F441691

General Info

Members Datasets Scaffolds Average Seq Length
428 242 856 219

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10010248|Ga0207654_100102482
Length 264
Sequence MAKRPPVSGVRPAKRPIGPSKTAAPGADPVGKKRRPGTAKRLFADLAPRPDPGAGADGPPVVELIPEKPRLETVRDAAKDCRACDLYKRGTQTVFGEGPRKAEVMLVGEQPGDAEDLAGHPFVGPAGKLLDRALEEAGIDRKLVYVTNVVKHFKWEPRGKRRIHAKPNGSEIAACRPWLETEIALVKPRILVCLGATAAQALLGKSFKVTKQRGTFVPSPLAPRVTATVHLSSSGARRIDEGRHDEMRRFVADLERVAAALSQE

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.61
Rhizosphere 93.22
Stem 0
Stem Tuber 0
Unclassified 12.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10010248 3300025911 Bacteria 4770
2 JGI24749J21850_1007470 3300002076 Bacteria 1523
3 JGI24751J29686_10000019 3300002459 Bacteria 107056
4 JGI25406J46586_10031560 3300003203 Bacteria 1979
5 Ga0058859_11489022 3300004798 Bacteria 786
6 Ga0065712_10005422 3300005290 Bacteria 5319
7 Ga0065712_10007365 3300005290 Bacteria 2641
8 Ga0065712_10008978 3300005290 Bacteria 3604
9 Ga0065712_10069511 3300005290 Bacteria 7167
10 Ga0065712_10070075 3300005290 Bacteria 6353
11 Ga0065715_10104514 3300005293 Unclassified 2956
12 Ga0065715_10105296 3300005293 Unclassified 2903
13 Ga0065715_10155592 3300005293 Unclassified 1675
14 Ga0065715_10346456 3300005293 Bacteria 958
15 Ga0065707_10028301 3300005295 Bacteria 1512
16 Ga0070683_100005602 3300005329 Bacteria 10491
17 Ga0070683_100007344 3300005329 Bacteria 9310
18 Ga0070690_100064845 3300005330 Bacteria 2361
19 Ga0070690_100092837 3300005330 Unclassified 1990
20 Ga0070670_100000291 3300005331 Bacteria 44111
21 Ga0070670_100067115 3300005331 Bacteria 3079
22 Ga0070670_100080205 3300005331 Bacteria 2805
23 Ga0070670_100081126 3300005331 Unclassified 2787
24 Ga0070677_10006893 3300005333 Bacteria 3776
25 Ga0068869_100271397 3300005334 Bacteria 1361
26 Ga0070666_10063955 3300005335 Bacteria 2495
27 Ga0070680_100068930 3300005336 Unclassified 2904
28 Ga0070680_100280503 3300005336 Bacteria 1412
29 Ga0070680_100512355 3300005336 Bacteria 1027
30 Ga0070682_100306808 3300005337 Bacteria 1167
31 Ga0068868_100292841 3300005338 Bacteria 1381
32 Ga0068868_100479264 3300005338 Bacteria 1086
33 Ga0070660_100034347 3300005339 Bacteria 3831
34 Ga0070660_100566655 3300005339 Bacteria 948
35 Ga0070689_100331602 3300005340 Unclassified 1273
36 Ga0070687_100300777 3300005343 Viruses 1018
37 Ga0070661_100202828 3300005344 Bacteria 1516
38 Ga0070661_100233429 3300005344 Bacteria 1414
39 Ga0070669_100487915 3300005353 Bacteria 1020
40 Ga0070669_100779607 3300005353 Bacteria 811
41 Ga0070675_100005785 3300005354 Bacteria 9462
42 Ga0070675_100124256 3300005354 Bacteria 2195
43 Ga0070675_100325361 3300005354 Bacteria 1359
44 Ga0070671_100212813 3300005355 Bacteria 1639
45 Ga0070674_100023159 3300005356 Bacteria 4015
46 Ga0070673_100000482 3300005364 Bacteria 21192
47 Ga0070673_100039163 3300005364 Bacteria 3625
48 Ga0070673_100374250 3300005364 Unclassified 1269
49 Ga0070688_100056343 3300005365 Bacteria 2468
50 Ga0070659_100128927 3300005366 Bacteria 2053
51 Ga0070659_100143910 3300005366 Bacteria 1942
52 Ga0070659_100438019 3300005366 Bacteria 1107
53 Ga0070667_100099796 3300005367 Bacteria 2507
54 Ga0070709_10027484 3300005434 Bacteria 3383
55 Ga0070709_10366301 3300005434 Bacteria 1068
56 Ga0070714_100035101 3300005435 Bacteria 4201
57 Ga0070714_100448210 3300005435 Bacteria 1225
58 Ga0070713_100025497 3300005436 Bacteria 4623
59 Ga0070713_100236167 3300005436 Unclassified 1663
60 Ga0070713_100281332 3300005436 Bacteria 1526
61 Ga0070711_100111744 3300005439 Bacteria 2006
62 Ga0070711_100528486 3300005439 Bacteria 976
63 Ga0070705_100013016 3300005440 Bacteria 4245
64 Ga0070700_100005771 3300005441 Bacteria 6571
65 Ga0070700_100009835 3300005441 Bacteria 5260
66 Ga0070700_100458089 3300005441 Unclassified 972
67 Ga0070694_100178690 3300005444 Bacteria 1568
68 Ga0070694_100180761 3300005444 Bacteria 1560
69 Ga0070694_100520935 3300005444 Bacteria 948
70 Ga0070678_100067259 3300005456 Bacteria 2666
71 Ga0070678_100175462 3300005456 Bacteria 1749
72 Ga0070678_100619315 3300005456 Bacteria 968
73 Ga0070662_100055384 3300005457 Bacteria 2877
