286 Ga0495629_0042197 3300046459 Bacteria 3206
287 Ga0495629_0048338 3300046459 Bacteria 2982
288 Ga0495629_0069434 3300046459 Bacteria 2458
289 Ga0495641_0004665 3300046461 Bacteria 9569
290 Ga0495641_0019315 3300046461 Bacteria 3491
291 Ga0495651_0000005 3300046462 Bacteria 173396
292 Ga0495651_0019551 3300046462 Bacteria 5252
293 Ga0495651_0047196 3300046462 Bacteria 3332
294 Ga0495653_0001769 3300046463 Bacteria 17036
295 Ga0495582_0014629 3300046473 Bacteria 4310
296 Ga0495639_0007515 3300046475 Bacteria 4680
297 Ga0495639_0038987 3300046475 Bacteria 2135
298 Ga0495662_0060791 3300046476 Bacteria 1824
299 Ga0495664_0028647 3300046477 Bacteria 3252
300 Ga0495585_0053515 3300046492 Bacteria 2234
301 Ga0495583_0056554 3300046506 Bacteria 1768
302 Ga0495608_0000057 3300046511 Bacteria 90735
303 Ga0495608_0001916 3300046511 Bacteria 14928
304 Ga0495618_0014094 3300046514 Bacteria 4867
305 Ga0495618_0074935 3300046514 Bacteria 2155
306 Ga0495628_0000073 3300046516 Bacteria 79628
307 Ga0495628_0109494 3300046516 Bacteria 2125
308 Ga0495630_0021402 3300046517 Bacteria 4775
309 Ga0495643_0001509 3300046522 Bacteria 21031
310 Ga0495652_0002756 3300046529 Bacteria 17742
311 Ga0495652_0100103 3300046529 Bacteria 2352
312 Ga0495652_0112781 3300046529 Bacteria 2183
313 Ga0495665_0022637 3300046531 Bacteria 3376
314 Ga0495640_0257967 3300046533 Unclassified 1090
315 Ga0495587_0000277 3300046536 Bacteria 36663
316 Ga0495645_0128679 3300046543 Bacteria 1777
317 Ga0495633_0044023 3300046558 Bacteria 2116
318 Ga0495667_0000025 3300046559 Bacteria 155090
319 Ga0495667_0023549 3300046559 Bacteria 4148
320 Ga0495667_0182509 3300046559 Bacteria 1346
321 Ga0495656_0052251 3300046615 Bacteria 1752
322 Ga0495634_0027444 3300046642 Bacteria 3960
323 Ga0495635_0076619 3300046663 Bacteria 2291
324 Ga0495657_0000018 3300046675 Bacteria 173397
325 Ga0495657_0126941 3300046675 Bacteria 1601
326 Ga0495599_0000054 3300046678 Bacteria 79938
327 Ga0495599_0107660 3300046678 Bacteria 1737
328 Ga0495623_0000107 3300046679 Bacteria 51479
329 Ga0495623_0012001 3300046679 Bacteria 5613
330 Ga0495646_0040199 3300046680 Bacteria 2881
331 Ga0495658_0074243 3300046683 Bacteria 1981
332 Ga0495658_0085567 3300046683 Bacteria 1858
333 Ga0495613_0028596 3300046689 Bacteria 4146
334 Ga0495624_0062427 3300046690 Bacteria 2331
335 Ga0495670_0002268 3300046691 Bacteria 9485
336 Ga0495600_0000759 3300046809 Bacteria 16984
337 Ga0495600_0031132 3300046809 Bacteria 3455
338 Ga0495581_0016687 3300047315 Bacteria 4269
339 Ga0495581_0066611 3300047315 Bacteria 2082
340 Ga0495604_0000066 3300047317 Bacteria 90720
341 Ga0495604_0023697 3300047317 Bacteria 4898
342 Ga0495604_0158993 3300047317 Bacteria 1598
343 Ga0495674_0080786 3300047319 Bacteria 2789
344 Ga0495676_0067396 3300047321 Bacteria 2769
345 Ga0495680_0000032 3300047322 Bacteria 108460
346 Ga0495680_0019391 3300047322 Bacteria 5740
347 Ga0495680_0046631 3300047322 Bacteria 3415
348 Ga0495683_0086709 3300047323 Bacteria 1521
349 Ga0495687_009010 3300047443 Bacteria 5636
