F441709

General Info

Members Datasets Scaffolds Average Seq Length
428 243 856 155

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0035952|Ga0373937_0035952_529_999
Length 156
Sequence VDYAPISVFLKFGFLAVLYLFLLWIARSALKDLRRTVSPAPDATGFHQAAGAPQQAATDAWLIAETGGGLAVGERFDLIGGLSIGRSAEADVRIDDRYASGVHARIFSRDGHTYIEDMNSTNGTLLNDATLNGEAELIDGDVVRIGDTAFRYEEGG

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
241 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 8.88
Rhizosphere 85.75
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0035952 3300036401 Bacteria 4512
2 JGI24740J21852_10008144 3300001979 Bacteria 4203
3 JGI24034J26672_10000101 3300002239 Bacteria 14362
4 JGI24742J22300_10005069 3300002244 Bacteria 2166
5 JGI25406J46586_10112225 3300003203 Bacteria 806
6 Ga0070676_10297280 3300005328 Bacteria 1093
7 Ga0070683_100017475 3300005329 Bacteria 6340
8 Ga0070683_100384804 3300005329 Bacteria 1337
9 Ga0070677_10000018 3300005333 Bacteria 51146
10 Ga0070666_10054364 3300005335 Bacteria 2701
11 Ga0070666_10070152 3300005335 Bacteria 2384
12 Ga0070680_100156907 3300005336 Bacteria 1912
13 Ga0070682_100000016 3300005337 Bacteria 239799
14 Ga0070682_100000029 3300005337 Bacteria 183516
15 Ga0070682_100244527 3300005337 Bacteria 1290
16 Ga0068868_100001232 3300005338 Bacteria 17590
17 Ga0068868_100001871 3300005338 Bacteria 14448
18 Ga0070689_100457328 3300005340 Bacteria 1087
19 Ga0070691_10000774 3300005341 Bacteria 12671
20 Ga0070691_10002432 3300005341 Bacteria 8259
21 Ga0070661_100005654 3300005344 Bacteria 8616
22 Ga0070674_100000033 3300005356 Bacteria 63982
23 Ga0070674_100000148 3300005356 Bacteria 32680
24 Ga0070688_100551840 3300005365 Bacteria 876
25 Ga0070667_100006272 3300005367 Bacteria 9886
26 Ga0070667_100080225 3300005367 Bacteria 2790
27 Ga0070667_100342327 3300005367 Bacteria 1352
28 Ga0070713_100251704 3300005436 Bacteria 1611
29 Ga0070711_100016234 3300005439 Bacteria 4726
30 Ga0070711_100061996 3300005439 Bacteria 2605
31 Ga0070700_100061618 3300005441 Bacteria 2367
32 Ga0070700_100073237 3300005441 Bacteria 2192
33 Ga0070708_101063855 3300005445 Bacteria 758
34 Ga0070663_100003432 3300005455 Bacteria 9139
35 Ga0070663_100312401 3300005455 Bacteria 1261
36 Ga0070678_100034005 3300005456 Bacteria 3546
37 Ga0070678_100352413 3300005456 Bacteria 1266
38 Ga0070662_100000008 3300005457 Bacteria 168754
39 Ga0070681_10025643 3300005458 Bacteria 5930
40 Ga0070681_11043350 3300005458 Bacteria 738
41 Ga0068867_100000518 3300005459 Bacteria 25679
42 Ga0070685_10372459 3300005466 Bacteria 982
43 Ga0070679_100002013 3300005530 Bacteria 18239
44 Ga0070684_100013611 3300005535 Bacteria 6565
45 Ga0070684_100060082 3300005535 Bacteria 3324
46 Ga0068853_100087737 3300005539 Bacteria 2730
47 Ga0070672_100001883 3300005543 Bacteria 13132
48 Ga0070665_100000120 3300005548 Bacteria 148340
49 Ga0070665_100010569 3300005548 Bacteria 9342
50 Ga0070665_100023425 3300005548 Bacteria 6216
51 Ga0070665_101050327 3300005548 Unclassified 826
52 Ga0070665_101245173 3300005548 Bacteria 754
53 Ga0070704_100894989 3300005549 Bacteria 798
54 Ga0070704_101320819 3300005549 Bacteria 660
55 Ga0068854_100032665 3300005578 Bacteria 3623
56 Ga0068852_100352244 3300005616 Bacteria 1438
57 Ga0068859_101090858 3300005617 Bacteria 878
58 Ga0068866_10000002 3300005718 Bacteria 394090
59 Ga0068866_10002353 3300005718 Bacteria 7839
60 Ga0068861_100121022 3300005719 Bacteria 2112
61 Ga0068863_100000080 3300005841 Bacteria 106670
62 Ga0068863_100532737 3300005841 Bacteria 1159
63 Ga0068858_100000035 3300005842 Bacteria 140466
64 Ga0068860_100004101 3300005843 Bacteria 14924
65 Ga0068860_100180426 3300005843 Bacteria 2040
66 Ga0068860_100327142 3300005843 Bacteria 1505
67 Ga0068862_100005324 3300005844 Bacteria 10779
68 Ga0081455_10047599 3300005937 Bacteria 3712
69 Ga0081455_10068773 3300005937 Bacteria 2947
70 Ga0081455_10514748 3300005937 Bacteria 800
71 Ga0081540_1033182 3300005983 Bacteria 2807
72 Ga0081539_10000674 3300005985 Bacteria 68446
73 Ga0070715_10000015 3300006163 Bacteria 152816