74 Ga0070662_100150215 3300005457 Bacteria 1813
75 Ga0070662_100264564 3300005457 Bacteria 1386
76 Ga0070681_10025832 3300005458 Bacteria 5905
77 Ga0070681_10179320 3300005458 Bacteria 2040
78 Ga0070681_10249428 3300005458 Bacteria 1688
79 Ga0070681_10321483 3300005458 Bacteria 1457
80 Ga0068867_100319694 3300005459 Bacteria 1285
81 Ga0070685_10030754 3300005466 Bacteria 2994
82 Ga0070706_100000691 3300005467 Bacteria 38197
83 Ga0070706_100023386 3300005467 Bacteria 5691
84 Ga0070707_100002993 3300005468 Bacteria 16044
85 Ga0070707_100009725 3300005468 Bacteria 8937
86 Ga0070707_100510017 3300005468 Bacteria 1165
87 Ga0070698_100628057 3300005471 Bacteria 1015
88 Ga0070679_100108672 3300005530 Bacteria 2759
89 Ga0070679_100143587 3300005530 Bacteria 2365
90 Ga0070679_100405879 3300005530 Bacteria 1308
91 Ga0070679_100639326 3300005530 Bacteria 1007
92 Ga0070684_100000403 3300005535 Bacteria 29597
93 Ga0070697_100165235 3300005536 Bacteria 1871
94 Ga0070672_100001481 3300005543 Bacteria 14576
95 Ga0070672_100038780 3300005543 Bacteria 3643
96 Ga0070672_100299782 3300005543 Bacteria 1362
97 Ga0070672_100574992 3300005543 Unclassified 980
98 Ga0070695_100102032 3300005545 Unclassified 1934
99 Ga0070695_100415936 3300005545 Bacteria 1023
100 Ga0070696_100076841 3300005546 Bacteria 2358
101 Ga0070665_100082998 3300005548 Bacteria 3209
102 Ga0070665_100186858 3300005548 Bacteria 2073
103 Ga0070704_100258792 3300005549 Bacteria 1433
104 Ga0068855_100026180 3300005563 Bacteria 6978
105 Ga0068855_100531002 3300005563 Bacteria 1275
106 Ga0070664_100031406 3300005564 Bacteria 4437
107 Ga0070664_100440115 3300005564 Bacteria 1196
108 Ga0068857_100056930 3300005577 Unclassified 3470
109 Ga0068857_100092177 3300005577 Bacteria 2712
110 Ga0068857_100351765 3300005577 Bacteria 1364
111 Ga0068857_100527233 3300005577 Bacteria 1111
112 Ga0068854_100161080 3300005578 Bacteria 1738
113 Ga0068856_100080023 3300005614 Unclassified 3241
114 Ga0068856_100612526 3300005614 Bacteria 1110
115 Ga0070702_100046674 3300005615 Bacteria 2456
116 Ga0068852_100155937 3300005616 Bacteria 2127
117 Ga0068852_100183809 3300005616 Bacteria 1967
118 Ga0068859_100070894 3300005617 Bacteria 3520
119 Ga0068859_100298974 3300005617 Unclassified 1703
120 Ga0068864_100195888 3300005618 Unclassified 1854
121 Ga0068864_100200229 3300005618 Bacteria 1834
122 Ga0068864_100591037 3300005618 Bacteria 1076
123 Ga0068866_10272429 3300005718 Bacteria 1045
124 Ga0068861_100134307 3300005719 Bacteria 2012
125 Ga0068870_10010035 3300005840 Unclassified 4332
126 Ga0068870_10112153 3300005840 Bacteria 1559
127 Ga0068863_100059558 3300005841 Bacteria 3612
128 Ga0068863_100380809 3300005841 Bacteria 1377
129 Ga0068858_100264994 3300005842 Bacteria 1634
130 Ga0068858_100281557 3300005842 Bacteria 1583
131 Ga0068858_100287112 3300005842 Bacteria 1567
132 Ga0068860_100533305 3300005843 Bacteria 1174
133 Ga0081455_10000328 3300005937 Bacteria 62204
134 Ga0081539_10000139 3300005985 Bacteria 170623
135 Ga0081539_10000631 3300005985 Bacteria 71279
136 Ga0081539_10003387 3300005985 Bacteria 19732
137 Ga0070717_10325817 3300006028 Bacteria 1369
138 Ga0070716_100068306 3300006173 Bacteria 2079
139 Ga0070712_100390420 3300006175 Bacteria 1147
140 Ga0070712_100487389 3300006175 Unclassified 1032
141 Ga0097621_100009338 3300006237 Bacteria 7120
142 Ga0097621_100433105 3300006237 Bacteria 1182
143 Ga0068871_100014210 3300006358 Bacteria 5928
144 Ga0075430_100017614 3300006846 Bacteria 6082
145 Ga0075433_10080797 3300006852 Bacteria 2866
146 Ga0075434_100034898 3300006871 Bacteria 4971
147 Ga0075434_100116221 3300006871 Bacteria 2688
148 Ga0075434_100275562 3300006871 Bacteria 1701
149 Ga0075434_100286210 3300006871 Unclassified 1668
150 Ga0075434_100476252 3300006871 Bacteria 1270
151 Ga0075429_100006948 3300006880 Bacteria 9834
152 Ga0068865_100338257 3300006881 Bacteria 1216
153 Ga0068865_100838439 3300006881 Viruses 796
154 Ga0097620_100070893 3300006931 Bacteria 3520
155 Ga0097620_100121891 3300006931 Unclassified 2674
156 Ga0097620_100298986 3300006931 Unclassified 1703
157 Ga0097620_100816495 3300006931 Bacteria 1019
