F441745

General Info

Members Datasets Scaffolds Average Seq Length
428 196 405 164

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0002213|Ga0495668_0002213_921_1490
Length 189
Sequence MAGHGVVPVQRGLGAETTFFHYRENLMSTTELTIRPATPADIPAIFGMIFELAVFEKLEHMVVANEAALHDSLFCDKPVCEALVGETGGEVVTFALFFHNFSTFLCKKGLYLEDLYVQQAHRGKGYGKQMLVALAQLAVQRDCGRFEWSVLDWNSNAIKFYEGMGATVMPDWRICRVTGDALAQLSAQA

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221645 Massilia sp. Root351 Isolate Unclassified
3 2643221664 Massilia sp. Root418 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543003 Duganella sp. GV066 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543026 Duganella sp. GV089 Isolate Unclassified
11 2738543029 Duganella sp. GV039 Isolate Unclassified
12 2738543030 Massilia sp. GV097 Isolate Unclassified
13 2821131069 Duganella sp. 1224 Isolate Unclassified
14 2842711865 Duganella sp. R-73148 Isolate Unclassified
15 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
16 2857553236 Duganella sp. R-74557 Isolate Unclassified
17 2857558681 Duganella sp. R-74565 Isolate Unclassified
18 2857564685 Duganella sp. R-74599 Isolate Unclassified
19 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
20 2904424332 Duganella sp. 1411 Isolate Rhizosphere
21 2919476304 Duganella sp. 3397 Isolate Unclassified
22 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
23 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
24 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
42 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
77 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
78 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
93 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
94 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
196 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.16
Metatranscriptomes 0.47
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.01
Nodule 0.93
Rhizoplane 2.34
Rhizosphere 79.91
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1007653 3300002738 Bacteria 1457
2 JGI25153J46596_10047253 3300003215 Bacteria 1268
3 rootL2_10030004 3300003322 Bacteria 5374
4 Ga0055529_1000271 3300003763 Bacteria 61698
5 Ga0055526_1000033 3300003771 Bacteria 138249
6 Ga0055526_1000059 3300003771 Bacteria 108161
7 Ga0055526_1001746 3300003771 Bacteria 15109
8 Ga0055537_1000144 3300003773 Bacteria 53397
9 Ga0055524_1000027 3300003775 Bacteria 213655
10 Ga0055534_1000072 3300003784 Bacteria 78212
11 Ga0055528_1000094 3300003790 Bacteria 71337
12 Ga0065165_1004965 3300005262 Bacteria 7813
13 Ga0065714_10010106 3300005288 Bacteria 3164
14 Ga0070671_100005570 3300005355 Bacteria 10033
15 Ga0070671_101067560 3300005355 Bacteria 709
16 Ga0070709_10487645 3300005434 Unclassified 934
17 Ga0068855_100035552 3300005563 Bacteria 5934
18 Ga0068857_100363804 3300005577 Bacteria 1341
19 Ga0070712_100067388 3300006175 Bacteria 2547
20 Ga0075430_100123165 3300006846 Bacteria 2162
21 Ga0079104_1015720 3300006946 Bacteria 2234
22 Ga0099826_10000003 3300006948 Bacteria 1067817
23 Ga0105244_10001188 3300009036 Bacteria 21533
24 Ga0105244_10001783 3300009036 Bacteria 16894
25 Ga0105244_10107993 3300009036 Bacteria 1357
26 Ga0105248_10262817 3300009177 Bacteria 1943
27 Ga0105239_11811798 3300010375 Unclassified 707
28 Ga0157369_10041619 3300013105 Bacteria 5014
29 Ga0157378_10749792 3300013297 Unclassified 999
30 Ga0182008_10000154 3300014497 Bacteria 54086
31 Ga0182006_1000010 3300015261 Bacteria 413414
32 Ga0182006_1000055 3300015261 Bacteria 173139
33 Ga0182007_10000030 3300015262 Bacteria 156866
34 Ga0182005_1000003 3300015265 Bacteria 683269
35 Ga0182005_1000009 3300015265 Bacteria 455334
36 Ga0163161_10115796 3300017792 Bacteria 2009
37 Ga0213872_10000069 3300021361 Bacteria 91692
38 Ga0213872_10000217 3300021361 Bacteria 50746
39 Ga0213872_10001823 3300021361 Bacteria 13219
40 Ga0213872_10103954 3300021361 Bacteria 1264
41 Ga0209437_103067 3300025233 Bacteria 3086
42 Ga0209437_112245 3300025233 Bacteria 1258
43 Ga0207425_1000476 3300025245 Bacteria 25466
44 Ga0209646_1000047 3300025246 Bacteria 323416
45 Ga0209759_1016042 3300025256 Bacteria 1908
46 Ga0209565_1000006 3300025263 Bacteria 897294
47 Ga0209455_1000051 3300025272 Bacteria 369818
48 Ga0209673_1000004 3300025273 Bacteria 896155
49 Ga0209675_1000006 3300025291 Bacteria 732267
50 Ga0209025_1002516 3300025294 Bacteria 19189
51 Ga0209564_1000006 3300025295 Bacteria 1100927
52 Ga0209564_1000026 3300025295 Bacteria 519154
53 Ga0209564_1000085 3300025295 Bacteria 251509
54 Ga0209564_1023109 3300025295 Bacteria 2172
55 Ga0209758_1000728 3300025297 Bacteria 48131
56 Ga0209256_1000013 3300025299 Bacteria 689442
57 Ga0209256_1000037 3300025299 Bacteria 377661
58 Ga0207655_1002061 3300025728 Bacteria 16884
59 Ga0207655_1002711 3300025728 Bacteria 13860
60 Ga0207699_10614209 3300025906 Unclassified 792
61 Ga0207671_10101552 3300025914 Bacteria 2179
62 Ga0207693_10092229 3300025915 Bacteria 2374
63 Ga0207650_10009897 3300025925 Bacteria 6523
64 Ga0207644_10344970 3300025931 Bacteria 1208
65 Ga0207690_10106670 3300025932 Unclassified 2010
66 Ga0207667_10111658 3300025949 Bacteria 2819
67 Ga0207703_10471223 3300026035 Bacteria 1176
68 Ga0207702_10147157 3300026078 Bacteria 2139
69 Ga0209281_1004108 3300027111 Bacteria 4475
70 Ga0209282_1000002 3300027666 Bacteria 1067825
71 Ga0265354_1003359 3300028016 Bacteria 1802
72 Ga0316181_1118542 3300030744 Bacteria 4380
73 Ga0265770_1012632 3300030878 Bacteria 1253
74 Ga0265760_10002084 3300031090 Bacteria 5880
75 Ga0307408_100000166 3300031548 Bacteria 73583
76 Ga0307414_10192768 3300032004 Bacteria 1650
77 Ga0307411_11156482 3300032005 Bacteria 700
78 Ga0373924_0128445 3300035410 Bacteria 1102
79 Ga0373937_0025492 3300036401 Bacteria 5337
80 Ga0373925_0294659 3300037068 Bacteria 1309
81 Ga0395898_0759158 3300037466 Bacteria 911
82 Ga0436361_0108199 3300039447 Bacteria 59346
83 Ga0436361_0719314 3300039447 Bacteria 16087
84 Ga0436361_0931365 3300039447 Bacteria 36892
85 Ga0436361_1028840 3300039447 Bacteria 1257
86 Ga0451791_1281173 3300041451 Bacteria 1502
87 Ga0451807_1629659 3300041486 Bacteria 1524
88 Ga0451845_0845083 3300041501 Bacteria 960
89 Ga0450898_037622 3300042134 Bacteria 907
90 Ga0450904_000226 3300042139 Bacteria 12285
91 Ga0466965_0021472 3300044683 Bacteria 3108
92 Ga0466960_0147087 3300044901 Bacteria 1256
93 Ga0495617_000099 3300046452 Bacteria 62284
94 Ga0495617_001548 3300046452 Bacteria 9961
95 Ga0495617_010756 3300046452 Bacteria 3132
96 Ga0495617_011814 3300046452 Bacteria 2978
97 Ga0495627_000066 3300046453 Bacteria 130363
98 Ga0495627_004455 3300046453 Bacteria 5856
99 Ga0495603_0016824 3300046455 Bacteria 4424
100 Ga0495603_0371040 3300046455 Bacteria 821
101 Ga0495590_0000036 3300046457 Bacteria 129241
102 Ga0495590_0000275 3300046457 Bacteria 27902
103 Ga0495590_0018263 3300046457 Bacteria 2511