74 Ga0070715_10557471 3300006163 Unclassified 665
75 Ga0070716_100534273 3300006173 Bacteria 871
76 Ga0070712_100574730 3300006175 Bacteria 952
77 Ga0097621_101664325 3300006237 Bacteria 607
78 Ga0075430_100549950 3300006846 Bacteria 952
79 Ga0075433_10000031 3300006852 Bacteria 55735
80 Ga0075433_10004030 3300006852 Bacteria 11364
81 Ga0097620_101090778 3300006931 Bacteria 878
82 Ga0105245_10000150 3300009098 Bacteria 66121
83 Ga0105245_10000327 3300009098 Bacteria 44888
84 Ga0105247_10035323 3300009101 Bacteria 3047
85 Ga0105247_10180779 3300009101 Bacteria 1407
86 Ga0105242_10001663 3300009176 Bacteria 17592
87 Ga0105242_10008554 3300009176 Bacteria 7861
88 Ga0105242_10805108 3300009176 Bacteria 930
89 Ga0105242_11923870 3300009176 Bacteria 632
90 Ga0105237_10647009 3300009545 Bacteria 1064
91 Ga0105238_11099308 3300009551 Bacteria 818
92 Ga0105249_10000095 3300009553 Bacteria 121300
93 Ga0105249_10006178 3300009553 Bacteria 10393
94 Ga0105239_10106226 3300010375 Bacteria 3110
95 Ga0157370_10002261 3300013104 Bacteria 23404
96 Ga0157370_10093497 3300013104 Bacteria 2822
97 Ga0157374_10001263 3300013296 Bacteria 21606
98 Ga0157374_10026432 3300013296 Bacteria 5223
99 Ga0157378_10015205 3300013297 Bacteria 6740
100 Ga0163162_10650038 3300013306 Bacteria 1178
101 Ga0163162_11709688 3300013306 Bacteria 719
102 Ga0157375_10000076 3300013308 Bacteria 101715
103 Ga0157375_10286620 3300013308 Bacteria 1810
104 Ga0157375_10344118 3300013308 Bacteria 1657
105 Ga0163163_10343576 3300014325 Bacteria 1548
106 Ga0163163_10579855 3300014325 Bacteria 1185
107 Ga0163163_10901896 3300014325 Bacteria 947
108 Ga0157380_10003706 3300014326 Bacteria 10503
109 Ga0157379_10149110 3300014968 Bacteria 2110
110 Ga0157379_10365152 3300014968 Bacteria 1323
111 Ga0163161_10000058 3300017792 Bacteria 114035
112 Ga0163161_10016129 3300017792 Bacteria 5215
113 Ga0206353_10482264 3300020082 Bacteria 1278
114 Ga0207682_10000047 3300025893 Bacteria 51208
115 Ga0207642_10000001 3300025899 Bacteria 714030
116 Ga0207642_10000003 3300025899 Bacteria 650651
117 Ga0207642_10000058 3300025899 Bacteria 33156
118 Ga0207710_10209403 3300025900 Bacteria 965
119 Ga0207680_10015971 3300025903 Bacteria 3932
120 Ga0207680_10057369 3300025903 Bacteria 2356
121 Ga0207685_10000001 3300025905 Bacteria 604473
122 Ga0207645_10691297 3300025907 Unclassified 693
123 Ga0207707_10013265 3300025912 Bacteria 7179
124 Ga0207707_10617928 3300025912 Bacteria 916
125 Ga0207663_10573112 3300025916 Bacteria 884
126 Ga0207660_10155463 3300025917 Bacteria 1760
127 Ga0207660_10238438 3300025917 Bacteria 1432
128 Ga0207649_10000025 3300025920 Bacteria 177532
129 Ga0207652_10000385 3300025921 Bacteria 45964
130 Ga0207652_10000544 3300025921 Bacteria 38182
131 Ga0207694_10000067 3300025924 Bacteria 128108
132 Ga0207687_10000021 3300025927 Bacteria 226396
133 Ga0207687_10000099 3300025927 Bacteria 63345
134 Ga0207644_10118490 3300025931 Bacteria 2012
135 Ga0207706_10000016 3300025933 Bacteria 170697
136 Ga0207686_10000189 3300025934 Bacteria 47718
137 Ga0207670_10940324 3300025936 Bacteria 725
138 Ga0207669_10000014 3300025937 Bacteria 129145
139 Ga0207669_10000024 3300025937 Bacteria 96123
140 Ga0207665_10177158 3300025939 Bacteria 1543
141 Ga0207691_10000062 3300025940 Bacteria 85448
142 Ga0207661_10005253 3300025944 Bacteria 9111
143 Ga0207661_10041457 3300025944 Bacteria 3624
144 Ga0207651_10000758 3300025960 Bacteria 13864
145 Ga0207712_10000003 3300025961 Bacteria 615314
146 Ga0207712_10007183 3300025961 Bacteria 7026
147 Ga0207668_10194146 3300025972 Bacteria 1611
148 Ga0207668_10416652 3300025972 Bacteria 1139
149 Ga0207658_10009994 3300025986 Bacteria 6450
150 Ga0207658_10397566 3300025986 Bacteria 1210
151 Ga0207658_10589936 3300025986 Bacteria 997
152 Ga0207658_10979022 3300025986 Bacteria 771
153 Ga0207677_10000444 3300026023 Bacteria 28037
154 Ga0207677_10002007 3300026023 Bacteria 10729
155 Ga0207703_10000060 3300026035 Bacteria 134334
156 Ga0207703_10000067 3300026035 Bacteria 125623
157 Ga0207639_10004291 3300026041 Bacteria 9607