158 Ga0075435_100000582 3300007076 Bacteria 22326
159 Ga0075435_100000857 3300007076 Bacteria 19032
160 Ga0099794_10148513 3300007265 Unclassified 1189
161 Ga0105240_10066328 3300009093 Bacteria 4478
162 Ga0105240_10456570 3300009093 Bacteria 1428
163 Ga0105240_10900784 3300009093 Bacteria 951
164 Ga0111539_10012486 3300009094 Bacteria 10646
165 Ga0111539_10283760 3300009094 Bacteria 1927
166 Ga0111539_10585212 3300009094 Bacteria 1300
167 Ga0111539_11987706 3300009094 Unclassified 674
168 Ga0105245_10501698 3300009098 Bacteria 1230
169 Ga0105247_10004551 3300009101 Bacteria 8840
170 Ga0105247_10006554 3300009101 Bacteria 7199
171 Ga0114129_10037877 3300009147 Bacteria 6805
172 Ga0114129_10143769 3300009147 Bacteria 3268
173 Ga0114129_10247261 3300009147 Unclassified 2396
174 Ga0114129_10310567 3300009147 Unclassified 2099
175 Ga0114129_10867775 3300009147 Bacteria 1146
176 Ga0105243_10138045 3300009148 Bacteria 2077
177 Ga0105243_10352193 3300009148 Bacteria 1352
178 Ga0105243_11156329 3300009148 Unclassified 785
179 Ga0105242_10026615 3300009176 Bacteria 4585
180 Ga0105242_10147519 3300009176 Bacteria 2048
181 Ga0105242_10728709 3300009176 Unclassified 973
182 Ga0105248_10249207 3300009177 Bacteria 1999
183 Ga0105248_10313563 3300009177 Bacteria 1767
184 Ga0105248_11012175 3300009177 Unclassified 939
185 Ga0105248_11848455 3300009177 Unclassified 685
186 Ga0105237_10017514 3300009545 Bacteria 7425
187 Ga0105238_10005228 3300009551 Bacteria 12824
188 Ga0105238_10139699 3300009551 Bacteria 2399
189 Ga0099796_10039167 3300010159 Bacteria 1594
190 Ga0099796_10065943 3300010159 Bacteria 1296
191 Ga0105239_10046662 3300010375 Bacteria 4747
192 Ga0105239_10184838 3300010375 Bacteria 2332
193 Ga0105239_10343436 3300010375 Bacteria 1685
194 Ga0105239_10417526 3300010375 Bacteria 1519
195 Ga0157373_10002172 3300013100 Bacteria 14865
196 Ga0157371_10488247 3300013102 Unclassified 909
197 Ga0157370_10033714 3300013104 Bacteria 4991
198 Ga0157370_10563624 3300013104 Bacteria 1044
199 Ga0157369_10261894 3300013105 Bacteria 1803
200 Ga0157374_10085803 3300013296 Bacteria 2994
201 Ga0157374_10149481 3300013296 Bacteria 2270
202 Ga0157378_10000218 3300013297 Bacteria 55703
203 Ga0157378_10454169 3300013297 Bacteria 1272
204 Ga0163162_10186695 3300013306 Bacteria 2200
205 Ga0157372_10209208 3300013307 Bacteria 2260
206 Ga0157372_10517922 3300013307 Bacteria 1390
207 Ga0157372_11009040 3300013307 Bacteria 964
208 Ga0157375_10000481 3300013308 Bacteria 36338
209 Ga0157375_10154281 3300013308 Bacteria 2434
210 Ga0157375_10609173 3300013308 Bacteria 1251
211 Ga0157375_10710988 3300013308 Bacteria 1158
212 Ga0157375_11350742 3300013308 Bacteria 839
213 Ga0163163_10056944 3300014325 Bacteria 3864
214 Ga0163163_10275957 3300014325 Bacteria 1732
215 Ga0157380_10751167 3300014326 Bacteria 987
216 Ga0157377_10092772 3300014745 Bacteria 1786
217 Ga0157379_10104936 3300014968 Unclassified 2536
218 Ga0157379_10255575 3300014968 Bacteria 1591
219 Ga0157379_10303801 3300014968 Bacteria 1455
220 Ga0157376_10018475 3300014969 Bacteria 5347
221 Ga0157376_10021665 3300014969 Bacteria 4994
222 Ga0157376_10211124 3300014969 Bacteria 1792
223 Ga0163161_10693463 3300017792 Bacteria 847
224 Ga0206356_10618689 3300020070 Bacteria 883
225 Ga0206353_10847676 3300020082 Bacteria 863
226 Ga0213873_10000001 3300021358 Bacteria 1657979
227 Ga0213876_10000002 3300021384 Bacteria 1168769
228 Ga0213876_10072297 3300021384 Bacteria 1821
229 Ga0224712_10028826 3300022467 Bacteria 1988
230 Ga0207697_10017670 3300025315 Bacteria 2930
231 Ga0207697_10221486 3300025315 Bacteria 835
232 Ga0207692_10081871 3300025898 Bacteria 1728
233 Ga0207680_10129656 3300025903 Bacteria 1660
234 Ga0207699_10301921 3300025906 Bacteria 1118
235 Ga0207699_10449919 3300025906 Bacteria 924
236 Ga0207645_10016231 3300025907 Bacteria 4932
237 Ga0207643_10020582 3300025908 Bacteria 3621
238 Ga0207684_10006454 3300025910 Bacteria 10691
239 Ga0207684_10006674 3300025910 Bacteria 10485
240 Ga0207707_10089404 3300025912 Bacteria 2691
241 Ga0207707_10433639 3300025912 Bacteria 1125
242 Ga0207695_10105603 3300025913 Bacteria 2803