104 Ga0495590_0056823 3300046457 Bacteria 1368
105 Ga0495629_0124788 3300046459 Bacteria 1794
106 Ga0495638_0000114 3300046460 Bacteria 129141
107 Ga0495638_0001462 3300046460 Bacteria 21338
108 Ga0495638_0003879 3300046460 Bacteria 11576
109 Ga0495638_0030550 3300046460 Bacteria 3467
110 Ga0495638_0092441 3300046460 Bacteria 1821
111 Ga0495638_0240328 3300046460 Bacteria 1003
112 Ga0495638_0251949 3300046460 Bacteria 973
113 Ga0495638_0255749 3300046460 Bacteria 963
114 Ga0495638_0440112 3300046460 Bacteria 668
115 Ga0495653_0000007 3300046463 Bacteria 314281
116 Ga0495653_0006487 3300046463 Bacteria 9593
117 Ga0495650_0000105 3300046471 Bacteria 205855
118 Ga0495650_0000232 3300046471 Bacteria 113636
119 Ga0495650_0000994 3300046471 Bacteria 32232
120 Ga0495650_0001023 3300046471 Bacteria 31411
121 Ga0495650_0002164 3300046471 Bacteria 16641
122 Ga0495650_0042910 3300046471 Bacteria 1923
123 Ga0495582_0012187 3300046473 Bacteria 4736
124 Ga0495605_0000015 3300046474 Bacteria 300227
125 Ga0495605_0001012 3300046474 Bacteria 18963
126 Ga0495605_0045799 3300046474 Bacteria 2153
127 Ga0495605_0133500 3300046474 Bacteria 1118
128 Ga0495639_0013737 3300046475 Bacteria 3502
129 Ga0495584_0000011 3300046491 Bacteria 208322
130 Ga0495584_0001592 3300046491 Bacteria 13409
131 Ga0495584_0018853 3300046491 Bacteria 3506
132 Ga0495584_0063059 3300046491 Bacteria 1863
133 Ga0495585_0000078 3300046492 Bacteria 100168
134 Ga0495585_0000379 3300046492 Bacteria 42623
135 Ga0495585_0003135 3300046492 Bacteria 11332
136 Ga0495585_0003654 3300046492 Bacteria 10286
137 Ga0495585_0005144 3300046492 Bacteria 8310
138 Ga0495585_0034656 3300046492 Bacteria 2854
139 Ga0495585_0037590 3300046492 Bacteria 2726
140 Ga0495594_0005687 3300046499 Bacteria 6410
141 Ga0495596_0000101 3300046500 Bacteria 60820
142 Ga0495596_0003575 3300046500 Bacteria 7823
143 Ga0495596_0014805 3300046500 Bacteria 3281
144 Ga0495596_0040424 3300046500 Bacteria 1841
145 Ga0495596_0350199 3300046500 Bacteria 575
146 Ga0495607_0001415 3300046501 Bacteria 21359
147 Ga0495607_0002307 3300046501 Bacteria 15660
148 Ga0495607_0003249 3300046501 Bacteria 12521
149 Ga0495607_0008618 3300046501 Bacteria 6956
150 Ga0495607_0015620 3300046501 Bacteria 4917
151 Ga0495607_0073007 3300046501 Bacteria 1908
152 Ga0495607_0116100 3300046501 Bacteria 1412
153 Ga0495583_0000004 3300046506 Bacteria 655287
154 Ga0495583_0000468 3300046506 Bacteria 59782
155 Ga0495583_0002552 3300046506 Bacteria 15377
156 Ga0495606_0000007 3300046507 Bacteria 323713
157 Ga0495606_0000280 3300046507 Bacteria 88619
158 Ga0495606_0000323 3300046507 Bacteria 82365
159 Ga0495606_0000705 3300046507 Bacteria 51759
160 Ga0495606_0000750 3300046507 Bacteria 50136
161 Ga0495606_0001844 3300046507 Bacteria 26692
162 Ga0495606_0004337 3300046507 Bacteria 14257
163 Ga0495606_0013171 3300046507 Bacteria 6561
164 Ga0495606_0062957 3300046507 Bacteria 2366
165 Ga0495606_0122930 3300046507 Bacteria 1551
166 Ga0495606_0124034 3300046507 Bacteria 1542
167 Ga0495606_0443088 3300046507 Bacteria 667
168 Ga0495610_0000004 3300046512 Bacteria 1006135
169 Ga0495610_0003863 3300046512 Bacteria 11385
170 Ga0495610_0005198 3300046512 Bacteria 9322
171 Ga0495610_0005521 3300046512 Bacteria 8959
172 Ga0495610_0012048 3300046512 Bacteria 5234
173 Ga0495610_0343709 3300046512 Bacteria 563
174 Ga0495616_0000103 3300046513 Bacteria 73155
175 Ga0495616_0000262 3300046513 Bacteria 42459
176 Ga0495616_0001765 3300046513 Bacteria 14725
177 Ga0495616_0002567 3300046513 Bacteria 11967
178 Ga0495616_0035509 3300046513 Bacteria 2579
179 Ga0495616_0072341 3300046513 Bacteria 1665
180 Ga0495620_0006722 3300046515 Bacteria 6294
181 Ga0495630_0458696 3300046517 Bacteria 976
182 Ga0495631_0033878 3300046518 Bacteria 2291
183 Ga0495632_0030977 3300046519 Bacteria 2770
184 Ga0495637_0000232 3300046520 Bacteria 43211
185 Ga0495637_0003027 3300046520 Bacteria 9001
186 Ga0495637_0261925 3300046520 Bacteria 620
187 Ga0495643_0000192 3300046522 Bacteria 96511
188 Ga0495643_0000225 3300046522 Bacteria 86508
189 Ga0495643_0000656 3300046522 Bacteria 40885
190 Ga0495643_0044937 3300046522 Bacteria 2399
191 Ga0495644_0000214 3300046523 Bacteria 27373
192 Ga0495644_0000519 3300046523 Bacteria 16470
193 Ga0495644_0003539 3300046523 Bacteria 6175
194 Ga0495644_0006080 3300046523 Bacteria 4696
195 Ga0495644_0008262 3300046523 Bacteria 4007
196 Ga0495644_0031282 3300046523 Bacteria 2010
197 Ga0495644_0320098 3300046523 Bacteria 608
198 Ga0495648_0000035 3300046524 Bacteria 196251
199 Ga0495648_0000155 3300046524 Bacteria 81384
200 Ga0495648_0000930 3300046524 Bacteria 30420
201 Ga0495648_0003473 3300046524 Bacteria 13847
202 Ga0495648_0030865 3300046524 Bacteria 3536
203 Ga0495648_0084028 3300046524 Bacteria 1802
204 Ga0495648_0120612 3300046524 Bacteria 1410
205 Ga0495648_0184956 3300046524 Bacteria 1056
206 Ga0495663_0008546 3300046525 Bacteria 2839
207 Ga0495666_0226350 3300046526 Bacteria 855
208 Ga0495642_0000533 3300046528 Bacteria 19346
209 Ga0495642_0001595 3300046528 Bacteria 9916
210 Ga0495642_0017179 3300046528 Bacteria 2825
211 Ga0495642_0022335 3300046528 Bacteria 2492
212 Ga0495642_0050386 3300046528 Bacteria 1712
213 Ga0495642_0069142 3300046528 Bacteria 1474
214 Ga0495642_0082028 3300046528 Bacteria 1359
215 Ga0495642_0083448 3300046528 Bacteria 1348
216 Ga0495652_0013194 3300046529 Bacteria 7438
217 Ga0495654_0000005 3300046530 Bacteria 491381
218 Ga0495654_0003244 3300046530 Bacteria 10041
219 Ga0495654_0008861 3300046530 Bacteria 5532
220 Ga0495654_0041161 3300046530 Bacteria 2299
221 Ga0495654_0323384 3300046530 Bacteria 625
222 Ga0495665_0002647 3300046531 Bacteria 9661
223 Ga0495586_0101763 3300046535 Bacteria 1594
224 Ga0495587_0108171 3300046536 Bacteria 1598
225 Ga0495609_0000823 3300046538 Bacteria 23077
226 Ga0495609_0002323 3300046538 Bacteria 11748
227 Ga0495609_0007010 3300046538 Bacteria 5680
228 Ga0495609_0035680 3300046538 Bacteria 2249
229 Ga0495609_0047130 3300046538 Bacteria 1929
230 Ga0495609_0161877 3300046538 Bacteria 948
231 Ga0495597_0000533 3300046542 Bacteria 31457
232 Ga0495597_0000683 3300046542 Bacteria 27402
233 Ga0495597_0174431 3300046542 Bacteria 871
234 Ga0495597_0226329 3300046542 Bacteria 741
235 Ga0495597_0227393 3300046542 Bacteria 739
236 Ga0495622_0000032 3300046557 Bacteria 125538
237 Ga0495622_0000258 3300046557 Bacteria 40426
238 Ga0495622_0005956 3300046557 Bacteria 5666
239 Ga0495633_0000224 3300046558 Bacteria 70187
240 Ga0495633_0000321 3300046558 Bacteria 54191
241 Ga0495633_0000425 3300046558 Bacteria 43892
242 Ga0495633_0004975 3300046558 Bacteria 8293
243 Ga0495633_0009056 3300046558 Bacteria 5535
244 Ga0495633_0013299 3300046558 Bacteria 4341
245 Ga0495633_0020853 3300046558 Bacteria 3288
246 Ga0495633_0033556 3300046558 Bacteria 2474
247 Ga0495633_0045961 3300046558 Bacteria 2066