158 Ga0207639_12137922 3300026041 Bacteria 521
159 Ga0207678_10001148 3300026067 Bacteria 24280
160 Ga0207678_10151757 3300026067 Bacteria 1978
161 Ga0207708_10091765 3300026075 Bacteria 2342
162 Ga0207708_10207575 3300026075 Bacteria 1565
163 Ga0207702_10009144 3300026078 Bacteria 8338
164 Ga0207702_10249281 3300026078 Bacteria 1667
165 Ga0207641_10000591 3300026088 Bacteria 39932
166 Ga0207641_10211537 3300026088 Bacteria 1794
167 Ga0207648_10002078 3300026089 Bacteria 21809
168 Ga0207675_100125361 3300026118 Bacteria 2433
169 Ga0207675_100558097 3300026118 Bacteria 1145
170 Ga0207683_10038516 3300026121 Bacteria 4168
171 Ga0268266_10000023 3300028379 Bacteria 501899
172 Ga0268266_10001915 3300028379 Bacteria 23404
173 Ga0268266_10007168 3300028379 Bacteria 10101
174 Ga0268266_10187843 3300028379 Bacteria 1885
175 Ga0268266_10400743 3300028379 Bacteria 1297
176 Ga0268266_10937822 3300028379 Unclassified 837
177 Ga0268266_11353674 3300028379 Bacteria 687
178 Ga0268265_10030735 3300028380 Bacteria 3871
179 Ga0268264_10001874 3300028381 Bacteria 19117
180 Ga0268264_10156499 3300028381 Bacteria 2049
181 Ga0268264_10581469 3300028381 Bacteria 1102
182 Ga0265326_10024641 3300028558 Bacteria 1717
183 Ga0265319_1000044 3300028563 Bacteria 103641
184 Ga0265338_10000297 3300028800 Bacteria 89764
185 Ga0307511_10045096 3300030521 Bacteria 3650
186 Ga0265331_10118831 3300031250 Bacteria 1209
187 Ga0265327_10302261 3300031251 Bacteria 704
188 Ga0307408_100416945 3300031548 Bacteria 1157
189 Ga0373953_0132947 3300035117 Bacteria 1062
190 Ga0373956_0412590 3300035119 Bacteria 644
191 Ga0373937_0547260 3300036401 Bacteria 1099
192 Ga0451837_1098527 3300041494 Bacteria 856
193 Ga0451853_0368553 3300041512 Bacteria 8009
194 Ga0451853_2145714 3300041512 Bacteria 1049
195 Ga0466963_0000027 3300044694 Bacteria 48596
196 Ga0466963_0450773 3300044694 Bacteria 908
197 Ga0495592_0077362 3300046454 Bacteria 2412
198 Ga0495592_0199812 3300046454 Bacteria 1350
199 Ga0495603_0000095 3300046455 Bacteria 40632
200 Ga0495603_0006945 3300046455 Bacteria 6791
201 Ga0495629_0000014 3300046459 Bacteria 201801
202 Ga0495629_0032625 3300046459 Bacteria 3687
203 Ga0495629_0124316 3300046459 Bacteria 1797
204 Ga0495629_0487778 3300046459 Bacteria 832
205 Ga0495641_0000001 3300046461 Bacteria 485224
206 Ga0495641_0129194 3300046461 Bacteria 1128
207 Ga0495641_0187914 3300046461 Bacteria 925
208 Ga0495651_0048816 3300046462 Bacteria 3268
209 Ga0495651_0152758 3300046462 Bacteria 1662
210 Ga0495651_0449180 3300046462 Bacteria 833
211 Ga0495653_0028113 3300046463 Bacteria 4500
212 Ga0495653_0136732 3300046463 Unclassified 1728
213 Ga0495653_0182328 3300046463 Bacteria 1440
214 Ga0495582_0000005 3300046473 Bacteria 156170
215 Ga0495662_0000118 3300046476 Bacteria 29672
216 Ga0495662_0054977 3300046476 Bacteria 1923
217 Ga0495594_0000004 3300046499 Bacteria 195881
218 Ga0495606_0000045 3300046507 Bacteria 212105
219 Ga0495608_0086337 3300046511 Bacteria 2033
220 Ga0495608_0224557 3300046511 Bacteria 1177
221 Ga0495610_0080468 3300046512 Bacteria 1498
222 Ga0495618_0000068 3300046514 Bacteria 74614
223 Ga0495620_0000580 3300046515 Bacteria 22923
224 Ga0495620_0070225 3300046515 Bacteria 1435
225 Ga0495628_0000070 3300046516 Bacteria 80592
226 Ga0495628_0083048 3300046516 Bacteria 2488
227 Ga0495628_1050090 3300046516 Bacteria 558
228 Ga0495630_0000037 3300046517 Bacteria 114404
229 Ga0495630_0000651 3300046517 Bacteria 25072
230 Ga0495630_0002631 3300046517 Bacteria 12434
231 Ga0495630_0014196 3300046517 Bacteria 5799
232 Ga0495630_0221046 3300046517 Bacteria 1446
233 Ga0495630_1015199 3300046517 Bacteria 630
234 Ga0495632_0249502 3300046519 Bacteria 796
235 Ga0495637_0154253 3300046520 Bacteria 865
236 Ga0495644_0000253 3300046523 Bacteria 24763
237 Ga0495652_0007416 3300046529 Bacteria 10112
238 Ga0495640_0008812 3300046533 Bacteria 7889
239 Ga0495640_0011923 3300046533 Bacteria 6666
240 Ga0495640_0214723 3300046533 Bacteria 1215
241 Ga0495586_0000438 3300046535 Bacteria 25030
242 Ga0495587_0010507 3300046536 Bacteria 5888