243 Ga0207695_10249678 3300025913 Bacteria 1674
244 Ga0207695_10324762 3300025913 Bacteria 1428
245 Ga0207693_10087122 3300025915 Bacteria 2447
246 Ga0207693_10122208 3300025915 Bacteria 2045
247 Ga0207663_10316609 3300025916 Bacteria 1171
248 Ga0207663_10430410 3300025916 Bacteria 1014
249 Ga0207660_10079432 3300025917 Bacteria 2406
250 Ga0207660_10196954 3300025917 Bacteria 1572
251 Ga0207662_10026439 3300025918 Bacteria 3347
252 Ga0207662_10131511 3300025918 Unclassified 1578
253 Ga0207657_10093008 3300025919 Bacteria 2512
254 Ga0207657_10445793 3300025919 Bacteria 1016
255 Ga0207649_10079542 3300025920 Bacteria 2118
256 Ga0207649_10097929 3300025920 Bacteria 1935
257 Ga0207652_10023615 3300025921 Bacteria 5096
258 Ga0207652_10056782 3300025921 Unclassified 3370
259 Ga0207652_10228007 3300025921 Bacteria 1679
260 Ga0207652_10393438 3300025921 Bacteria 1251
261 Ga0207646_10001182 3300025922 Bacteria 32937
262 Ga0207646_10007370 3300025922 Bacteria 11196
263 Ga0207646_10359177 3300025922 Bacteria 1316
264 Ga0207681_10093080 3300025923 Unclassified 2156
265 Ga0207681_10207291 3300025923 Bacteria 1509
266 Ga0207681_10565008 3300025923 Bacteria 937
267 Ga0207694_10041272 3300025924 Bacteria 3555
268 Ga0207650_10003668 3300025925 Bacteria 10503
269 Ga0207650_10009068 3300025925 Bacteria 6800
270 Ga0207650_10031522 3300025925 Bacteria 3829
271 Ga0207650_10094327 3300025925 Bacteria 2292
272 Ga0207659_10008750 3300025926 Bacteria 6304
273 Ga0207659_10262626 3300025926 Bacteria 1405
274 Ga0207687_10221376 3300025927 Bacteria 1490
275 Ga0207700_10034667 3300025928 Bacteria 3626
276 Ga0207700_10045357 3300025928 Bacteria 3243
277 Ga0207700_10067879 3300025928 Bacteria 2731
278 Ga0207700_10387622 3300025928 Bacteria 1223
279 Ga0207664_10124162 3300025929 Bacteria 2165
280 Ga0207644_10049570 3300025931 Bacteria 3007
281 Ga0207644_10116081 3300025931 Bacteria 2031
282 Ga0207686_10877978 3300025934 Bacteria 723
283 Ga0207709_10026793 3300025935 Bacteria 3314
284 Ga0207709_10227443 3300025935 Unclassified 1349
285 Ga0207709_10426345 3300025935 Bacteria 1020
286 Ga0207669_10006092 3300025937 Bacteria 5475
287 Ga0207665_10005537 3300025939 Bacteria 8421
288 Ga0207665_10294266 3300025939 Bacteria 1212
289 Ga0207691_10000725 3300025940 Bacteria 32565
290 Ga0207691_10114065 3300025940 Bacteria 2401
291 Ga0207691_10302675 3300025940 Bacteria 1373
292 Ga0207691_10319419 3300025940 Bacteria 1332
293 Ga0207711_10765390 3300025941 Bacteria 900
294 Ga0207689_10139356 3300025942 Unclassified 1998
295 Ga0207661_10003446 3300025944 Bacteria 10979
296 Ga0207679_10036328 3300025945 Bacteria 3494
297 Ga0207667_10057605 3300025949 Bacteria 4078
298 Ga0207667_10302255 3300025949 Bacteria 1635
299 Ga0207651_10000222 3300025960 Bacteria 24389
300 Ga0207712_10563115 3300025961 Bacteria 982
301 Ga0207658_10159493 3300025986 Bacteria 1847
302 Ga0207677_10655045 3300026023 Bacteria 927
303 Ga0207703_10221284 3300026035 Bacteria 1693
304 Ga0207678_10210082 3300026067 Bacteria 1665
305 Ga0207708_10074287 3300026075 Bacteria 2605
306 Ga0207708_10547286 3300026075 Unclassified 976
307 Ga0207702_10648468 3300026078 Bacteria 1038
308 Ga0207648_10007184 3300026089 Bacteria 10980
309 Ga0207676_10032604 3300026095 Bacteria 3928
310 Ga0207676_10173930 3300026095 Bacteria 1879
311 Ga0207674_10026294 3300026116 Bacteria 6186
312 Ga0207674_10111274 3300026116 Bacteria 2713
313 Ga0207674_10250019 3300026116 Bacteria 1720
314 Ga0207675_100064937 3300026118 Bacteria 3411
315 Ga0207675_100279294 3300026118 Bacteria 1622
316 Ga0207683_10262381 3300026121 Bacteria 1577
317 Ga0207683_10268446 3300026121 Bacteria 1558
318 Ga0207683_10302363 3300026121 Bacteria 1464
319 Ga0207698_10090222 3300026142 Bacteria 2506
320 Ga0207698_10215521 3300026142 Bacteria 1731
321 Ga0207428_10075165 3300027907 Bacteria 2648
322 Ga0207428_10155582 3300027907 Bacteria 1739
323 Ga0268266_10186015 3300028379 Bacteria 1894
324 Ga0307408_100126881 3300031548 Unclassified 1985
325 Ga0307412_10065137 3300031911 Bacteria 2465
326 Ga0307416_100120697 3300032002 Bacteria 2335
327 Ga0307416_100278033 3300032002 Bacteria 1649