350 Ga0495687_016311 3300047443 Bacteria 3737
351 Ga0495675_0000577 3300047444 Bacteria 23644
352 Ga0495675_0004765 3300047444 Bacteria 8239
353 Ga0495685_000284 3300047447 Bacteria 16923
354 Ga0495681_0000813 3300047470 Bacteria 23988
355 Ga0495684_0041798 3300047471 Bacteria 3512
356 Ga0495593_0006770 3300047673 Bacteria 6708
357 Ga0495593_0023576 3300047673 Bacteria 3419
358 Ga0495602_0000123 3300048088 Bacteria 72994
359 Ga0495602_0073784 3300048088 Bacteria 2902
360 Ga0496102_0589884 3300048905 Bacteria 1034
361 Ga0496104_0064591 3300048907 Bacteria 3472
362 Ga0496104_0084767 3300048907 Bacteria 3024
363 Ga0496109_0128947 3300048912 Bacteria 2360
364 Ga0496109_0389896 3300048912 Bacteria 1316
365 Ga0496112_0056078 3300048915 Bacteria 3877
366 Ga0496112_0372318 3300048915 Bacteria 1370
367 Ga0496115_0001614 3300048918 Bacteria 16216
368 Ga0501031_0031856 3300049568 Bacteria 3438
369 Ga0501032_0162211 3300049569 Bacteria 1467
370 Ga0501033_0017874 3300049570 Bacteria 5353
371 Ga0501034_0411385 3300049571 Bacteria 1274
372 Ga0501036_0062737 3300049572 Bacteria 3148
373 Ga0501036_0423421 3300049572 Bacteria 1110
374 Ga0501037_0202189 3300049573 Bacteria 1403
375 Ga0501038_0004424 3300049574 Bacteria 13076
376 Ga0501039_0138687 3300049575 Bacteria 1910
377 Ga0501039_0246534 3300049575 Bacteria 1405
378 Ga0501040_0295060 3300049576 Bacteria 1159
379 Ga0501043_0171898 3300049579 Bacteria 1690
380 Ga0501067_0021109 3300049583 Bacteria 3604
381 Ga0501071_0439200 3300049587 Bacteria 998
382 Ga0501072_0104935 3300049588 Bacteria 2247
383 Ga0501074_0045239 3300049590 Bacteria 3185
384 Ga0501077_0161178 3300049593 Bacteria 1424
385 Ga0501222_016605 3300049662 Bacteria 975
386 Ga0501079_0037547 3300049741 Bacteria 3734
387 Ga0501080_0124179 3300049742 Bacteria 2391
388 Ga0501081_0088618 3300049743 Bacteria 2174
389 Ga0501081_0326539 3300049743 Bacteria 1128
390 Ga0501083_0186451 3300049744 Bacteria 1354
391 Ga0501035_0052218 3300049822 Bacteria 3658
392 Ga0501044_0029945 3300049823 Bacteria 5738
393 Ga0501044_0159833 3300049823 Bacteria 2231
394 nmdc:mga05p37_296070_c1 3300050507 Bacteria 1924
395 nmdc:mga05p37_321686_c1 3300050507 Bacteria 1831
396 nmdc:mga09592_143896_c1 3300050508 Bacteria 2056
397 nmdc:mga09592_297625_c1 3300050508 Bacteria 1399
398 nmdc:mga09592_322015_c1 3300050508 Bacteria 1339
399 nmdc:mga09592_615378_c1 3300050508 Bacteria 929
400 nmdc:mga0qj67_84329_c1 3300050509 Bacteria 2548
401 nmdc:mga06r32_10098_c1 3300050510 Bacteria 8523
402 nmdc:mga06r32_113799_c1 3300050510 Bacteria 2664
403 nmdc:mga06r32_480518_c1 3300050510 Bacteria 1220
404 nmdc:mga06r32_5671_c1 3300050510 Bacteria 11236
405 nmdc:mga06r32_635636_c1 3300050510 Bacteria 1036
406 nmdc:mga0n895_147106_c1 3300050512 Bacteria 2386
407 nmdc:mga08x19_63370_c1 3300050514 Bacteria 2399
408 nmdc:mga0a205_4141_c1 3300050515 Bacteria 9856
409 Ga0495601_0060324 3300053077 Bacteria 2407
410 Ga0495655_0006456 3300053083 Bacteria 2132
411 Ga0500578_0004449 3300053086 Bacteria 9867