243 Ga0495587_0256225 3300046536 Bacteria 983
244 Ga0495587_0257529 3300046536 Bacteria 980
245 Ga0495645_0062581 3300046543 Bacteria 2695
246 Ga0495645_0105186 3300046543 Bacteria 2003
247 Ga0495645_0344834 3300046543 Bacteria 961
248 Ga0495622_0000016 3300046557 Bacteria 177089
249 Ga0495633_0214152 3300046558 Bacteria 882
250 Ga0495667_0000015 3300046559 Bacteria 200377
251 Ga0495667_0065728 3300046559 Bacteria 2372
252 Ga0495667_0100190 3300046559 Bacteria 1875
253 Ga0495656_0000644 3300046615 Bacteria 11183
254 Ga0495634_0045983 3300046642 Bacteria 2948
255 Ga0495634_0137165 3300046642 Bacteria 1555
256 Ga0495625_0140047 3300046660 Bacteria 1632
257 Ga0495635_0134685 3300046663 Bacteria 1684
258 Ga0495635_0389484 3300046663 Bacteria 927
259 Ga0495657_0000785 3300046675 Bacteria 28273
260 Ga0495657_0046172 3300046675 Bacteria 2951
261 Ga0495599_0153627 3300046678 Bacteria 1424
262 Ga0495623_0082194 3300046679 Bacteria 1991
263 Ga0495623_0320885 3300046679 Bacteria 851
264 Ga0495646_0109534 3300046680 Bacteria 1574
265 Ga0495646_0191758 3300046680 Bacteria 1117
266 Ga0495647_0000013 3300046681 Bacteria 88029
267 Ga0495647_0002264 3300046681 Bacteria 6039
268 Ga0495647_0017625 3300046681 Bacteria 2529
269 Ga0495658_0000019 3300046683 Bacteria 91606
270 Ga0495669_0000163 3300046684 Bacteria 42549
271 Ga0495669_0091032 3300046684 Bacteria 1408
272 Ga0495613_0000159 3300046689 Bacteria 65969
273 Ga0495613_0046535 3300046689 Bacteria 3208
274 Ga0495624_0000013 3300046690 Bacteria 115278
275 Ga0495624_0026154 3300046690 Bacteria 3825
276 Ga0495670_0006060 3300046691 Bacteria 5926
277 Ga0495649_0000828 3300046694 Bacteria 24830
278 Ga0495600_0059550 3300046809 Bacteria 2494
279 Ga0495581_0563475 3300047315 Bacteria 661
280 Ga0495604_0051079 3300047317 Bacteria 3208
281 Ga0495604_0121148 3300047317 Bacteria 1894
282 Ga0495674_0000007 3300047319 Bacteria 336257
283 Ga0495672_0253869 3300047320 Bacteria 852
284 Ga0495676_0000091 3300047321 Bacteria 66575
285 Ga0495676_0000563 3300047321 Bacteria 30429
286 Ga0495676_0052152 3300047321 Bacteria 3267
287 Ga0495676_0149809 3300047321 Bacteria 1662
288 Ga0495680_0000023 3300047322 Bacteria 116444
289 Ga0495680_0004702 3300047322 Bacteria 12994
290 Ga0495680_0016603 3300047322 Bacteria 6317
291 Ga0495680_0111616 3300047322 Bacteria 2025
292 Ga0495673_0233271 3300047469 Bacteria 677
293 Ga0495684_0048725 3300047471 Bacteria 3239
294 Ga0495686_0199727 3300047472 Bacteria 1148
295 Ga0495593_0020156 3300047673 Bacteria 3735
296 Ga0495593_0605342 3300047673 Bacteria 550
297 Ga0495602_0127927 3300048088 Bacteria 2031
298 Ga0496100_0000003 3300048903 Bacteria 360802
299 Ga0496100_0000008 3300048903 Bacteria 231974
300 Ga0496100_0112219 3300048903 Bacteria 1896
301 Ga0496101_0000003 3300048904 Bacteria 406565
302 Ga0496101_0000016 3300048904 Bacteria 240753
303 Ga0496101_0521664 3300048904 Unclassified 939
304 Ga0496102_0001497 3300048905 Bacteria 20646
305 Ga0496103_0210645 3300048906 Bacteria 1250
306 Ga0496104_0000003 3300048907 Bacteria 669219
307 Ga0496104_0000063 3300048907 Bacteria 116618
308 Ga0496105_0000031 3300048908 Bacteria 137220
309 Ga0496105_0000041 3300048908 Bacteria 116618
310 Ga0496105_0031996 3300048908 Bacteria 4314
311 Ga0496105_0098874 3300048908 Bacteria 2409
312 Ga0496106_0000048 3300048909 Bacteria 98233
313 Ga0496106_0000052 3300048909 Bacteria 94849
314 Ga0496106_0000085 3300048909 Bacteria 74004
315 Ga0496106_0129302 3300048909 Bacteria 1980
316 Ga0496106_1031520 3300048909 Bacteria 646
317 Ga0496107_0000008 3300048910 Bacteria 251874
318 Ga0496107_0000009 3300048910 Bacteria 231682
319 Ga0496107_0316542 3300048910 Bacteria 1161
320 Ga0496108_0000002 3300048911 Bacteria 700890
321 Ga0496108_0003029 3300048911 Bacteria 13517
322 Ga0496108_0005521 3300048911 Bacteria 10229
323 Ga0496108_0251993 3300048911 Bacteria 1536
324 Ga0496109_0000001 3300048912 Bacteria 700852
325 Ga0496109_0000237 3300048912 Bacteria 53743
326 Ga0496109_0243060 3300048912 Bacteria 1694
327 Ga0496109_0723320 3300048912 Bacteria 933