328 Ga0307415_100529357 3300032126 Bacteria 1036
329 Ga0373955_0027649 3300035172 Bacteria 2935
330 Ga0373935_0726429 3300035692 Bacteria 731
331 Ga0373937_0000248 3300036401 Bacteria 52740
332 Ga0373937_0155401 3300036401 Bacteria 2144
333 Ga0373925_0565838 3300037068 Unclassified 935
334 Ga0395900_0539802 3300037418 Bacteria 1112
335 Ga0395905_0607109 3300037471 Bacteria 996
336 Ga0395901_0308387 3300038443 Bacteria 1640
337 Ga0395901_0510380 3300038443 Bacteria 1223
338 Ga0436365_0693404 3300039437 Bacteria 102624
339 Ga0436365_1250347 3300039437 Bacteria 2891
340 Ga0436362_0984254 3300039453 Bacteria 405590
341 Ga0451800_1564240 3300041459 Unclassified 837
342 Ga0439455_0023184 3300042012 Unclassified 1493
343 Ga0439455_0077403 3300042012 Bacteria 900
344 Ga0439458_0022072 3300042157 Unclassified 1477
345 Ga0451577_0030045 3300042876 Bacteria 4910
346 Ga0453683_0071275 3300044673 Bacteria 2174
347 Ga0466957_0000202 3300044842 Bacteria 27701
348 Ga0466960_0217591 3300044901 Unclassified 1050
349 Ga0466967_0201402 3300045976 Bacteria 1886
350 Ga0495592_0004183 3300046454 Bacteria 10538
351 Ga0495629_0040522 3300046459 Bacteria 3276
352 Ga0495641_0046895 3300046461 Bacteria 1986
353 Ga0495580_0382269 3300046472 Viruses 951
354 Ga0495664_0285093 3300046477 Unclassified 998
355 Ga0495620_0000133 3300046515 Bacteria 60765
356 Ga0495628_0003632 3300046516 Bacteria 13774
357 Ga0495630_0038234 3300046517 Bacteria 3590
358 Ga0495666_0036785 3300046526 Bacteria 2384
359 Ga0495652_0003486 3300046529 Bacteria 15501
360 Ga0495587_0123880 3300046536 Bacteria 1479
361 Ga0495645_0001076 3300046543 Bacteria 18525
362 Ga0495599_0000317 3300046678 Bacteria 28802
363 Ga0495623_0005729 3300046679 Bacteria 8110
364 Ga0495646_0037657 3300046680 Unclassified 2990
365 Ga0495658_0088798 3300046683 Unclassified 1827
366 Ga0495581_0207659 3300047315 Unclassified 1145
367 Ga0495674_0067324 3300047319 Unclassified 3103
368 Ga0495674_0551571 3300047319 Unclassified 917
369 Ga0495676_0170222 3300047321 Unclassified 1534
370 Ga0495602_0013076 3300048088 Bacteria 8487
371 Ga0496100_0195570 3300048903 Bacteria 1471
372 Ga0496101_0129554 3300048904 Bacteria 1915
373 Ga0496104_0010848 3300048907 Bacteria 8148
374 Ga0496104_0416555 3300048907 Bacteria 1256
375 Ga0496105_0016822 3300048908 Bacteria 5847
376 Ga0496105_0175601 3300048908 Bacteria 1755
377 Ga0496105_0214632 3300048908 Unclassified 1568
378 Ga0496106_0075999 3300048909 Bacteria 2574
379 Ga0496106_0205850 3300048909 Bacteria 1567
380 Ga0496108_0022749 3300048911 Bacteria 5156
381 Ga0496108_0026135 3300048911 Bacteria 4815
382 Ga0496109_0002337 3300048912 Bacteria 15810
383 Ga0496109_0028674 3300048912 Bacteria 4982
384 Ga0496109_0331935 3300048912 Bacteria 1436
385 Ga0496109_0494000 3300048912 Bacteria 1155
386 Ga0496110_0093974 3300048913 Bacteria 2684
387 Ga0496111_0051209 3300048914 Bacteria 2981
388 Ga0496111_0294369 3300048914 Unclassified 1204
389 Ga0496112_0001195 3300048915 Bacteria 19467
390 Ga0496112_0145306 3300048915 Bacteria 2340
391 Ga0496112_0181752 3300048915 Bacteria 2067
392 Ga0496112_0259365 3300048915 Bacteria 1688
393 Ga0496114_0249573 3300048917 Bacteria 1561
394 Ga0501034_0072824 3300049571 Bacteria 3444
395 Ga0501039_0011048 3300049575 Bacteria 6882
396 Ga0501039_0056704 3300049575 Bacteria 3035
397 Ga0501040_0006057 3300049576 Bacteria 7835
398 Ga0501041_0132882 3300049577 Bacteria 1550
399 Ga0501042_0009654 3300049578 Bacteria 6443
400 Ga0501048_0007756 3300049582 Bacteria 8136
401 Ga0501071_0044770 3300049587 Bacteria 3175
402 Ga0501072_0016533 3300049588 Bacteria 5668
403 Ga0501074_0107537 3300049590 Bacteria 1997
404 Ga0501074_0362148 3300049590 Bacteria 1029
405 Ga0501075_0071440 3300049591 Bacteria 2623
406 Ga0501076_0001933 3300049592 Bacteria 14141
407 Ga0501077_0090914 3300049593 Bacteria 1934
408 Ga0501081_0079942 3300049743 Bacteria 2287
409 Ga0501081_0227362 3300049743 Bacteria 1358
410 Ga0501035_0076263 3300049822 Bacteria 2965
411 Ga0501044_0121320 3300049823 Bacteria 2615
412 Ga0501045_0008677 3300049824 Bacteria 7087
413 Ga0501045_0093722 3300049824 Bacteria 2221