412 Ga0500583_0062795 3300053092 Bacteria 1758
413 Ga0500654_012617 3300053099 Bacteria 5682
414 Ga0500553_101024 3300053101 Bacteria 1241
415 Ga0500560_008000 3300053107 Bacteria 2522
416 Ga0500614_009838 3300053123 Bacteria 2044
417 Ga0500628_001373 3300053129 Bacteria 4188
418 Ga0500652_003399 3300053131 Bacteria 4821
419 Ga0500658_0002249 3300053134 Bacteria 7480
420 Ga0500600_0046774 3300053149 Bacteria 2470
421 Ga0500633_0014668 3300053160 Bacteria 2229
422 Ga0500587_001101 3300053739 Bacteria 3705
423 Ga0501084_0027239 3300054114 Bacteria 4777
424 Ga0501082_0026301 3300060353 Bacteria 5014
425 2552109792 2551306166 Bacteria 9731570
426 2623591013 2622736626 Bacteria 7181580
427 2816510081 2816332139 Bacteria 9138787
428 2837183522 2837183177 Bacteria 4637169
429 Ga0224712_10005320
430 JGI25406J46586_10023223
431 Ga0070658_10042270
432 Ga0070683_100011587
433 Ga0070683_100035589
434 Ga0070683_100173075
435 Ga0070683_100390337
436 Ga0068869_100077024
437 Ga0070680_100007558
438 Ga0070660_100094909
439 Ga0070691_10005560
440 Ga0070661_100313668
441 Ga0070659_100576997
442 Ga0070709_10008202
443 Ga0070714_100006566
444 Ga0070714_100017218
445 Ga0070714_100042870
446 Ga0070713_100000334
447 Ga0070713_100047770
448 Ga0070713_100261312
449 Ga0070713_100368359
450 Ga0070710_10012283
451 Ga0070711_100252911
452 Ga0070711_100356027
453 Ga0070708_100008382
454 Ga0070708_100034442
455 Ga0070708_100120658
456 Ga0070708_100238568
457 Ga0070663_100071585
458 Ga0070681_10014016
459 Ga0070681_10430911
460 Ga0070706_100001982
461 Ga0070706_100007825
462 Ga0070706_100089169
463 Ga0070706_100100008
464 Ga0070707_100003579
465 Ga0070707_100005815
466 Ga0070707_100032155
467 Ga0070707_100046420
468 Ga0070707_100081765
469 Ga0070698_100000708
470 Ga0070698_100009668
471 Ga0070698_100027041
472 Ga0070698_100073619
473 Ga0070698_100128883
474 Ga0070699_100000040
475 Ga0070699_100040913
476 Ga0070699_100116576
477 Ga0070679_100009417
478 Ga0070679_100125388
479 Ga0070679_100128242
480 Ga0070684_100000435
481 Ga0070686_100564304
482 Ga0070665_100307154
483 Ga0070664_100017627
484 Ga0070664_100080424
485 Ga0068857_100000569
486 Ga0068857_100192831
487 Ga0068857_100351762
488 Ga0068856_100000373
489 Ga0068852_100197237
490 Ga0068861_100470529
491 Ga0068862_100476010
492 Ga0081455_10002946
493 Ga0081455_10019428
494 Ga0081455_10062507
495 Ga0081455_10092284
496 Ga0081455_10172517
497 Ga0081538_10003584
498 Ga0081538_10005661
499 Ga0081538_10006935
500 Ga0081538_10007373
501 Ga0081540_1002033
502 Ga0081540_1071424
503 Ga0081540_1075620
504 Ga0081540_1088844
505 Ga0081539_10000520
506 Ga0081539_10014469
507 Ga0081539_10015392
508 Ga0081539_10030757
509 Ga0081539_10033986
510 Ga0070717_10000435
511 Ga0070717_10002189
512 Ga0070717_10006592
513 Ga0070717_10012976
514 Ga0070717_10044495
515 Ga0070717_10151122
516 Ga0070717_10490184
517 Ga0070716_100011325
518 Ga0070712_100006798
519 Ga0068871_100080587
520 Ga0075428_100002071
521 Ga0075428_100036974
522 Ga0075428_100046468
523 Ga0075428_100055993