328 Ga0496110_0019404 3300048913 Bacteria 5720
329 Ga0496110_0022739 3300048913 Bacteria 5327
330 Ga0496110_0721534 3300048913 Bacteria 899
331 Ga0496111_0184677 3300048914 Bacteria 1550
332 Ga0496112_0000002 3300048915 Bacteria 782039
333 Ga0496114_0000010 3300048917 Bacteria 363396
334 Ga0496114_0007966 3300048917 Bacteria 8385
335 Ga0496115_0000426 3300048918 Bacteria 34356
336 Ga0496117_0003725 3300048920 Bacteria 17484
337 Ga0496118_0001663 3300048921 Bacteria 32640
338 Ga0496119_0004897 3300048922 Bacteria 13097
339 Ga0496119_0010541 3300048922 Bacteria 7761
340 Ga0496119_0020332 3300048922 Bacteria 4847
341 Ga0496120_0003770 3300048923 Bacteria 13390
342 Ga0496120_0201359 3300048923 Bacteria 964
343 Ga0496121_0033218 3300048924 Bacteria 4673
344 Ga0496121_0051949 3300048924 Bacteria 3447
345 Ga0496121_0655762 3300048924 Bacteria 638
346 Ga0496124_0080209 3300048927 Bacteria 2686
347 Ga0496125_0014770 3300048928 Bacteria 7586
348 Ga0496125_0220661 3300048928 Bacteria 1222
349 Ga0496126_0099805 3300048929 Bacteria 2542
350 Ga0501031_0000396 3300049568 Bacteria 25435
351 Ga0501032_0002570 3300049569 Bacteria 14203
352 Ga0501033_0000211 3300049570 Bacteria 55768
353 Ga0501033_0368894 3300049570 Bacteria 1004
354 Ga0501034_0021623 3300049571 Bacteria 6553
355 Ga0501036_0001187 3300049572 Bacteria 19851
356 Ga0501037_0000120 3300049573 Bacteria 73352
357 Ga0501038_0000139 3300049574 Bacteria 62162
358 Ga0501039_0006993 3300049575 Bacteria 8592
359 Ga0501040_0641601 3300049576 Bacteria 767
360 Ga0501042_0011733 3300049578 Bacteria 5920
361 Ga0501042_0016772 3300049578 Bacteria 5037
362 Ga0501043_0000203 3300049579 Bacteria 54330
363 Ga0501046_0000194 3300049580 Bacteria 62330
364 Ga0501047_0000287 3300049581 Bacteria 58087
365 Ga0501047_0038003 3300049581 Bacteria 4656
366 Ga0501047_0129995 3300049581 Bacteria 2399
367 Ga0501047_0691708 3300049581 Bacteria 837
368 Ga0501048_0000004 3300049582 Bacteria 100672
369 Ga0501048_0476948 3300049582 Bacteria 894
370 Ga0501067_0023481 3300049583 Bacteria 3418
371 Ga0501068_0022306 3300049584 Bacteria 3701
372 Ga0501068_0081861 3300049584 Bacteria 1982
373 Ga0501069_0031450 3300049585 Bacteria 2918
374 Ga0501069_0172404 3300049585 Bacteria 1248
375 Ga0501070_0000079 3300049586 Bacteria 82054
376 Ga0501070_0005710 3300049586 Bacteria 10612
377 Ga0501070_0006692 3300049586 Bacteria 9816
378 Ga0501071_0082284 3300049587 Bacteria 2357
379 Ga0501071_0394572 3300049587 Bacteria 1056
380 Ga0501072_0014372 3300049588 Bacteria 6069
381 Ga0501072_0025803 3300049588 Bacteria 4579
382 Ga0501073_0002347 3300049589 Bacteria 14162
383 Ga0501074_0086250 3300049590 Bacteria 2249
384 Ga0501074_0173536 3300049590 Bacteria 1538
385 Ga0501074_0391777 3300049590 Bacteria 985
386 Ga0501076_0646678 3300049592 Bacteria 873
387 Ga0501077_0201419 3300049593 Bacteria 1264
388 Ga0501079_0007228 3300049741 Bacteria 8381
389 Ga0501079_0029460 3300049741 Bacteria 4214
390 Ga0501080_0014046 3300049742 Bacteria 7371
391 Ga0501080_0195416 3300049742 Bacteria 1858
392 Ga0501080_1273423 3300049742 Bacteria 630
393 Ga0501081_0787038 3300049743 Bacteria 716
394 Ga0501083_0002122 3300049744 Bacteria 13604
395 Ga0501083_0010257 3300049744 Bacteria 6601
396 Ga0501083_0030014 3300049744 Bacteria 3736
397 Ga0501035_0000059 3300049822 Bacteria 134506
398 Ga0501044_0000417 3300049823 Bacteria 52579
399 Ga0501044_0029921 3300049823 Bacteria 5741
400 Ga0501044_1117861 3300049823 Bacteria 657
401 Ga0501045_0009170 3300049824 Bacteria 6914
402 Ga0501045_0061405 3300049824 Bacteria 2757
403 Ga0501045_0733047 3300049824 Bacteria 729
404 nmdc:mga0yw44_802800_c1 3300050492 Bacteria 639
405 nmdc:mga05p37_323749_c1 3300050507 Bacteria 1823
406 nmdc:mga0qj67_25230_c1 3300050509 Bacteria 4591
407 nmdc:mga0a205_1507_c1 3300050515 Bacteria 19879
408 Ga0495601_0000120 3300053077 Bacteria 43540
409 Ga0495601_0047029 3300053077 Bacteria 2716
410 Ga0495601_0057306 3300053077 Bacteria 2468
411 Ga0495612_0005849 3300053078 Bacteria 5079
412 Ga0495612_0023850 3300053078 Bacteria 2456