414 nmdc:mga05p37_1297110_c1 3300050507 Unclassified 743
415 nmdc:mga05p37_637377_c1 3300050507 Bacteria 1196
416 nmdc:mga06r32_32041_c1 3300050510 Bacteria 4941
417 nmdc:mga06r32_388315_c1 3300050510 Bacteria 1378
418 nmdc:mga08y16_12851_c1 3300050511 Bacteria 8803
419 nmdc:mga08y16_274567_c1 3300050511 Bacteria 1739
420 nmdc:mga08y16_787651_c1 3300050511 Bacteria 944
421 nmdc:mga0n895_345088_c1 3300050512 Bacteria 1508
422 nmdc:mga0n895_3583_c1 3300050512 Bacteria 12550
423 nmdc:mga0a205_424918_c1 3300050515 Bacteria 1191
424 nmdc:mga0a205_548495_c1 3300050515 Bacteria 1011
425 Ga0495601_0000388 3300053077 Bacteria 23301
426 Ga0501084_0023477 3300054114 Bacteria 5146
427 Ga0501082_0160684 3300060353 Bacteria 1952
428 Ga0530510_0017554 3300061734 Bacteria 5071
429 Ga0207654_10010248
430 JGI24749J21850_1007470
431 JGI24751J29686_10000019
432 JGI25406J46586_10031560
433 Ga0058859_11489022
434 Ga0065712_10005422
435 Ga0065712_10007365
436 Ga0065712_10008978
437 Ga0065712_10069511
438 Ga0065712_10070075
439 Ga0065715_10104514
440 Ga0065715_10105296
441 Ga0065715_10155592
442 Ga0065715_10346456
443 Ga0065707_10028301
444 Ga0070683_100005602
445 Ga0070683_100007344
446 Ga0070690_100064845
447 Ga0070690_100092837
448 Ga0070670_100000291
449 Ga0070670_100067115
450 Ga0070670_100080205
451 Ga0070670_100081126
452 Ga0070677_10006893
453 Ga0068869_100271397
454 Ga0070666_10063955
455 Ga0070680_100068930
456 Ga0070680_100280503
457 Ga0070680_100512355
458 Ga0070682_100306808
459 Ga0068868_100292841
460 Ga0068868_100479264
461 Ga0070660_100034347
462 Ga0070660_100566655
463 Ga0070689_100331602
464 Ga0070687_100300777
465 Ga0070661_100202828
466 Ga0070661_100233429
467 Ga0070669_100487915
468 Ga0070669_100779607
469 Ga0070675_100005785
470 Ga0070675_100124256
471 Ga0070675_100325361
472 Ga0070671_100212813
473 Ga0070674_100023159
474 Ga0070673_100000482
475 Ga0070673_100039163
476 Ga0070673_100374250
477 Ga0070688_100056343
478 Ga0070659_100128927
479 Ga0070659_100143910
480 Ga0070659_100438019
481 Ga0070667_100099796
482 Ga0070709_10027484
483 Ga0070709_10366301
484 Ga0070714_100035101
485 Ga0070714_100448210
486 Ga0070713_100025497
487 Ga0070713_100236167
488 Ga0070713_100281332
489 Ga0070711_100111744
490 Ga0070711_100528486
491 Ga0070705_100013016
492 Ga0070700_100005771
493 Ga0070700_100009835
494 Ga0070700_100458089
495 Ga0070694_100178690
496 Ga0070694_100180761
497 Ga0070694_100520935
498 Ga0070678_100067259
499 Ga0070678_100175462
500 Ga0070678_100619315
501 Ga0070662_100055384
502 Ga0070662_100150215
503 Ga0070662_100264564
504 Ga0070681_10025832
505 Ga0070681_10179320
506 Ga0070681_10249428
507 Ga0070681_10321483
508 Ga0068867_100319694
509 Ga0070685_10030754
510 Ga0070706_100000691
511 Ga0070706_100023386
512 Ga0070707_100002993
513 Ga0070707_100009725
514 Ga0070707_100510017
515 Ga0070698_100628057
516 Ga0070679_100108672
517 Ga0070679_100143587
518 Ga0070679_100405879
519 Ga0070679_100639326
520 Ga0070684_100000403
521 Ga0070697_100165235
522 Ga0070672_100001481
523 Ga0070672_100038780
524 Ga0070672_100299782
525 Ga0070672_100574992
526 Ga0070695_100102032
527 Ga0070695_100415936
528 Ga0070696_100076841
529 Ga0070665_100082998
530 Ga0070665_100186858
531 Ga0070704_100258792
532 Ga0068855_100026180
533 Ga0068855_100531002
534 Ga0070664_100031406
535 Ga0070664_100440115
536 Ga0068857_100056930
537 Ga0068857_100092177
538 Ga0068857_100351765
539 Ga0068857_100527233
540 Ga0068854_100161080
541 Ga0068856_100080023
542 Ga0068856_100612526
543 Ga0070702_100046674
544 Ga0068852_100155937
545 Ga0068852_100183809
546 Ga0068859_100070894
547 Ga0068859_100298974
548 Ga0068864_100195888
549 Ga0068864_100200229
550 Ga0068864_100591037
551 Ga0068866_10272429
552 Ga0068861_100134307
553 Ga0068870_10010035
554 Ga0068870_10112153
555 Ga0068863_100059558
556 Ga0068863_100380809
557 Ga0068858_100264994
558 Ga0068858_100281557
559 Ga0068858_100287112
560 Ga0068860_100533305
561 Ga0081455_10000328
562 Ga0081539_10000139
563 Ga0081539_10000631
564 Ga0081539_10003387
565 Ga0070717_10325817
566 Ga0070716_100068306
567 Ga0070712_100390420
568 Ga0070712_100487389
569 Ga0097621_100009338