524 Ga0075428_100453247
525 Ga0075428_100584292
526 Ga0075428_100657097
527 Ga0075430_100054524
528 Ga0075431_100003101
529 Ga0075431_100008849
530 Ga0075431_100093242
531 Ga0075431_100114495
532 Ga0075431_100393686
533 Ga0075431_100661469
534 Ga0075434_100122916
535 Ga0075434_100522942
536 Ga0075429_100006548
537 Ga0075429_100178713
538 Ga0075429_100526212
539 Ga0068865_100107045
540 Ga0075436_100002386
541 Ga0075436_100115359
542 Ga0111539_10151224
543 Ga0105247_10312526
544 Ga0114129_10062973
545 Ga0114129_10737045
546 Ga0105238_10096207
547 Ga0105238_10169212
548 Ga0105238_10597573
549 Ga0105249_10731271
550 Ga0157370_10013866
551 Ga0157369_10001178
552 Ga0157369_10014794
553 Ga0157372_10222082
554 Ga0206355_1076157
555 Ga0206352_10960030
556 Ga0206350_10592936
557 Ga0206353_10597035
558 Ga0206353_11851845
559 Ga0224712_10041286
560 Ga0207699_10010084
561 Ga0207699_10042751
562 Ga0207705_10070757
563 Ga0207684_10000855
564 Ga0207684_10005848
565 Ga0207684_10017984
566 Ga0207684_10125197
567 Ga0207707_10555246
568 Ga0207693_10016330
569 Ga0207693_10239520
570 Ga0207663_10015471
571 Ga0207660_10016244
572 Ga0207657_10092013
573 Ga0207652_10032835
574 Ga0207646_10008894
575 Ga0207646_10021321
576 Ga0207646_10147559
577 Ga0207646_10179498
578 Ga0207694_10203402
579 Ga0207700_10021309
580 Ga0207700_10044820
581 Ga0207700_10048212
582 Ga0207700_10301704
583 Ga0207664_10005161
584 Ga0207664_10028864
585 Ga0207664_10032440
586 Ga0207664_10114931
587 Ga0207704_10350988
588 Ga0207665_10016049
589 Ga0207665_10064229
590 Ga0207689_10166702
591 Ga0207661_10008773
592 Ga0207661_10108598
593 Ga0207661_10202666
594 Ga0207679_10015205
595 Ga0207679_10063974
596 Ga0207712_10578261
597 Ga0207678_10039131
598 Ga0207678_10241074
599 Ga0207702_10007067
600 Ga0207676_10807687
601 Ga0207674_10005044
602 Ga0207674_10183587
603 Ga0207675_100460228
604 Ga0207698_10446201
605 Ga0207428_10006711
606 Ga0207428_10094908
607 Ga0268266_10219783
608 Ga0268265_10647733
609 Ga0265336_10006041
610 Ga0307517_10002046
611 Ga0307517_10194752
612 Ga0265338_10001380
613 Ga0307512_10007812
614 Ga0307513_10003872
615 Ga0307513_10011105
616 Ga0307509_10253825
617 Ga0307508_10012655
618 Ga0307508_10044635
619 Ga0307514_10003450
620 Ga0307514_10151595
621 Ga0307516_10008029
622 Ga0307516_10009068
623 Ga0307405_10035786
624 Ga0307413_10119395
625 Ga0307410_10269107
626 Ga0307410_10327368
627 Ga0307410_10461148
628 Ga0307406_10055498
629 Ga0307406_10077128
630 Ga0307406_10181340
631 Ga0307406_10547577
632 Ga0307409_100052991
633 Ga0307409_100064216
634 Ga0307409_100171980
635 Ga0307409_100322399
636 Ga0307416_100064758
637 Ga0307416_100288955
638 Ga0307414_10323136
639 Ga0307411_10295650
640 Ga0307411_10419707
641 Ga0307411_10629975
642 Ga0307415_100055868
643 Ga0307507_10067232
644 Ga0307507_10110600
645 Ga0373934_0001139
646 Ga0373944_0028161
647 Ga0373951_0015285
648 Ga0373923_0011274
649 Ga0373936_0031856
650 Ga0373936_0040820
651 Ga0373953_0000345
652 Ga0373953_0013361
653 Ga0373954_0026881