413 Ga0495612_0138193 3300053078 Bacteria 1056
414 Ga0495655_0005157 3300053083 Bacteria 2291
415 Ga0495595_0000117 3300053084 Bacteria 34251
416 Ga0495619_0000129 3300053085 Bacteria 55936
417 Ga0495619_0000455 3300053085 Bacteria 27679
418 Ga0495619_0003753 3300053085 Bacteria 9783
419 Ga0495619_0015992 3300053085 Bacteria 4747
420 Ga0500566_0006250 3300053094 Bacteria 7079
421 Ga0500641_0003211 3300053096 Bacteria 5777
422 Ga0500595_004401 3300053119 Bacteria 6329
423 Ga0500614_000183 3300053123 Bacteria 16149
424 Ga0501084_0311931 3300054114 Bacteria 1328
425 Ga0501084_1128539 3300054114 Bacteria 658
426 Ga0501082_0078358 3300060353 Bacteria 2850
427 Ga0501082_0098672 3300060353 Bacteria 2526
428 Ga0501082_0988245 3300060353 Bacteria 736
429 Ga0373937_0035952
430 JGI24740J21852_10008144
431 JGI24034J26672_10000101
432 JGI24742J22300_10005069
433 JGI25406J46586_10112225
434 Ga0070676_10297280
435 Ga0070683_100017475
436 Ga0070683_100384804
437 Ga0070677_10000018
438 Ga0070666_10054364
439 Ga0070666_10070152
440 Ga0070680_100156907
441 Ga0070682_100000016
442 Ga0070682_100000029
443 Ga0070682_100244527
444 Ga0068868_100001232
445 Ga0068868_100001871
446 Ga0070689_100457328
447 Ga0070691_10000774
448 Ga0070691_10002432
449 Ga0070661_100005654
450 Ga0070674_100000033
451 Ga0070674_100000148
452 Ga0070688_100551840
453 Ga0070667_100006272
454 Ga0070667_100080225
455 Ga0070667_100342327
456 Ga0070713_100251704
457 Ga0070711_100016234
458 Ga0070711_100061996
459 Ga0070700_100061618
460 Ga0070700_100073237
461 Ga0070708_101063855
462 Ga0070663_100003432
463 Ga0070663_100312401
464 Ga0070678_100034005
465 Ga0070678_100352413
466 Ga0070662_100000008
467 Ga0070681_10025643
468 Ga0070681_11043350
469 Ga0068867_100000518
470 Ga0070685_10372459
471 Ga0070679_100002013
472 Ga0070684_100013611
473 Ga0070684_100060082
474 Ga0068853_100087737
475 Ga0070672_100001883
476 Ga0070665_100000120
477 Ga0070665_100010569
478 Ga0070665_100023425
479 Ga0070665_101050327
480 Ga0070665_101245173
481 Ga0070704_100894989
482 Ga0070704_101320819
483 Ga0068854_100032665
484 Ga0068852_100352244
485 Ga0068859_101090858
486 Ga0068866_10000002
487 Ga0068866_10002353
488 Ga0068861_100121022
489 Ga0068863_100000080
490 Ga0068863_100532737
491 Ga0068858_100000035
492 Ga0068860_100004101
493 Ga0068860_100180426
494 Ga0068860_100327142
495 Ga0068862_100005324
496 Ga0081455_10047599
497 Ga0081455_10068773
498 Ga0081455_10514748
499 Ga0081540_1033182
500 Ga0081539_10000674
501 Ga0070715_10000015
502 Ga0070715_10557471
503 Ga0070716_100534273
504 Ga0070712_100574730
505 Ga0097621_101664325
506 Ga0075430_100549950
507 Ga0075433_10000031
508 Ga0075433_10004030
509 Ga0097620_101090778
510 Ga0105245_10000150
511 Ga0105245_10000327
512 Ga0105247_10035323
513 Ga0105247_10180779
514 Ga0105242_10001663
515 Ga0105242_10008554
516 Ga0105242_10805108
517 Ga0105242_11923870
518 Ga0105237_10647009
519 Ga0105238_11099308
520 Ga0105249_10000095
521 Ga0105249_10006178
522 Ga0105239_10106226
523 Ga0157370_10002261
524 Ga0157370_10093497
525 Ga0157374_10001263
526 Ga0157374_10026432
527 Ga0157378_10015205
528 Ga0163162_10650038
529 Ga0163162_11709688
530 Ga0157375_10000076
531 Ga0157375_10286620
532 Ga0157375_10344118
533 Ga0163163_10343576
534 Ga0163163_10579855
535 Ga0163163_10901896
536 Ga0157380_10003706
537 Ga0157379_10149110
538 Ga0157379_10365152
539 Ga0163161_10000058
540 Ga0163161_10016129
541 Ga0206353_10482264
542 Ga0207682_10000047
543 Ga0207642_10000001
544 Ga0207642_10000003
545 Ga0207642_10000058
546 Ga0207710_10209403
547 Ga0207680_10015971
548 Ga0207680_10057369
549 Ga0207685_10000001
550 Ga0207645_10691297
551 Ga0207707_10013265
552 Ga0207707_10617928
553 Ga0207663_10573112
554 Ga0207660_10155463
555 Ga0207660_10238438
556 Ga0207649_10000025
557 Ga0207652_10000385
558 Ga0207652_10000544
559 Ga0207694_10000067
560 Ga0207687_10000021
561 Ga0207687_10000099
562 Ga0207644_10118490
563 Ga0207706_10000016
564 Ga0207686_10000189
565 Ga0207670_10940324
566 Ga0207669_10000014
567 Ga0207669_10000024
568 Ga0207665_10177158