248 Ga0495633_0059618 3300046558 Bacteria 1789
249 Ga0495667_0594965 3300046559 Bacteria 689
250 Ga0495668_0000272 3300046616 Bacteria 72485
251 Ga0495668_0000417 3300046616 Bacteria 55494
252 Ga0495668_0000760 3300046616 Bacteria 37992
253 Ga0495668_0002213 3300046616 Bacteria 16546
254 Ga0495668_0013697 3300046616 Bacteria 4772
255 Ga0495668_0042216 3300046616 Bacteria 2539
256 Ga0495668_0230937 3300046616 Bacteria 1013
257 Ga0495668_0424068 3300046616 Bacteria 731
258 Ga0495634_0007515 3300046642 Bacteria 8169
259 Ga0495611_0000964 3300046648 Bacteria 15318
260 Ga0495611_0001454 3300046648 Bacteria 11778
261 Ga0495611_0016397 3300046648 Bacteria 3167
262 Ga0495611_0216174 3300046648 Bacteria 892
263 Ga0495625_0000481 3300046660 Bacteria 59753
264 Ga0495625_0000982 3300046660 Bacteria 37834
265 Ga0495625_0003690 3300046660 Bacteria 14972
266 Ga0495625_0003738 3300046660 Bacteria 14810
267 Ga0495625_0004876 3300046660 Bacteria 12506
268 Ga0495625_0133944 3300046660 Bacteria 1676
269 Ga0495625_0408258 3300046660 Bacteria 847
270 Ga0495659_0000029 3300046664 Bacteria 66600
271 Ga0495659_0000229 3300046664 Bacteria 23719
272 Ga0495659_0296424 3300046664 Bacteria 682
273 Ga0495661_0031806 3300046665 Bacteria 3342
274 Ga0495661_0032028 3300046665 Bacteria 3327
275 Ga0495661_0068846 3300046665 Bacteria 2075
276 Ga0495661_0070785 3300046665 Bacteria 2040
277 Ga0495661_0134126 3300046665 Bacteria 1353
278 Ga0495661_0239128 3300046665 Bacteria 932
279 Ga0495661_0313651 3300046665 Bacteria 781
280 Ga0495661_0361614 3300046665 Bacteria 712
281 Ga0495588_0005979 3300046674 Bacteria 5457
282 Ga0495588_0011658 3300046674 Bacteria 4131
283 Ga0495599_0351972 3300046678 Bacteria 883
284 Ga0495623_0006925 3300046679 Bacteria 7368
285 Ga0495669_0002932 3300046684 Bacteria 7012
286 Ga0495669_0114891 3300046684 Bacteria 1259
287 Ga0495670_0000406 3300046691 Bacteria 20593
288 Ga0495670_0001625 3300046691 Bacteria 10999
289 Ga0495670_0011286 3300046691 Bacteria 4392
290 Ga0495670_0082394 3300046691 Bacteria 1640
291 Ga0495670_0142717 3300046691 Bacteria 1253
292 Ga0495671_0000074 3300046692 Bacteria 96288
293 Ga0495671_0000211 3300046692 Bacteria 51024
294 Ga0495671_0001257 3300046692 Bacteria 17333
295 Ga0495671_0013537 3300046692 Bacteria 4411
296 Ga0495671_0015687 3300046692 Bacteria 4054
297 Ga0495649_0001720 3300046694 Bacteria 16189
298 Ga0495649_0064077 3300046694 Bacteria 1974
299 Ga0495589_0012901 3300046794 Bacteria 4318
300 Ga0495589_0164327 3300046794 Bacteria 1057
301 Ga0495660_0000420 3300046810 Bacteria 35871
302 Ga0495660_0002754 3300046810 Bacteria 11084
303 Ga0495660_0004875 3300046810 Bacteria 8081
304 Ga0495660_0005608 3300046810 Bacteria 7505
305 Ga0495660_0010564 3300046810 Bacteria 5370
306 Ga0495660_0011163 3300046810 Bacteria 5215
307 Ga0495660_0019760 3300046810 Bacteria 3866
308 Ga0495660_0179373 3300046810 Bacteria 1025
309 Ga0495660_0192814 3300046810 Bacteria 978
310 Ga0495581_0066831 3300047315 Bacteria 2079
311 Ga0495604_0072857 3300047317 Bacteria 2594
312 Ga0495636_0000226 3300047318 Bacteria 22221
313 Ga0495636_0066721 3300047318 Bacteria 1530
314 Ga0495674_0018866 3300047319 Bacteria 6415
315 Ga0495674_0848286 3300047319 Bacteria 708
316 Ga0495672_0000035 3300047320 Bacteria 290329
317 Ga0495672_0000385 3300047320 Bacteria 54448
318 Ga0495672_0001516 3300047320 Bacteria 22758
319 Ga0495672_0006305 3300047320 Bacteria 9223
320 Ga0495672_0025986 3300047320 Bacteria 3742
321 Ga0495676_0014203 3300047321 Bacteria 7130
322 Ga0495676_0016953 3300047321 Bacteria 6450
323 Ga0495683_0000426 3300047323 Bacteria 33759
324 Ga0495683_0001256 3300047323 Bacteria 17198
325 Ga0495683_0041045 3300047323 Bacteria 2336
326 Ga0495683_0090078 3300047323 Bacteria 1487
327 Ga0495683_0145947 3300047323 Bacteria 1105
328 Ga0495683_0168747 3300047323 Bacteria 1007
329 Ga0495687_001367 3300047443 Bacteria 22540
330 Ga0495687_001879 3300047443 Bacteria 18158
331 Ga0495687_002599 3300047443 Bacteria 14191
332 Ga0495675_0010943 3300047444 Bacteria 5684
333 Ga0495677_0000953 3300047445 Bacteria 11646
334 Ga0495677_0007395 3300047445 Bacteria 4108
335 Ga0495677_0057100 3300047445 Bacteria 1442
336 Ga0495677_0106011 3300047445 Bacteria 1066
337 Ga0495685_000041 3300047447 Bacteria 52191
338 Ga0495673_0000027 3300047469 Bacteria 475440
339 Ga0495673_0000135 3300047469 Bacteria 135338
340 Ga0495673_0000252 3300047469 Bacteria 74793
341 Ga0495673_0010995 3300047469 Bacteria 4896
342 Ga0495673_0253156 3300047469 Bacteria 642
343 Ga0495681_0003455 3300047470 Bacteria 10983
344 Ga0495681_0014898 3300047470 Bacteria 4430
345 Ga0495681_0018109 3300047470 Bacteria 3889
346 Ga0495681_0026353 3300047470 Bacteria 3027
347 Ga0495681_0100888 3300047470 Bacteria 1262
348 Ga0495681_0126396 3300047470 Bacteria 1092
349 Ga0495686_0002546 3300047472 Bacteria 17027
350 Ga0495686_0003256 3300047472 Bacteria 14241
351 Ga0495686_0071718 3300047472 Bacteria 2131
352 Ga0495686_0108583 3300047472 Bacteria 1666
353 Ga0495686_0116517 3300047472 Bacteria 1597
354 Ga0495686_0161920 3300047472 Bacteria 1307
355 Ga0495593_0161391 3300047673 Bacteria 1131
356 Ga0495602_0004054 3300048088 Bacteria 15255
357 Ga0495614_0268755 3300048089 Bacteria 783
358 Ga0495626_0000030 3300048091 Bacteria 202562
359 Ga0495626_0170644 3300048091 Bacteria 907
360 Ga0496110_0497668 3300048913 Bacteria 1110
361 Ga0496110_0973959 3300048913 Bacteria 755
362 Ga0496111_0072028 3300048914 Bacteria 2515
363 Ga0496111_0544987 3300048914 Bacteria 852
364 Ga0496112_1330400 3300048915 Bacteria 634
365 Ga0496114_0396451 3300048917 Bacteria 1222
366 Ga0496114_0521486 3300048917 Bacteria 1051
367 Ga0496116_0036249 3300048919 Bacteria 3454
368 Ga0496116_0068271 3300048919 Bacteria 2266
369 Ga0496117_0000010 3300048920 Bacteria 611954
370 Ga0496118_0000009 3300048921 Bacteria 611954
371 Ga0496118_0167798 3300048921 Bacteria 1346
372 Ga0496120_0073717 3300048923 Bacteria 1867
373 Ga0496121_0006221 3300048924 Bacteria 14962
374 Ga0496121_0009876 3300048924 Bacteria 10880
375 Ga0496121_0060279 3300048924 Bacteria 3122
376 Ga0496122_0002186 3300048925 Bacteria 28638
377 Ga0496122_0462267 3300048925 Bacteria 626
378 Ga0496123_0002612 3300048926 Bacteria 21859
379 Ga0496123_0002764 3300048926 Bacteria 20993
380 Ga0496124_0015387 3300048927 Bacteria 7333
381 Ga0496124_0064342 3300048927 Bacteria 3062
382 Ga0496124_0133411 3300048927 Bacteria 1970
383 Ga0496125_0050377 3300048928 Bacteria 3448
384 Ga0496125_0189674 3300048928 Bacteria 1359
385 Ga0496126_0007014 3300048929 Bacteria 12436
386 Ga0495678_000001 3300049459 Bacteria 1060340
387 Ga0495678_002536 3300049459 Bacteria 12269
388 Ga0495678_008766 3300049459 Bacteria 5069
389 Ga0495678_031794 3300049459 Bacteria 2195
390 Ga0495682_0000197 3300049460 Bacteria 48575
391 Ga0495682_0000369 3300049460 Bacteria 32675
392 Ga0495682_0003855 3300049460 Bacteria 6574