654 Ga0373954_0062486
655 Ga0373956_0022681
656 Ga0373957_0000141
657 Ga0373957_0049944
658 Ga0373943_0074217
659 Ga0373946_0016059
660 Ga0373955_0000044
661 Ga0373955_0003590
662 Ga0373962_0014951
663 Ga0373924_0005277
664 Ga0373924_0013461
665 Ga0373933_0000025
666 Ga0373933_0004913
667 Ga0373947_0248901
668 Ga0373937_0000370
669 Ga0373937_0014310
670 Ga0373925_0004555
671 Ga0373925_0012469
672 Ga0373925_0077732
673 Ga0373925_0444231
674 Ga0395899_0064923
675 Ga0395899_0109786
676 Ga0395899_0186450
677 Ga0395899_0197176
678 Ga0395900_0002127
679 Ga0395900_0093142
680 Ga0395900_0134569
681 Ga0395900_0141223
682 Ga0395900_0187959
683 Ga0395898_0006265
684 Ga0395898_0036183
685 Ga0395898_0059598
686 Ga0395898_0104244
687 Ga0395898_0223231
688 Ga0395898_0422704
689 Ga0395898_0514896
690 Ga0395905_0002509
691 Ga0436364_1168676
692 Ga0436364_1329099
693 Ga0395901_0003924
694 Ga0395901_0006076
695 Ga0395901_0008914
696 Ga0395901_0015227
697 Ga0395901_0015899
698 Ga0395901_0022022
699 Ga0395901_0039368
700 Ga0395901_0078711
701 Ga0395901_0080822
702 Ga0436362_0356910
703 Ga0439443_009766
704 Ga0439454_007820
705 Ga0439463_041696
706 Ga0466966_0054403
707 Ga0466966_0177046
708 Ga0466968_0125188
709 Ga0466959_0034259
710 Ga0466959_0382548
711 Ga0466967_0002511
712 Ga0495592_0000016
713 Ga0495603_0074992
714 Ga0495629_0042197
715 Ga0495629_0048338
716 Ga0495629_0069434
717 Ga0495641_0004665
718 Ga0495641_0019315
719 Ga0495651_0000005
720 Ga0495651_0019551
721 Ga0495651_0047196
722 Ga0495653_0001769
723 Ga0495582_0014629
724 Ga0495639_0007515
725 Ga0495639_0038987
726 Ga0495662_0060791
727 Ga0495664_0028647
728 Ga0495585_0053515
729 Ga0495583_0056554
730 Ga0495608_0000057
731 Ga0495608_0001916
732 Ga0495618_0014094
733 Ga0495618_0074935
734 Ga0495628_0000073
735 Ga0495628_0109494
736 Ga0495630_0021402
737 Ga0495643_0001509
738 Ga0495652_0002756
739 Ga0495652_0100103
740 Ga0495652_0112781
741 Ga0495665_0022637
742 Ga0495640_0257967
743 Ga0495587_0000277
744 Ga0495645_0128679
745 Ga0495633_0044023
746 Ga0495667_0000025
747 Ga0495667_0023549
748 Ga0495667_0182509
749 Ga0495656_0052251
750 Ga0495634_0027444
751 Ga0495635_0076619
752 Ga0495657_0000018
753 Ga0495657_0126941
754 Ga0495599_0000054
755 Ga0495599_0107660
756 Ga0495623_0000107
757 Ga0495623_0012001
758 Ga0495646_0040199
759 Ga0495658_0074243
760 Ga0495658_0085567
761 Ga0495613_0028596
762 Ga0495624_0062427
763 Ga0495670_0002268
764 Ga0495600_0000759
765 Ga0495600_0031132
766 Ga0495581_0016687
767 Ga0495581_0066611
768 Ga0495604_0000066
769 Ga0495604_0023697
770 Ga0495604_0158993
771 Ga0495674_0080786
772 Ga0495676_0067396
773 Ga0495680_0000032
774 Ga0495680_0019391
775 Ga0495680_0046631
776 Ga0495683_0086709
777 Ga0495687_009010
778 Ga0495687_016311
779 Ga0495675_0000577
780 Ga0495675_0004765
781 Ga0495685_000284
782 Ga0495681_0000813
783 Ga0495684_0041798
784 Ga0495593_0006770
785 Ga0495593_0023576
786 Ga0495602_0000123
787 Ga0495602_0073784
788 Ga0496102_0589884
789 Ga0496104_0064591
790 Ga0496104_0084767
791 Ga0496109_0128947