569 Ga0207691_10000062
570 Ga0207661_10005253
571 Ga0207661_10041457
572 Ga0207651_10000758
573 Ga0207712_10000003
574 Ga0207712_10007183
575 Ga0207668_10194146
576 Ga0207668_10416652
577 Ga0207658_10009994
578 Ga0207658_10397566
579 Ga0207658_10589936
580 Ga0207658_10979022
581 Ga0207677_10000444
582 Ga0207677_10002007
583 Ga0207703_10000060
584 Ga0207703_10000067
585 Ga0207639_10004291
586 Ga0207639_12137922
587 Ga0207678_10001148
588 Ga0207678_10151757
589 Ga0207708_10091765
590 Ga0207708_10207575
591 Ga0207702_10009144
592 Ga0207702_10249281
593 Ga0207641_10000591
594 Ga0207641_10211537
595 Ga0207648_10002078
596 Ga0207675_100125361
597 Ga0207675_100558097
598 Ga0207683_10038516
599 Ga0268266_10000023
600 Ga0268266_10001915
601 Ga0268266_10007168
602 Ga0268266_10187843
603 Ga0268266_10400743
604 Ga0268266_10937822
605 Ga0268266_11353674
606 Ga0268265_10030735
607 Ga0268264_10001874
608 Ga0268264_10156499
609 Ga0268264_10581469
610 Ga0265326_10024641
611 Ga0265319_1000044
612 Ga0265338_10000297
613 Ga0307511_10045096
614 Ga0265331_10118831
615 Ga0265327_10302261
616 Ga0307408_100416945
617 Ga0373953_0132947
618 Ga0373956_0412590
619 Ga0373937_0547260
620 Ga0451837_1098527
621 Ga0451853_0368553
622 Ga0451853_2145714
623 Ga0466963_0000027
624 Ga0466963_0450773
625 Ga0495592_0077362
626 Ga0495592_0199812
627 Ga0495603_0000095
628 Ga0495603_0006945
629 Ga0495629_0000014
630 Ga0495629_0032625
631 Ga0495629_0124316
632 Ga0495629_0487778
633 Ga0495641_0000001
634 Ga0495641_0129194
635 Ga0495641_0187914
636 Ga0495651_0048816
637 Ga0495651_0152758
638 Ga0495651_0449180
639 Ga0495653_0028113
640 Ga0495653_0136732
641 Ga0495653_0182328
642 Ga0495582_0000005
643 Ga0495662_0000118
644 Ga0495662_0054977
645 Ga0495594_0000004
646 Ga0495606_0000045
647 Ga0495608_0086337
648 Ga0495608_0224557
649 Ga0495610_0080468
650 Ga0495618_0000068
651 Ga0495620_0000580
652 Ga0495620_0070225
653 Ga0495628_0000070
654 Ga0495628_0083048
655 Ga0495628_1050090
656 Ga0495630_0000037
657 Ga0495630_0000651
658 Ga0495630_0002631
659 Ga0495630_0014196
660 Ga0495630_0221046
661 Ga0495630_1015199
662 Ga0495632_0249502
663 Ga0495637_0154253
664 Ga0495644_0000253
665 Ga0495652_0007416
666 Ga0495640_0008812
667 Ga0495640_0011923
668 Ga0495640_0214723
669 Ga0495586_0000438
670 Ga0495587_0010507
671 Ga0495587_0256225
672 Ga0495587_0257529
673 Ga0495645_0062581
674 Ga0495645_0105186
675 Ga0495645_0344834
676 Ga0495622_0000016
677 Ga0495633_0214152
678 Ga0495667_0000015
679 Ga0495667_0065728
680 Ga0495667_0100190
681 Ga0495656_0000644
682 Ga0495634_0045983
683 Ga0495634_0137165
684 Ga0495625_0140047
685 Ga0495635_0134685
686 Ga0495635_0389484
687 Ga0495657_0000785
688 Ga0495657_0046172
689 Ga0495599_0153627
690 Ga0495623_0082194
691 Ga0495623_0320885
692 Ga0495646_0109534
693 Ga0495646_0191758
694 Ga0495647_0000013
695 Ga0495647_0002264
696 Ga0495647_0017625
697 Ga0495658_0000019
698 Ga0495669_0000163
699 Ga0495669_0091032
700 Ga0495613_0000159
701 Ga0495613_0046535
702 Ga0495624_0000013
703 Ga0495624_0026154
704 Ga0495670_0006060
705 Ga0495649_0000828
706 Ga0495600_0059550
707 Ga0495581_0563475
708 Ga0495604_0051079
709 Ga0495604_0121148
710 Ga0495674_0000007
711 Ga0495672_0253869
712 Ga0495676_0000091
713 Ga0495676_0000563
714 Ga0495676_0052152
715 Ga0495676_0149809
716 Ga0495680_0000023
717 Ga0495680_0004702
718 Ga0495680_0016603
719 Ga0495680_0111616
720 Ga0495673_0233271
721 Ga0495684_0048725
722 Ga0495686_0199727
723 Ga0495593_0020156
724 Ga0495593_0605342
725 Ga0495602_0127927
726 Ga0496100_0000003
727 Ga0496100_0000008
728 Ga0496100_0112219
729 Ga0496101_0000003
730 Ga0496101_0000016
731 Ga0496101_0521664
732 Ga0496102_0001497
733 Ga0496103_0210645
734 Ga0496104_0000003
735 Ga0496104_0000063
736 Ga0496105_0000031
737 Ga0496105_0000041
738 Ga0496105_0031996
739 Ga0496105_0098874
740 Ga0496106_0000048
741 Ga0496106_0000052
742 Ga0496106_0000085
743 Ga0496106_0129302
744 Ga0496106_1031520
745 Ga0496107_0000008
746 Ga0496107_0000009
747 Ga0496107_0316542
748 Ga0496108_0000002
749 Ga0496108_0003029
750 Ga0496108_0005521