393 Ga0495682_0004218 3300049460 Bacteria 6218
394 Ga0495682_0083421 3300049460 Bacteria 1149
395 Ga0501249_001893 3300049679 Bacteria 4253
396 Ga0501269_000335 3300049766 Bacteria 12150
397 nmdc:mga05p37_198873_c1 3300050507 Bacteria 2429
398 nmdc:mga0qj67_193350_c1 3300050509 Bacteria 1653
399 nmdc:mga0a205_169177_c1 3300050515 Bacteria 2081
400 Ga0495619_0344204 3300053085 Bacteria 1032
401 Ga0500557_226434 3300053105 Bacteria 593
402 Ga0500618_000248 3300053125 Bacteria 42854
403 Ga0500559_0283482 3300053136 Bacteria 779
404 Ga0500586_000075 3300053145 Bacteria 17073
405 Ga0500586_015254 3300053145 Bacteria 2304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100005570 Ga0070671_1000055706 156
2 3300041486 Ga0451807_1629659 Ga0451807_1629659_656_1132 156
3 3300041501 Ga0451845_0845083 Ga0451845_0845083_311_790 158
4 iso_pu_bacteria 2643221645 2644249508 158
5 iso_pu_bacteria 2643221664 2644359608 158
6 iso_pu_bacteria 2738541280 2738740921 158
7 iso_pu_bacteria 2738541300 2738845243 158
8 iso_pu_bacteria 2738543018 2739274838 158
9 iso_pu_bacteria 2738543030 2739343882 158
10 3300005355 Ga0070671_101067560 Ga0070671_1010675601 159
11 3300031548 Ga0307408_100000166 Ga0307408_10000016623 159
12 3300044683 Ga0466965_0021472 Ga0466965_0021472_1271_1750 159
13 iso_pu_bacteria 2738541297 2738825652 159
14 iso_pu_bacteria 2738541357 2739149449 159
15 iso_pu_bacteria 2738543003 2739191368 159
16 iso_pu_bacteria 2738543026 2739317845 159
17 iso_pu_bacteria 2738543029 2739336086 159
18 iso_pu_bacteria 2821131069 2821134247 159
19 iso_pu_bacteria 2842711865 2842712082 159
20 iso_pu_bacteria 2857553236 2857554833 159
21 iso_pu_bacteria 2857558681 2857559593 159
22 iso_pu_bacteria 2857564685 2857566054 159
23 iso_pu_bacteria 2885080285 2885081684 159
24 iso_pu_bacteria 2904424332 2904429720 159
25 iso_pu_bacteria 2919476304 2919479082 159
26 3300003322 rootL2_10030004 rootL2_100300047 160
27 3300003771 Ga0055526_1001746 Ga0055526_10017468 160
28 3300003773 Ga0055537_1000144 Ga0055537_10001447 160
29 3300003775 Ga0055524_1000027 Ga0055524_1000027110 160
30 3300003784 Ga0055534_1000072 Ga0055534_100007215 160
31 3300003790 Ga0055528_1000094 Ga0055528_100009427 160
32 3300006948 Ga0099826_10000003 Ga0099826_10000003701 160
33 3300021361 Ga0213872_10000069 Ga0213872_1000006956 160
34 3300021361 Ga0213872_10000217 Ga0213872_1000021738 160
35 3300021361 Ga0213872_10001823 Ga0213872_100018235 160
36 3300021361 Ga0213872_10103954 Ga0213872_101039542 160
37 3300025263 Ga0209565_1000006 Ga0209565_1000006446 160
38 3300025273 Ga0209673_1000004 Ga0209673_1000004383 160
39 3300025291 Ga0209675_1000006 Ga0209675_1000006445 160
40 3300025295 Ga0209564_1000085 Ga0209564_1000085170 160
41 3300025295 Ga0209564_1023109 Ga0209564_10231092 160
42 3300025299 Ga0209256_1000013 Ga0209256_1000013305 160
43 3300025299 Ga0209256_1000037 Ga0209256_1000037227 160
44 3300027666 Ga0209282_1000002 Ga0209282_1000002306 160
45 3300039447 Ga0436361_0108199 Ga0436361_0108199_25691_26173 160
46 3300039447 Ga0436361_0719314 Ga0436361_0719314_7085_7567 160
47 3300039447 Ga0436361_0931365 Ga0436361_0931365_9366_9848 160
48 3300039447 Ga0436361_1028840 Ga0436361_1028840_101_583 160
49 3300046452 Ga0495617_000099 Ga0495617_000099_34238_34720 160
50 3300046492 Ga0495585_0000379 Ga0495585_0000379_25048_25530 160
51 3300046524 Ga0495648_0000155 Ga0495648_0000155_56948_57430 160
52 3300046558 Ga0495633_0059618 Ga0495633_0059618_431_913 160
53 3300046664 Ga0495659_0296424 Ga0495659_0296424_130_615 160
54 iso_pu_bacteria 2600255292 2601670410 160
55 iso_pu_bacteria 2857547612 2857548250 160
56 iso_pu_bacteria 2932410948 2932412848 160
57 iso_pu_bacteria 2932416698 2932420363 160
58 3300003763 Ga0055529_1000271 Ga0055529_100027129 161
59 3300006846 Ga0075430_100123165 Ga0075430_1001231653 161
60 3300025233 Ga0209437_103067 Ga0209437_1030672 161
61 3300025256 Ga0209759_1016042 Ga0209759_10160422 161
62 3300025272 Ga0209455_1000051 Ga0209455_100005128 161
63 3300032005 Ga0307411_11156482 Ga0307411_111564821 161
64 3300037466 Ga0395898_0759158 Ga0395898_0759158_195_680 161
65 3300046452 Ga0495617_001548 Ga0495617_001548_8861_9346 161
66 3300046452 Ga0495617_011814 Ga0495617_011814_2037_2522 161
67 3300046457 Ga0495590_0018263 Ga0495590_0018263_1722_2207 161
68 3300046460 Ga0495638_0001462 Ga0495638_0001462_16864_17349 161
69 3300046471 Ga0495650_0000105 Ga0495650_0000105_26335_26820 161
70 3300046474 Ga0495605_0001012 Ga0495605_0001012_16355_16840 161
71 3300046474 Ga0495605_0133500 Ga0495605_0133500_427_912 161
72 3300046491 Ga0495584_0063059 Ga0495584_0063059_636_1121 161
73 3300046501 Ga0495607_0003249 Ga0495607_0003249_8692_9177 161
74 3300046501 Ga0495607_0015620 Ga0495607_0015620_1023_1508 161
75 3300046506 Ga0495583_0000004 Ga0495583_0000004_263551_264036 161
76 3300046507 Ga0495606_0000007 Ga0495606_0000007_224959_225444 161
77 3300046507 Ga0495606_0013171 Ga0495606_0013171_4645_5130 161
78 3300046513 Ga0495616_0001765 Ga0495616_0001765_614_1099 161
79 3300046523 Ga0495644_0000214 Ga0495644_0000214_7538_8023 161
80 3300046524 Ga0495648_0000930 Ga0495648_0000930_24604_25089 161
81 3300046528 Ga0495642_0050386 Ga0495642_0050386_146_631 161
82 3300046528 Ga0495642_0082028 Ga0495642_0082028_819_1304 161
83 3300046538 Ga0495609_0000823 Ga0495609_0000823_3296_3781 161
84 3300046542 Ga0495597_0226329 Ga0495597_0226329_91_576 161
85 3300046558 Ga0495633_0004975 Ga0495633_0004975_3180_3665 161
86 3300046648 Ga0495611_0001454 Ga0495611_0001454_8681_9166 161
87 3300046660 Ga0495625_0004876 Ga0495625_0004876_1747_2232 161
88 3300046664 Ga0495659_0000229 Ga0495659_0000229_7306_7791 161
89 3300046665 Ga0495661_0070785 Ga0495661_0070785_577_1062 161
90 3300046691 Ga0495670_0000406 Ga0495670_0000406_3524_4009 161
91 3300046692 Ga0495671_0001257 Ga0495671_0001257_14424_14909 161
92 3300046810 Ga0495660_0192814 Ga0495660_0192814_303_788 161
93 3300047318 Ga0495636_0000226 Ga0495636_0000226_19079_19564 161
94 3300047320 Ga0495672_0001516 Ga0495672_0001516_3392_3877 161
95 3300047320 Ga0495672_0006305 Ga0495672_0006305_6249_6734 161
96 3300047323 Ga0495683_0001256 Ga0495683_0001256_2144_2629 161
97 3300047443 Ga0495687_001367 Ga0495687_001367_19541_20026 161
98 3300047445 Ga0495677_0007395 Ga0495677_0007395_1197_1682 161
99 3300047447 Ga0495685_000041 Ga0495685_000041_4560_5045 161
100 3300047469 Ga0495673_0010995 Ga0495673_0010995_3781_4266 161
101 3300047469 Ga0495673_0253156 Ga0495673_0253156_37_522 161
102 3300047472 Ga0495686_0108583 Ga0495686_0108583_598_1083 161
103 3300048091 Ga0495626_0000030 Ga0495626_0000030_97882_98373 161
104 3300048917 Ga0496114_0521486 Ga0496114_0521486_351_860 161
105 3300049459 Ga0495678_008766 Ga0495678_008766_686_1171 161
106 3300049460 Ga0495682_0000197 Ga0495682_0000197_16342_16827 161
107 3300049460 Ga0495682_0000369 Ga0495682_0000369_29783_30268 161