570 Ga0097621_100433105
571 Ga0068871_100014210
572 Ga0075430_100017614
573 Ga0075433_10080797
574 Ga0075434_100034898
575 Ga0075434_100116221
576 Ga0075434_100275562
577 Ga0075434_100286210
578 Ga0075434_100476252
579 Ga0075429_100006948
580 Ga0068865_100338257
581 Ga0068865_100838439
582 Ga0097620_100070893
583 Ga0097620_100121891
584 Ga0097620_100298986
585 Ga0097620_100816495
586 Ga0075435_100000582
587 Ga0075435_100000857
588 Ga0099794_10148513
589 Ga0105240_10066328
590 Ga0105240_10456570
591 Ga0105240_10900784
592 Ga0111539_10012486
593 Ga0111539_10283760
594 Ga0111539_10585212
595 Ga0111539_11987706
596 Ga0105245_10501698
597 Ga0105247_10004551
598 Ga0105247_10006554
599 Ga0114129_10037877
600 Ga0114129_10143769
601 Ga0114129_10247261
602 Ga0114129_10310567
603 Ga0114129_10867775
604 Ga0105243_10138045
605 Ga0105243_10352193
606 Ga0105243_11156329
607 Ga0105242_10026615
608 Ga0105242_10147519
609 Ga0105242_10728709
610 Ga0105248_10249207
611 Ga0105248_10313563
612 Ga0105248_11012175
613 Ga0105248_11848455
614 Ga0105237_10017514
615 Ga0105238_10005228
616 Ga0105238_10139699
617 Ga0099796_10039167
618 Ga0099796_10065943
619 Ga0105239_10046662
620 Ga0105239_10184838
621 Ga0105239_10343436
622 Ga0105239_10417526
623 Ga0157373_10002172
624 Ga0157371_10488247
625 Ga0157370_10033714
626 Ga0157370_10563624
627 Ga0157369_10261894
628 Ga0157374_10085803
629 Ga0157374_10149481
630 Ga0157378_10000218
631 Ga0157378_10454169
632 Ga0163162_10186695
633 Ga0157372_10209208
634 Ga0157372_10517922
635 Ga0157372_11009040
636 Ga0157375_10000481
637 Ga0157375_10154281
638 Ga0157375_10609173
639 Ga0157375_10710988
640 Ga0157375_11350742
641 Ga0163163_10056944
642 Ga0163163_10275957
643 Ga0157380_10751167
644 Ga0157377_10092772
645 Ga0157379_10104936
646 Ga0157379_10255575
647 Ga0157379_10303801
648 Ga0157376_10018475
649 Ga0157376_10021665
650 Ga0157376_10211124
651 Ga0163161_10693463
652 Ga0206356_10618689
653 Ga0206353_10847676
654 Ga0213873_10000001
655 Ga0213876_10000002
656 Ga0213876_10072297
657 Ga0224712_10028826
658 Ga0207697_10017670
659 Ga0207697_10221486
660 Ga0207692_10081871
661 Ga0207680_10129656
662 Ga0207699_10301921
663 Ga0207699_10449919
664 Ga0207645_10016231
665 Ga0207643_10020582
666 Ga0207684_10006454
667 Ga0207684_10006674
668 Ga0207707_10089404
669 Ga0207707_10433639
670 Ga0207695_10105603
671 Ga0207695_10249678
672 Ga0207695_10324762
673 Ga0207693_10087122
674 Ga0207693_10122208
675 Ga0207663_10316609
676 Ga0207663_10430410
677 Ga0207660_10079432
678 Ga0207660_10196954
679 Ga0207662_10026439
680 Ga0207662_10131511
681 Ga0207657_10093008
682 Ga0207657_10445793
683 Ga0207649_10079542
684 Ga0207649_10097929
685 Ga0207652_10023615
686 Ga0207652_10056782
687 Ga0207652_10228007
688 Ga0207652_10393438
689 Ga0207646_10001182
690 Ga0207646_10007370
691 Ga0207646_10359177
692 Ga0207681_10093080
693 Ga0207681_10207291
694 Ga0207681_10565008
695 Ga0207694_10041272
696 Ga0207650_10003668
697 Ga0207650_10009068
698 Ga0207650_10031522
699 Ga0207650_10094327
700 Ga0207659_10008750
701 Ga0207659_10262626
702 Ga0207687_10221376
703 Ga0207700_10034667
704 Ga0207700_10045357
705 Ga0207700_10067879
706 Ga0207700_10387622
707 Ga0207664_10124162
708 Ga0207644_10049570
709 Ga0207644_10116081
710 Ga0207686_10877978
711 Ga0207709_10026793
712 Ga0207709_10227443
713 Ga0207709_10426345
714 Ga0207669_10006092
715 Ga0207665_10005537
716 Ga0207665_10294266
717 Ga0207691_10000725
718 Ga0207691_10114065
719 Ga0207691_10302675
720 Ga0207691_10319419
721 Ga0207711_10765390
722 Ga0207689_10139356
723 Ga0207661_10003446
724 Ga0207679_10036328
725 Ga0207667_10057605
726 Ga0207667_10302255
727 Ga0207651_10000222
728 Ga0207712_10563115
729 Ga0207658_10159493
730 Ga0207677_10655045
731 Ga0207703_10221284
732 Ga0207678_10210082
733 Ga0207708_10074287
734 Ga0207708_10547286
735 Ga0207702_10648468
736 Ga0207648_10007184
737 Ga0207676_10032604
738 Ga0207676_10173930
739 Ga0207674_10026294
740 Ga0207674_10111274
741 Ga0207674_10250019
742 Ga0207675_100064937
743 Ga0207675_100279294
744 Ga0207683_10262381
745 Ga0207683_10268446
746 Ga0207683_10302363
747 Ga0207698_10090222
748 Ga0207698_10215521