751 Ga0496108_0251993
752 Ga0496109_0000001
753 Ga0496109_0000237
754 Ga0496109_0243060
755 Ga0496109_0723320
756 Ga0496110_0019404
757 Ga0496110_0022739
758 Ga0496110_0721534
759 Ga0496111_0184677
760 Ga0496112_0000002
761 Ga0496114_0000010
762 Ga0496114_0007966
763 Ga0496115_0000426
764 Ga0496117_0003725
765 Ga0496118_0001663
766 Ga0496119_0004897
767 Ga0496119_0010541
768 Ga0496119_0020332
769 Ga0496120_0003770
770 Ga0496120_0201359
771 Ga0496121_0033218
772 Ga0496121_0051949
773 Ga0496121_0655762
774 Ga0496124_0080209
775 Ga0496125_0014770
776 Ga0496125_0220661
777 Ga0496126_0099805
778 Ga0501031_0000396
779 Ga0501032_0002570
780 Ga0501033_0000211
781 Ga0501033_0368894
782 Ga0501034_0021623
783 Ga0501036_0001187
784 Ga0501037_0000120
785 Ga0501038_0000139
786 Ga0501039_0006993
787 Ga0501040_0641601
788 Ga0501042_0011733
789 Ga0501042_0016772
790 Ga0501043_0000203
791 Ga0501046_0000194
792 Ga0501047_0000287
793 Ga0501047_0038003
794 Ga0501047_0129995
795 Ga0501047_0691708
796 Ga0501048_0000004
797 Ga0501048_0476948
798 Ga0501067_0023481
799 Ga0501068_0022306
800 Ga0501068_0081861
801 Ga0501069_0031450
802 Ga0501069_0172404
803 Ga0501070_0000079
804 Ga0501070_0005710
805 Ga0501070_0006692
806 Ga0501071_0082284
807 Ga0501071_0394572
808 Ga0501072_0014372
809 Ga0501072_0025803
810 Ga0501073_0002347
811 Ga0501074_0086250
812 Ga0501074_0173536
813 Ga0501074_0391777
814 Ga0501076_0646678
815 Ga0501077_0201419
816 Ga0501079_0007228
817 Ga0501079_0029460
818 Ga0501080_0014046
819 Ga0501080_0195416
820 Ga0501080_1273423
821 Ga0501081_0787038
822 Ga0501083_0002122
823 Ga0501083_0010257
824 Ga0501083_0030014
825 Ga0501035_0000059
826 Ga0501044_0000417
827 Ga0501044_0029921
828 Ga0501044_1117861
829 Ga0501045_0009170
830 Ga0501045_0061405
831 Ga0501045_0733047
832 nmdc:mga0yw44_802800_c1
833 nmdc:mga05p37_323749_c1
834 nmdc:mga0qj67_25230_c1
835 nmdc:mga0a205_1507_c1
836 Ga0495601_0000120
837 Ga0495601_0047029
838 Ga0495601_0057306
839 Ga0495612_0005849
840 Ga0495612_0023850
841 Ga0495612_0138193
842 Ga0495655_0005157
843 Ga0495595_0000117
844 Ga0495619_0000129
845 Ga0495619_0000455
846 Ga0495619_0003753
847 Ga0495619_0015992
848 Ga0500566_0006250
849 Ga0500641_0003211
850 Ga0500595_004401
851 Ga0500614_000183
852 Ga0501084_0311931
853 Ga0501084_1128539
854 Ga0501082_0078358
855 Ga0501082_0098672
856 Ga0501082_0988245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

82

146

0.98

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

68

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rj3-assembly3.cif.gz_C crystal structure of the forkhead associated (fha) domain of the glycogen accumulation regulator (gara) from mycobacterium tuberculosis 0.9288 59 157
6hc1-assembly2.cif.gz_B bdellovibrio bacteriovorus dgcb fha in complex with phosphorylated n-terminal peptide 0.9284 60 157
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9276 59 155
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9271 63 155
6i2p-assembly1.cif.gz_D crystal structure of the mycobacterium tuberculosis pknb kinase domain (l33e mutant) in complex with its substrate gara 0.9169 58 157
ID Description Score Start End Superfamily
af_A6PWD2_8_99_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9455 82 158 2.60.200.20
af_Q8II28_278_394_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9443 82 152 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.933 62 155 2.60.200.20
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9286 81 157 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9282 61 154 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7C3JFB4-F1-model_v4 FHA domain-containing protein 0.9632 60 158
AF-A0A2D5QNN3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9627 57 154 GO:0000155
AF-A0A7V9J6E1-F1-model_v4 FHA domain-containing protein 0.9591 60 154
AF-A0A7C6P7M2-F1-model_v4 FtsW/RodA/SpoVE family cell cycle protein 0.959 60 157 GO:0005886
GO:0008360
GO:0015648
GO:0032153
GO:0051301
AF-A0A1F9F951-F1-model_v4 FHA domain-containing protein 0.9586 60 154 GO:0016020

Map