108 3300050509 nmdc:mga0qj67_193350_c1 nmdc:mga0qj67_193350_c1_127_612 161
109 3300013297 Ga0157378_10749792 Ga0157378_107497921 162
110 3300025925 Ga0207650_10009897 Ga0207650_100098974 162
111 3300044901 Ga0466960_0147087 Ga0466960_0147087_618_1109 162
112 3300046453 Ga0495627_004455 Ga0495627_004455_1777_2268 162
113 3300046455 Ga0495603_0016824 Ga0495603_0016824_2227_2718 162
114 3300046455 Ga0495603_0371040 Ga0495603_0371040_18_509 162
115 3300046457 Ga0495590_0000275 Ga0495590_0000275_14779_15270 162
116 3300046457 Ga0495590_0056823 Ga0495590_0056823_146_637 162
117 3300046460 Ga0495638_0003879 Ga0495638_0003879_2206_2697 162
118 3300046460 Ga0495638_0240328 Ga0495638_0240328_199_690 162
119 3300046460 Ga0495638_0251949 Ga0495638_0251949_341_835 162
120 3300046460 Ga0495638_0440112 Ga0495638_0440112_16_507 162
121 3300046463 Ga0495653_0006487 Ga0495653_0006487_3175_3666 162
122 3300046473 Ga0495582_0012187 Ga0495582_0012187_528_1019 162
123 3300046474 Ga0495605_0045799 Ga0495605_0045799_612_1103 162
124 3300046491 Ga0495584_0000011 Ga0495584_0000011_94187_94678 162
125 3300046491 Ga0495584_0001592 Ga0495584_0001592_199_690 162
126 3300046491 Ga0495584_0018853 Ga0495584_0018853_1754_2245 162
127 3300046492 Ga0495585_0000078 Ga0495585_0000078_83313_83804 162
128 3300046492 Ga0495585_0003135 Ga0495585_0003135_10351_10842 162
129 3300046492 Ga0495585_0005144 Ga0495585_0005144_5807_6298 162
130 3300046492 Ga0495585_0034656 Ga0495585_0034656_736_1227 162
131 3300046492 Ga0495585_0037590 Ga0495585_0037590_430_921 162
132 3300046499 Ga0495594_0005687 Ga0495594_0005687_2819_3310 162
133 3300046500 Ga0495596_0000101 Ga0495596_0000101_17994_18485 162
134 3300046500 Ga0495596_0003575 Ga0495596_0003575_5320_5811 162
135 3300046500 Ga0495596_0014805 Ga0495596_0014805_1942_2433 162
136 3300046500 Ga0495596_0040424 Ga0495596_0040424_1126_1617 162
137 3300046500 Ga0495596_0350199 Ga0495596_0350199_69_560 162
138 3300046501 Ga0495607_0002307 Ga0495607_0002307_15036_15527 162
139 3300046501 Ga0495607_0073007 Ga0495607_0073007_839_1330 162
140 3300046501 Ga0495607_0116100 Ga0495607_0116100_692_1183 162
141 3300046507 Ga0495606_0062957 Ga0495606_0062957_901_1392 162
142 3300046507 Ga0495606_0122930 Ga0495606_0122930_349_837 162
143 3300046507 Ga0495606_0124034 Ga0495606_0124034_985_1476 162
144 3300046513 Ga0495616_0000262 Ga0495616_0000262_9067_9558 162
145 3300046513 Ga0495616_0002567 Ga0495616_0002567_8967_9458 162
146 3300046513 Ga0495616_0035509 Ga0495616_0035509_255_746 162
147 3300046513 Ga0495616_0072341 Ga0495616_0072341_959_1450 162
148 3300046515 Ga0495620_0006722 Ga0495620_0006722_5210_5701 162
149 3300046517 Ga0495630_0458696 Ga0495630_0458696_12_503 162
150 3300046518 Ga0495631_0033878 Ga0495631_0033878_1540_2031 162
151 3300046519 Ga0495632_0030977 Ga0495632_0030977_269_760 162
152 3300046523 Ga0495644_0000519 Ga0495644_0000519_8316_8804 162
153 3300046523 Ga0495644_0006080 Ga0495644_0006080_2415_2906 162
154 3300046523 Ga0495644_0008262 Ga0495644_0008262_1295_1786 162
155 3300046523 Ga0495644_0031282 Ga0495644_0031282_488_979 162
156 3300046524 Ga0495648_0184956 Ga0495648_0184956_188_679 162
157 3300046525 Ga0495663_0008546 Ga0495663_0008546_1248_1739 162
158 3300046526 Ga0495666_0226350 Ga0495666_0226350_203_694 162
159 3300046528 Ga0495642_0001595 Ga0495642_0001595_2457_2948 162
160 3300046528 Ga0495642_0017179 Ga0495642_0017179_327_818 162
161 3300046528 Ga0495642_0022335 Ga0495642_0022335_1777_2265 162
162 3300046528 Ga0495642_0069142 Ga0495642_0069142_449_940 162
163 3300046528 Ga0495642_0083448 Ga0495642_0083448_606_1094 162
164 3300046529 Ga0495652_0013194 Ga0495652_0013194_2981_3472 162
165 3300046530 Ga0495654_0008861 Ga0495654_0008861_3890_4378 162
166 3300046530 Ga0495654_0323384 Ga0495654_0323384_50_541 162
167 3300046531 Ga0495665_0002647 Ga0495665_0002647_4397_4888 162
168 3300046535 Ga0495586_0101763 Ga0495586_0101763_942_1433 162
169 3300046536 Ga0495587_0108171 Ga0495587_0108171_1010_1501 162
170 3300046538 Ga0495609_0035680 Ga0495609_0035680_824_1312 162
171 3300046538 Ga0495609_0047130 Ga0495609_0047130_544_1035 162
172 3300046542 Ga0495597_0174431 Ga0495597_0174431_178_669 162
173 3300046557 Ga0495622_0000032 Ga0495622_0000032_99428_99919 162
174 3300046557 Ga0495622_0005956 Ga0495622_0005956_4467_4955 162
175 3300046558 Ga0495633_0009056 Ga0495633_0009056_518_1006 162
176 3300046558 Ga0495633_0013299 Ga0495633_0013299_1808_2299 162
177 3300046558 Ga0495633_0033556 Ga0495633_0033556_935_1426 162
178 3300046558 Ga0495633_0045961 Ga0495633_0045961_523_1014 162
179 3300046559 Ga0495667_0594965 Ga0495667_0594965_66_557 162
180 3300046616 Ga0495668_0013697 Ga0495668_0013697_1689_2180 162
181 3300046616 Ga0495668_0042216 Ga0495668_0042216_262_753 162
182 3300046616 Ga0495668_0230937 Ga0495668_0230937_348_836 162
183 3300046616 Ga0495668_0424068 Ga0495668_0424068_226_717 162
184 3300046642 Ga0495634_0007515 Ga0495634_0007515_697_1188 162
185 3300046648 Ga0495611_0000964 Ga0495611_0000964_10361_10849 162
186 3300046648 Ga0495611_0016397 Ga0495611_0016397_95_586 162
187 3300046648 Ga0495611_0216174 Ga0495611_0216174_213_704 162
188 3300046660 Ga0495625_0133944 Ga0495625_0133944_868_1359 162
189 3300046660 Ga0495625_0408258 Ga0495625_0408258_62_553 162
190 3300046664 Ga0495659_0000029 Ga0495659_0000029_20501_20989 162
191 3300046665 Ga0495661_0032028 Ga0495661_0032028_2797_3288 162
192 3300046665 Ga0495661_0068846 Ga0495661_0068846_97_588 162
193 3300046665 Ga0495661_0134126 Ga0495661_0134126_622_1110 162
194 3300046665 Ga0495661_0313651 Ga0495661_0313651_159_650 162
195 3300046665 Ga0495661_0361614 Ga0495661_0361614_174_665 162
196 3300046674 Ga0495588_0005979 Ga0495588_0005979_1996_2487 162
197 3300046674 Ga0495588_0011658 Ga0495588_0011658_842_1333 162
198 3300046678 Ga0495599_0351972 Ga0495599_0351972_33_533 162
199 3300046679 Ga0495623_0006925 Ga0495623_0006925_3619_4110 162
200 3300046684 Ga0495669_0002932 Ga0495669_0002932_6410_6901 162
201 3300046684 Ga0495669_0114891 Ga0495669_0114891_655_1146 162
202 3300046691 Ga0495670_0001625 Ga0495670_0001625_8684_9175 162
203 3300046691 Ga0495670_0011286 Ga0495670_0011286_1820_2311 162
204 3300046691 Ga0495670_0142717 Ga0495670_0142717_151_642 162
205 3300046692 Ga0495671_0000211 Ga0495671_0000211_38267_38755 162
206 3300046692 Ga0495671_0013537 Ga0495671_0013537_2304_2795 162
207 3300046794 Ga0495589_0012901 Ga0495589_0012901_2587_3078 162
208 3300046810 Ga0495660_0000420 Ga0495660_0000420_34929_35417 162
209 3300046810 Ga0495660_0004875 Ga0495660_0004875_5863_6351 162
210 3300046810 Ga0495660_0005608 Ga0495660_0005608_284_775 162
211 3300047315 Ga0495581_0066831 Ga0495581_0066831_1311_1802 162
212 3300047317 Ga0495604_0072857 Ga0495604_0072857_230_721 162
213 3300047318 Ga0495636_0066721 Ga0495636_0066721_167_655 162