792 Ga0496109_0389896
793 Ga0496112_0056078
794 Ga0496112_0372318
795 Ga0496115_0001614
796 Ga0501031_0031856
797 Ga0501032_0162211
798 Ga0501033_0017874
799 Ga0501034_0411385
800 Ga0501036_0062737
801 Ga0501036_0423421
802 Ga0501037_0202189
803 Ga0501038_0004424
804 Ga0501039_0138687
805 Ga0501039_0246534
806 Ga0501040_0295060
807 Ga0501043_0171898
808 Ga0501067_0021109
809 Ga0501071_0439200
810 Ga0501072_0104935
811 Ga0501074_0045239
812 Ga0501077_0161178
813 Ga0501222_016605
814 Ga0501079_0037547
815 Ga0501080_0124179
816 Ga0501081_0088618
817 Ga0501081_0326539
818 Ga0501083_0186451
819 Ga0501035_0052218
820 Ga0501044_0029945
821 Ga0501044_0159833
822 nmdc:mga05p37_296070_c1
823 nmdc:mga05p37_321686_c1
824 nmdc:mga09592_143896_c1
825 nmdc:mga09592_297625_c1
826 nmdc:mga09592_322015_c1
827 nmdc:mga09592_615378_c1
828 nmdc:mga0qj67_84329_c1
829 nmdc:mga06r32_10098_c1
830 nmdc:mga06r32_113799_c1
831 nmdc:mga06r32_480518_c1
832 nmdc:mga06r32_5671_c1
833 nmdc:mga06r32_635636_c1
834 nmdc:mga0n895_147106_c1
835 nmdc:mga08x19_63370_c1
836 nmdc:mga0a205_4141_c1
837 Ga0495601_0060324
838 Ga0495655_0006456
839 Ga0500578_0004449
840 Ga0500583_0062795
841 Ga0500654_012617
842 Ga0500553_101024
843 Ga0500560_008000
844 Ga0500614_009838
845 Ga0500628_001373
846 Ga0500652_003399
847 Ga0500658_0002249
848 Ga0500600_0046774
849 Ga0500633_0014668
850 Ga0500587_001101
851 Ga0501084_0027239
852 Ga0501082_0026301
853 2552109792
854 2623591013
855 2816510081
856 2837183522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

34

211

0.93

PF05368

NmrA

NmrA-like family

30

216

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

31

133

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

170

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.8233 5 249
6jkh-assembly1.cif.gz_A the nad+-bound form of human nsdhl 0.801 1 132
2zcu-assembly1.cif.gz_A crystal structure of a new type of nadph-dependent quinone oxidoreductase (qor2) from escherichia coli 0.7958 5 249
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.7938 5 249
6jkg-assembly1.cif.gz_B the nad+-free form of human nsdhl 0.7926 1 131
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9036 3 36 3.40.50.720
af_P39315_2_136_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8276 6 129 3.40.50.720
af_A0A1D8PJA6_54_340_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8258 5 200 3.40.50.720
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8202 4 60 3.40.50.720
af_Q9N3H3_46_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.811 3 179 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q8CAJ5-F1-model_v4 NmrA family transcriptional regulator 0.9882 94 250
AF-K4REQ2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9807 84 252
AF-A0A536C2B3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9768 3 248 GO:0044877
GO:1901006
AF-A0A3A0AJE9-F1-model_v4 NmrA family transcriptional regulator 0.9754 3 250 GO:0044877
GO:1901006
AF-A0A1H9KH62-F1-model_v4 Uncharacterized protein 0.9754 120 246

Map