metagRoot

F441779

General Info

Members	Datasets	Scaffolds	Average Seq Length
428	296	428	326

Family's Representative Sequence

Representative Sequence	3300050507\|nmdc:mga05p37_169642_c1\|nmdc:mga05p37_169642_c1_384_1439
Length	351
Sequence	VKHLTVNEIAVRFGGRFATTGAIMLTRRSLIAGASLGCLLPSASRAAAQSYPTQTIRIIAGFPAGGGIDLVARLLAEPFKTMGQPVIVENRTGAAGMIAAQAVAKAPADGYMLLMATSGEIAISHHLYKEKMAYDPMGELAPVALVGIVPCVVVVAETTPVRTPQELIAYTKANPRKLSFSSSGVGNPQQLAGELMNIMAGTDVLHVPYRGAAPAVADVATGAVTMSFASLAAALPLIEAGKLRAVAVTSLERMPQLPDVAPLQEGAPGLKGYELLNWFGLFATGGTPASIIARLNGIANKTLQEPSTVALLMKQGIIPRPLSSAEYRSFVLSESEKFAKVIDQAKIKPEG

Samples

	Sample ID	Description	Type	Environment
1	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
2	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
3	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
4	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
7	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
8	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
9	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
10	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
17	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
18	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
30	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
31	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
32	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
33	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
34	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
35	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
36	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
37	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
38	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
39	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
40	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
41	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
42	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
43	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
44	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
50	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
59	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
60	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
61	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
62	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
63	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
64	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
65	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
66	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
67	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
68	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
69	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
70	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
71	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
72	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
74	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
75	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
76	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
77	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
78	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
79	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
80	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
81	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
84	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
89	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
90	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
91	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
97	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
98	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
143	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
144	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
148	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
149	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
150	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
151	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
152	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
153	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
154	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
155	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
156	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
157	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
158	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
159	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
160	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
161	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
162	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
163	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
164	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
165	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
166	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
167	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
168	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
169	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
170	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
171	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
172	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
173	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
174	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
175	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
176	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
177	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
178	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
179	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
180	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
181	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
182	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
183	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
184	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
185	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
186	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
187	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
188	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
189	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
190	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
191	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
192	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
193	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
194	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
195	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
196	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
197	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
198	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
199	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
200	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
201	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
202	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
203	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
204	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
205	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
206	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
207	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
208	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
209	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
210	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
211	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
212	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
213	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
214	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
215	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
216	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
217	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
218	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
219	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
220	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
221	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
222	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
223	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
224	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
225	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
226	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
227	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
228	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
229	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
230	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
231	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
232	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
233	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
234	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
235	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
236	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
237	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
238	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
239	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
240	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
241	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
242	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
243	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
244	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
245	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
246	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
247	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
248	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
249	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
250	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
251	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
252	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
253	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
254	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
255	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
256	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
258	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
260	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
261	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
262	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
263	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
264	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
265	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
266	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
269	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
270	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
271	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
272	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
273	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
274	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
275	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
276	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
277	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
278	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
279	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
280	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
281	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
282	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
283	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
284	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
285	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
286	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
287	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
288	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
289	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
290	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
291	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
292	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
293	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
294	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
295	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
296	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.84
Nodule	0
Rhizoplane	5.61
Rhizosphere	88.32
Stem	0
Stem Tuber	0
Unclassified	0.23