214 3300047319 Ga0495674_0848286 Ga0495674_0848286_108_596 162
215 3300047320 Ga0495672_0000035 Ga0495672_0000035_258582_259070 162
216 3300047321 Ga0495676_0016953 Ga0495676_0016953_3849_4340 162
217 3300047323 Ga0495683_0000426 Ga0495683_0000426_16376_16867 162
218 3300047323 Ga0495683_0090078 Ga0495683_0090078_183_674 162
219 3300047323 Ga0495683_0145947 Ga0495683_0145947_135_626 162
220 3300047444 Ga0495675_0010943 Ga0495675_0010943_4241_4732 162
221 3300047445 Ga0495677_0000953 Ga0495677_0000953_6886_7377 162
222 3300047445 Ga0495677_0057100 Ga0495677_0057100_183_674 162
223 3300047470 Ga0495681_0014898 Ga0495681_0014898_569_1060 162
224 3300047470 Ga0495681_0018109 Ga0495681_0018109_803_1294 162
225 3300047470 Ga0495681_0026353 Ga0495681_0026353_2258_2749 162
226 3300047470 Ga0495681_0126396 Ga0495681_0126396_199_693 162
227 3300047472 Ga0495686_0003256 Ga0495686_0003256_8055_8543 162
228 3300047472 Ga0495686_0116517 Ga0495686_0116517_304_795 162
229 3300047673 Ga0495593_0161391 Ga0495593_0161391_492_992 162
230 3300048088 Ga0495602_0004054 Ga0495602_0004054_8077_8577 162
231 3300048089 Ga0495614_0268755 Ga0495614_0268755_209_700 162
232 3300048091 Ga0495626_0170644 Ga0495626_0170644_131_625 162
233 3300048913 Ga0496110_0973959 Ga0496110_0973959_199_690 162
234 3300048915 Ga0496112_1330400 Ga0496112_1330400_26_517 162
235 3300049460 Ga0495682_0004218 Ga0495682_0004218_2588_3079 162
236 3300049460 Ga0495682_0083421 Ga0495682_0083421_402_893 162
237 3300002738 JGI25154J39366_1007653 JGI25154J39366_10076532 163
238 3300003215 JGI25153J46596_10047253 JGI25153J46596_100472532 163
239 3300003771 Ga0055526_1000033 Ga0055526_1000033105 163
240 3300003771 Ga0055526_1000059 Ga0055526_100005920 163
241 3300005262 Ga0065165_1004965 Ga0065165_10049657 163
242 3300005288 Ga0065714_10010106 Ga0065714_100101063 163
243 3300005434 Ga0070709_10487645 Ga0070709_104876452 163
244 3300005563 Ga0068855_100035552 Ga0068855_1000355524 163
245 3300005577 Ga0068857_100363804 Ga0068857_1003638042 163
246 3300006175 Ga0070712_100067388 Ga0070712_1000673883 163
247 3300006946 Ga0079104_1015720 Ga0079104_10157202 163
248 3300009036 Ga0105244_10001188 Ga0105244_1000118815 163
249 3300009036 Ga0105244_10001783 Ga0105244_100017839 163
250 3300009036 Ga0105244_10107993 Ga0105244_101079932 163
251 3300009177 Ga0105248_10262817 Ga0105248_102628172 163
252 3300010375 Ga0105239_11811798 Ga0105239_118117981 163
253 3300013105 Ga0157369_10041619 Ga0157369_100416193 163
254 3300014497 Ga0182008_10000154 Ga0182008_1000015421 163
255 3300015261 Ga0182006_1000010 Ga0182006_100001062 163
256 3300015261 Ga0182006_1000055 Ga0182006_100005594 163
257 3300015262 Ga0182007_10000030 Ga0182007_1000003063 163
258 3300015265 Ga0182005_1000003 Ga0182005_1000003303 163
259 3300015265 Ga0182005_1000009 Ga0182005_1000009364 163
260 3300017792 Ga0163161_10115796 Ga0163161_101157962 163
261 3300025233 Ga0209437_112245 Ga0209437_1122452 163
262 3300025245 Ga0207425_1000476 Ga0207425_100047613 163
263 3300025246 Ga0209646_1000047 Ga0209646_1000047233 163
264 3300025294 Ga0209025_1002516 Ga0209025_10025162 163
265 3300025295 Ga0209564_1000006 Ga0209564_1000006634 163
266 3300025295 Ga0209564_1000026 Ga0209564_100002694 163
267 3300025297 Ga0209758_1000728 Ga0209758_100072834 163
268 3300025728 Ga0207655_1002061 Ga0207655_10020612 163
269 3300025728 Ga0207655_1002711 Ga0207655_10027118 163
270 3300025906 Ga0207699_10614209 Ga0207699_106142092 163
271 3300025914 Ga0207671_10101552 Ga0207671_101015522 163
272 3300025915 Ga0207693_10092229 Ga0207693_100922292 163
273 3300025931 Ga0207644_10344970 Ga0207644_103449702 163
274 3300025932 Ga0207690_10106670 Ga0207690_101066702 163
275 3300025949 Ga0207667_10111658 Ga0207667_101116582 163
276 3300026035 Ga0207703_10471223 Ga0207703_104712232 163
277 3300026078 Ga0207702_10147157 Ga0207702_101471572 163
278 3300027111 Ga0209281_1004108 Ga0209281_10041082 163
279 3300028016 Ga0265354_1003359 Ga0265354_10033592 163
280 3300030744 Ga0316181_1118542 Ga0316181_11185424 163
281 3300030878 Ga0265770_1012632 Ga0265770_10126322 163
282 3300031090 Ga0265760_10002084 Ga0265760_100020845 163
283 3300032004 Ga0307414_10192768 Ga0307414_101927682 163
284 3300035410 Ga0373924_0128445 Ga0373924_0128445_258_812 163
285 3300036401 Ga0373937_0025492 Ga0373937_0025492_852_1406 163
286 3300037068 Ga0373925_0294659 Ga0373925_0294659_176_730 163
287 3300041451 Ga0451791_1281173 Ga0451791_1281173_881_1390 163
288 3300042134 Ga0450898_037622 Ga0450898_037622_334_828 163
289 3300042139 Ga0450904_000226 Ga0450904_000226_8632_9129 163
290 3300046452 Ga0495617_010756 Ga0495617_010756_64_555 163
291 3300046453 Ga0495627_000066 Ga0495627_000066_99204_99695 163
292 3300046457 Ga0495590_0000036 Ga0495590_0000036_26732_27238 163
293 3300046459 Ga0495629_0124788 Ga0495629_0124788_902_1456 163
294 3300046460 Ga0495638_0000114 Ga0495638_0000114_27914_28420 163
295 3300046460 Ga0495638_0030550 Ga0495638_0030550_2852_3343 163
296 3300046460 Ga0495638_0092441 Ga0495638_0092441_127_621 163
297 3300046460 Ga0495638_0255749 Ga0495638_0255749_186_677 163
298 3300046463 Ga0495653_0000007 Ga0495653_0000007_169158_169649 163
299 3300046471 Ga0495650_0000232 Ga0495650_0000232_87657_88148 163
300 3300046471 Ga0495650_0000994 Ga0495650_0000994_12455_12946 163
301 3300046471 Ga0495650_0001023 Ga0495650_0001023_5312_5806 163
302 3300046471 Ga0495650_0002164 Ga0495650_0002164_5130_5636 163
303 3300046471 Ga0495650_0042910 Ga0495650_0042910_1147_1641 163
304 3300046474 Ga0495605_0000015 Ga0495605_0000015_272971_273504 163
305 3300046475 Ga0495639_0013737 Ga0495639_0013737_1928_2434 163
306 3300046492 Ga0495585_0003654 Ga0495585_0003654_1103_1597 163
307 3300046501 Ga0495607_0001415 Ga0495607_0001415_9022_9528 163
308 3300046501 Ga0495607_0008618 Ga0495607_0008618_3802_4293 163
309 3300046506 Ga0495583_0000468 Ga0495583_0000468_27931_28437 163
310 3300046506 Ga0495583_0002552 Ga0495583_0002552_8321_8818 163
311 3300046507 Ga0495606_0000280 Ga0495606_0000280_23407_23958 163
312 3300046507 Ga0495606_0000323 Ga0495606_0000323_22312_22803 163
313 3300046507 Ga0495606_0000705 Ga0495606_0000705_34426_34929 163
314 3300046507 Ga0495606_0000750 Ga0495606_0000750_25491_25982 163
315 3300046507 Ga0495606_0001844 Ga0495606_0001844_10582_11088 163
316 3300046507 Ga0495606_0004337 Ga0495606_0004337_12496_12987 163
317 3300046507 Ga0495606_0443088 Ga0495606_0443088_130_624 163
318 3300046512 Ga0495610_0000004 Ga0495610_0000004_939713_940207 163
319 3300046512 Ga0495610_0003863 Ga0495610_0003863_1897_2448 163
320 3300046512 Ga0495610_0005198 Ga0495610_0005198_6670_7161 163
321 3300046512 Ga0495610_0005521 Ga0495610_0005521_3242_3733 163
322 3300046512 Ga0495610_0012048 Ga0495610_0012048_53_544 163
323 3300046512 Ga0495610_0343709 Ga0495610_0343709_20_511 163