749 Ga0207428_10075165
750 Ga0207428_10155582
751 Ga0268266_10186015
752 Ga0307408_100126881
753 Ga0307412_10065137
754 Ga0307416_100120697
755 Ga0307416_100278033
756 Ga0307415_100529357
757 Ga0373955_0027649
758 Ga0373935_0726429
759 Ga0373937_0000248
760 Ga0373937_0155401
761 Ga0373925_0565838
762 Ga0395900_0539802
763 Ga0395905_0607109
764 Ga0395901_0308387
765 Ga0395901_0510380
766 Ga0436365_0693404
767 Ga0436365_1250347
768 Ga0436362_0984254
769 Ga0451800_1564240
770 Ga0439455_0023184
771 Ga0439455_0077403
772 Ga0439458_0022072
773 Ga0451577_0030045
774 Ga0453683_0071275
775 Ga0466957_0000202
776 Ga0466960_0217591
777 Ga0466967_0201402
778 Ga0495592_0004183
779 Ga0495629_0040522
780 Ga0495641_0046895
781 Ga0495580_0382269
782 Ga0495664_0285093
783 Ga0495620_0000133
784 Ga0495628_0003632
785 Ga0495630_0038234
786 Ga0495666_0036785
787 Ga0495652_0003486
788 Ga0495587_0123880
789 Ga0495645_0001076
790 Ga0495599_0000317
791 Ga0495623_0005729
792 Ga0495646_0037657
793 Ga0495658_0088798
794 Ga0495581_0207659
795 Ga0495674_0067324
796 Ga0495674_0551571
797 Ga0495676_0170222
798 Ga0495602_0013076
799 Ga0496100_0195570
800 Ga0496101_0129554
801 Ga0496104_0010848
802 Ga0496104_0416555
803 Ga0496105_0016822
804 Ga0496105_0175601
805 Ga0496105_0214632
806 Ga0496106_0075999
807 Ga0496106_0205850
808 Ga0496108_0022749
809 Ga0496108_0026135
810 Ga0496109_0002337
811 Ga0496109_0028674
812 Ga0496109_0331935
813 Ga0496109_0494000
814 Ga0496110_0093974
815 Ga0496111_0051209
816 Ga0496111_0294369
817 Ga0496112_0001195
818 Ga0496112_0145306
819 Ga0496112_0181752
820 Ga0496112_0259365
821 Ga0496114_0249573
822 Ga0501034_0072824
823 Ga0501039_0011048
824 Ga0501039_0056704
825 Ga0501040_0006057
826 Ga0501041_0132882
827 Ga0501042_0009654
828 Ga0501048_0007756
829 Ga0501071_0044770
830 Ga0501072_0016533
831 Ga0501074_0107537
832 Ga0501074_0362148
833 Ga0501075_0071440
834 Ga0501076_0001933
835 Ga0501077_0090914
836 Ga0501081_0079942
837 Ga0501081_0227362
838 Ga0501035_0076263
839 Ga0501044_0121320
840 Ga0501045_0008677
841 Ga0501045_0093722
842 nmdc:mga05p37_1297110_c1
843 nmdc:mga05p37_637377_c1
844 nmdc:mga06r32_32041_c1
845 nmdc:mga06r32_388315_c1
846 nmdc:mga08y16_12851_c1
847 nmdc:mga08y16_274567_c1
848 nmdc:mga08y16_787651_c1
849 nmdc:mga0n895_345088_c1
850 nmdc:mga0n895_3583_c1
851 nmdc:mga0a205_424918_c1
852 nmdc:mga0a205_548495_c1
853 Ga0495601_0000388
854 Ga0501084_0023477
855 Ga0501082_0160684
856 Ga0530510_0017554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

95

255

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l6s-assembly1.cif.gz_A the structure of the udgx mutant h109e crosslinked to single-stranded dna 0.9676 9 207
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.9652 6 208
8iij-assembly1.cif.gz_A h109g mutant of uracil dna glycosylase x 0.9627 10 207
8iig-assembly1.cif.gz_A complex form of msmudgx h109a mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by udgx h109a 0.9603 8 208
8iil-assembly1.cif.gz_A complex form of msmudgx h109g mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109g 0.9597 8 208
ID Description Score Start End Superfamily
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8624 19 208 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8573 17 208 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8323 17 208 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8285 19 208 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7678 18 210 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A7C2NG96-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9963 18 210 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A538LKJ8-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9933 17 210 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A7V9KZQ3-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9923 20 157 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A7W1KT55-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9917 14 210 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A536CPF9-F1-model_v4 Type-4 uracil-DNA glycosylase 0.9901 14 210 GO:0004844
GO:0006281
GO:0046872
GO:0051539

Map