324 3300046513 Ga0495616_0000103 Ga0495616_0000103_14729_15226 163
325 3300046520 Ga0495637_0000232 Ga0495637_0000232_20016_20510 163
326 3300046520 Ga0495637_0003027 Ga0495637_0003027_343_834 163
327 3300046520 Ga0495637_0261925 Ga0495637_0261925_20_511 163
328 3300046522 Ga0495643_0000192 Ga0495643_0000192_17182_17679 163
329 3300046522 Ga0495643_0000225 Ga0495643_0000225_27217_27708 163
330 3300046522 Ga0495643_0000656 Ga0495643_0000656_11233_11739 163
331 3300046522 Ga0495643_0044937 Ga0495643_0044937_486_977 163
332 3300046523 Ga0495644_0003539 Ga0495644_0003539_2360_2857 163
333 3300046523 Ga0495644_0320098 Ga0495644_0320098_50_541 163
334 3300046524 Ga0495648_0000035 Ga0495648_0000035_167360_167866 163
335 3300046524 Ga0495648_0003473 Ga0495648_0003473_1183_1677 163
336 3300046524 Ga0495648_0030865 Ga0495648_0030865_1996_2487 163
337 3300046524 Ga0495648_0084028 Ga0495648_0084028_1184_1678 163
338 3300046524 Ga0495648_0120612 Ga0495648_0120612_154_651 163
339 3300046528 Ga0495642_0000533 Ga0495642_0000533_9640_10146 163
340 3300046530 Ga0495654_0000005 Ga0495654_0000005_353937_354431 163
341 3300046530 Ga0495654_0003244 Ga0495654_0003244_6316_6810 163
342 3300046530 Ga0495654_0041161 Ga0495654_0041161_76_585 163
343 3300046538 Ga0495609_0002323 Ga0495609_0002323_29_520 163
344 3300046538 Ga0495609_0007010 Ga0495609_0007010_2747_3238 163
345 3300046538 Ga0495609_0161877 Ga0495609_0161877_392_883 163
346 3300046542 Ga0495597_0000533 Ga0495597_0000533_11508_11999 163
347 3300046542 Ga0495597_0000683 Ga0495597_0000683_6429_6935 163
348 3300046542 Ga0495597_0227393 Ga0495597_0227393_53_547 163
349 3300046557 Ga0495622_0000258 Ga0495622_0000258_8503_9009 163
350 3300046558 Ga0495633_0000224 Ga0495633_0000224_65293_65799 163
351 3300046558 Ga0495633_0000321 Ga0495633_0000321_28460_28951 163
352 3300046558 Ga0495633_0000425 Ga0495633_0000425_8139_8648 163
353 3300046558 Ga0495633_0020853 Ga0495633_0020853_308_799 163
354 3300046616 Ga0495668_0000272 Ga0495668_0000272_26602_27108 163
355 3300046616 Ga0495668_0000417 Ga0495668_0000417_33940_34491 163
356 3300046616 Ga0495668_0000760 Ga0495668_0000760_23062_23556 163
357 3300046616 Ga0495668_0002213 Ga0495668_0002213_921_1490 163
358 3300046660 Ga0495625_0000481 Ga0495625_0000481_31277_31783 163
359 3300046660 Ga0495625_0000982 Ga0495625_0000982_12038_12529 163
360 3300046660 Ga0495625_0003690 Ga0495625_0003690_10446_10937 163
361 3300046660 Ga0495625_0003738 Ga0495625_0003738_10620_11111 163
362 3300046665 Ga0495661_0031806 Ga0495661_0031806_2111_2608 163
363 3300046665 Ga0495661_0239128 Ga0495661_0239128_415_912 163
364 3300046691 Ga0495670_0082394 Ga0495670_0082394_592_1098 163
365 3300046692 Ga0495671_0000074 Ga0495671_0000074_70792_71286 163
366 3300046692 Ga0495671_0015687 Ga0495671_0015687_3434_3925 163
367 3300046694 Ga0495649_0001720 Ga0495649_0001720_10481_10972 163
368 3300046694 Ga0495649_0064077 Ga0495649_0064077_714_1205 163
369 3300046794 Ga0495589_0164327 Ga0495589_0164327_232_726 163
370 3300046810 Ga0495660_0002754 Ga0495660_0002754_9591_10085 163
371 3300046810 Ga0495660_0010564 Ga0495660_0010564_1133_1624 163
372 3300046810 Ga0495660_0011163 Ga0495660_0011163_3565_4056 163
373 3300046810 Ga0495660_0019760 Ga0495660_0019760_1032_1538 163
374 3300046810 Ga0495660_0179373 Ga0495660_0179373_192_686 163
375 3300047319 Ga0495674_0018866 Ga0495674_0018866_4808_5302 163
376 3300047320 Ga0495672_0000385 Ga0495672_0000385_27150_27641 163
377 3300047320 Ga0495672_0025986 Ga0495672_0025986_637_1134 163
378 3300047321 Ga0495676_0014203 Ga0495676_0014203_287_781 163
379 3300047323 Ga0495683_0041045 Ga0495683_0041045_91_585 163
380 3300047323 Ga0495683_0168747 Ga0495683_0168747_494_985 163
381 3300047443 Ga0495687_001879 Ga0495687_001879_17060_17566 163
382 3300047443 Ga0495687_002599 Ga0495687_002599_13093_13599 163
383 3300047445 Ga0495677_0106011 Ga0495677_0106011_396_902 163
384 3300047469 Ga0495673_0000027 Ga0495673_0000027_450335_450826 163
385 3300047469 Ga0495673_0000135 Ga0495673_0000135_24222_24713 163
386 3300047469 Ga0495673_0000252 Ga0495673_0000252_48735_49229 163
387 3300047470 Ga0495681_0003455 Ga0495681_0003455_9818_10309 163
388 3300047470 Ga0495681_0100888 Ga0495681_0100888_230_721 163
389 3300047472 Ga0495686_0002546 Ga0495686_0002546_10528_11019 163
390 3300047472 Ga0495686_0071718 Ga0495686_0071718_399_893 163
391 3300047472 Ga0495686_0161920 Ga0495686_0161920_60_551 163
392 3300048913 Ga0496110_0497668 Ga0496110_0497668_300_791 163
393 3300048914 Ga0496111_0072028 Ga0496111_0072028_1289_1795 163
394 3300048914 Ga0496111_0544987 Ga0496111_0544987_62_553 163
395 3300048917 Ga0496114_0396451 Ga0496114_0396451_659_1150 163
396 3300048919 Ga0496116_0036249 Ga0496116_0036249_958_1449 163
397 3300048919 Ga0496116_0068271 Ga0496116_0068271_56_625 163
398 3300048920 Ga0496117_0000010 Ga0496117_0000010_253660_254166 163
399 3300048921 Ga0496118_0000009 Ga0496118_0000009_357789_358295 163
400 3300048921 Ga0496118_0167798 Ga0496118_0167798_750_1241 163
401 3300048923 Ga0496120_0073717 Ga0496120_0073717_414_905 163
402 3300048924 Ga0496121_0006221 Ga0496121_0006221_8223_8729 163
403 3300048924 Ga0496121_0009876 Ga0496121_0009876_636_1142 163
404 3300048924 Ga0496121_0060279 Ga0496121_0060279_906_1397 163
405 3300048925 Ga0496122_0002186 Ga0496122_0002186_15356_15862 163
406 3300048925 Ga0496122_0462267 Ga0496122_0462267_22_513 163
407 3300048926 Ga0496123_0002612 Ga0496123_0002612_2674_3165 163
408 3300048926 Ga0496123_0002764 Ga0496123_0002764_13206_13712 163
409 3300048927 Ga0496124_0015387 Ga0496124_0015387_2135_2626 163
410 3300048927 Ga0496124_0064342 Ga0496124_0064342_1185_1676 163
411 3300048927 Ga0496124_0133411 Ga0496124_0133411_769_1260 163
412 3300048928 Ga0496125_0050377 Ga0496125_0050377_1527_2033 163
413 3300048928 Ga0496125_0189674 Ga0496125_0189674_68_559 163
414 3300048929 Ga0496126_0007014 Ga0496126_0007014_4310_4801 163
415 3300049459 Ga0495678_000001 Ga0495678_000001_836409_836900 163
416 3300049459 Ga0495678_002536 Ga0495678_002536_6579_7070 163
417 3300049459 Ga0495678_031794 Ga0495678_031794_105_611 163
418 3300049460 Ga0495682_0003855 Ga0495682_0003855_5021_5530 163
419 3300049679 Ga0501249_001893 Ga0501249_001893_304_795 163
420 3300049766 Ga0501269_000335 Ga0501269_000335_1085_1576 163
421 3300050507 nmdc:mga05p37_198873_c1 nmdc:mga05p37_198873_c1_1782_2294 163
422 3300050515 nmdc:mga0a205_169177_c1 nmdc:mga0a205_169177_c1_297_809 163
423 3300053085 Ga0495619_0344204 Ga0495619_0344204_349_903 163
424 3300053105 Ga0500557_226434 Ga0500557_226434_77_568 163
425 3300053125 Ga0500618_000248 Ga0500618_000248_12120_12611 163
426 3300053136 Ga0500559_0283482 Ga0500559_0283482_238_729 163
427 3300053145 Ga0500586_000075 Ga0500586_000075_9417_9908 163
428 3300053145 Ga0500586_015254 Ga0500586_015254_148_642 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

84

172

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

48

166

0.87

PF08445

FR47

FR47-like protein

102

177

0.87

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

78

165

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fe7-assembly1.cif.gz_B the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9631 6 160
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.9548 7 160
2fe7-assembly1.cif.gz_A the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa 0.937 7 160
7zkt-assembly3.cif.gz_F moss spermine/spermidine acetyl transferase (ppssat) in complex with coa and lysine 0.9337 6 157
7zhc-assembly1.cif.gz_B moss spermine/spermidine acetyl transferase (ppssat) in complex with acetylcoa and polyethylen glycol 0.9307 6 157
ID Description Score Start End Superfamily
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9759 4 161 3.40.630.30
af_P79081_1_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9581 6 163 3.40.630.30
2fe7A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9548 7 160 3.40.630.30
af_A4ICI2_5_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9423 6 152 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9408 4 161 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7I7PG00-F1-model_v4 N-acetyltransferase GCN5 0.9877 6 126 GO:0008080
AF-A0A1F4I937-F1-model_v4 GNAT family N-acetyltransferase 0.9875 6 160 GO:0008080
AF-A0A6J6VE11-F1-model_v4 Unannotated protein 0.9872 7 160 GO:0008080
AF-A0A837VEI5-F1-model_v4 deleted 0.9824 6 161
AF-A0A2D4ZC05-F1-model_v4 deleted 0.9823 7 160

Feature Viewer

pLDDT pTM Quality
92.81 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map