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	ARSoilYngRDRAFT_c00285	3300000042	Bacteria	7442
2	ARSoilOldRDRAFT_c000264	3300000044	Bacteria	7510
3	ARCol0oldRDRAFT_c00257	3300000045	Bacteria	5037
4	ARCol0yngRDRAFT_1000034	3300000652	Bacteria	23733
5	JGI24737J22298_10006975	3300001990	Bacteria	3830
6	JGI25153J46596_10017951	3300003215	Bacteria	2766
7	JGI25405J52794_10009486	3300003911	Bacteria	1838
8	Ga0065712_10119657	3300005290	Unclassified	1676
9	Ga0065712_10147479	3300005290	Bacteria	1396
10	Ga0070658_10171637	3300005327	Bacteria	1822
11	Ga0070683_100150753	3300005329	Bacteria	2204
12	Ga0070670_100060496	3300005331	Bacteria	3252
13	Ga0070670_100069449	3300005331	Bacteria	3024
14	Ga0068869_100090317	3300005334	Bacteria	2302
15	Ga0070666_10069023	3300005335	Bacteria	2402
16	Ga0070682_100131093	3300005337	Bacteria	1697
17	Ga0068868_100016130	3300005338	Bacteria	5541
18	Ga0068868_100018747	3300005338	Bacteria	5176
19	Ga0070689_100100233	3300005340	Bacteria	2291
20	Ga0070689_100122745	3300005340	Bacteria	2076
21	Ga0070689_100130699	3300005340	Bacteria	2013
22	Ga0070689_100182635	3300005340	Bacteria	1704
23	Ga0070691_10068386	3300005341	Bacteria	1719
24	Ga0070687_100020324	3300005343	Bacteria	3103
25	Ga0070661_100057734	3300005344	Unclassified	2843
26	Ga0070668_100098185	3300005347	Bacteria	2317
27	Ga0070668_100120161	3300005347	Bacteria	2099
28	Ga0070669_100062445	3300005353	Bacteria	2739
29	Ga0070675_100005893	3300005354	Bacteria	9391
30	Ga0070675_100321264	3300005354	Bacteria	1367
31	Ga0070671_100020376	3300005355	Bacteria	5407
32	Ga0070671_100028755	3300005355	Bacteria	4580
33	Ga0070674_100019468	3300005356	Bacteria	4312
34	Ga0070673_100051440	3300005364	Bacteria	3227
35	Ga0070673_100213120	3300005364	Bacteria	1669
36	Ga0070673_100346280	3300005364	Bacteria	1318
37	Ga0070688_100027545	3300005365	Bacteria	3385
38	Ga0070688_100134455	3300005365	Bacteria	1672
39	Ga0070659_100013416	3300005366	Bacteria	6098
40	Ga0070667_100142143	3300005367	Bacteria	2102
41	Ga0070709_10227679	3300005434	Bacteria	1332
42	Ga0070714_100017605	3300005435	Bacteria	5791
43	Ga0070713_100013256	3300005436	Bacteria	6078
44	Ga0070701_10003764	3300005438	Bacteria	6059
45	Ga0070711_100032052	3300005439	Bacteria	3491
46	Ga0070705_100093428	3300005440	Bacteria	1880
47	Ga0070700_100072489	3300005441	Bacteria	2202
48	Ga0070694_100023686	3300005444	Bacteria	3952
49	Ga0070663_100051972	3300005455	Bacteria	2921
50	Ga0070663_100118789	3300005455	Bacteria	1995
51	Ga0070678_100029626	3300005456	Bacteria	3750
52	Ga0070678_100098242	3300005456	Unclassified	2263
53	Ga0070678_100233168	3300005456	Bacteria	1535
54	Ga0070662_100033115	3300005457	Bacteria	3637
55	Ga0070662_100036782	3300005457	Bacteria	3466
56	Ga0070681_10185725	3300005458	Bacteria	1999
57	Ga0068867_100099942	3300005459	Bacteria	2214
58	Ga0068867_100203119	3300005459	Bacteria	1587
59	Ga0070685_10102675	3300005466	Bacteria	1748
60	Ga0070698_100348680	3300005471	Bacteria	1412
61	Ga0070684_100073096	3300005535	Bacteria	3021
62	Ga0070684_100110312	3300005535	Unclassified	2467
63	Ga0070684_100115926	3300005535	Bacteria	2406
64	Ga0068853_100109769	3300005539	Bacteria	2449
65	Ga0070672_100033284	3300005543	Bacteria	3901
66	Ga0070672_100093386	3300005543	Bacteria	2430
67	Ga0070672_100215919	3300005543	Bacteria	1608
68	Ga0070686_100052086	3300005544	Bacteria	2608
69	Ga0070695_100054286	3300005545	Bacteria	2578
70	Ga0070696_100027672	3300005546	Bacteria	3865
71	Ga0070693_100005990	3300005547	Bacteria	5879
72	Ga0068855_100234512	3300005563	Bacteria	2052
73	Ga0068854_100012380	3300005578	Bacteria	5584
74	Ga0068852_100016330	3300005616	Bacteria	5784
75	Ga0068852_100084344	3300005616	Unclassified	2827
76	Ga0068852_100220692	3300005616	Bacteria	1803
77	Ga0068859_100032685	3300005617	Bacteria	5226
78	Ga0068859_100267766	3300005617	Bacteria	1800
79	Ga0068864_100009619	3300005618	Bacteria	7973
80	Ga0068851_10041029	3300005834	Unclassified	2327
81	Ga0068863_100017555	3300005841	Bacteria	6857
82	Ga0068860_100125617	3300005843	Bacteria	2458
83	Ga0068862_100004105	3300005844	Bacteria	12346
84	Ga0068862_100364750	3300005844	Bacteria	1343
85	Ga0081455_10000237	3300005937	Bacteria	71335
86	Ga0081455_10001351	3300005937	Bacteria	30344
87	Ga0081455_10052290	3300005937	Bacteria	3498
88	Ga0081455_10247152	3300005937	Bacteria	1307
89	Ga0081540_1020893	3300005983	Bacteria	3920
90	Ga0070717_10005794	3300006028	Bacteria	9047
91	Ga0075368_10020575	3300006042	Bacteria	2500
92	Ga0075368_10038160	3300006042	Bacteria	1880
93	Ga0075363_100206481	3300006048	Bacteria	1123
94	Ga0075432_10010154	3300006058	Bacteria	3195
95	Ga0070716_100021457	3300006173	Bacteria	3404
96	Ga0070712_100228021	3300006175	Bacteria	1478
97	Ga0075362_10040763	3300006177	Bacteria	2046
98	Ga0075367_10133343	3300006178	Bacteria	1536
99	Ga0075369_10006562	3300006186	Bacteria	4402
100	Ga0075366_10004543	3300006195	Bacteria	7451
101	Ga0075366_10035135	3300006195	Bacteria	2955
102	Ga0075366_10161833	3300006195	Bacteria	1356
103	Ga0097621_100043576	3300006237	Bacteria	3617
104	Ga0097621_100212909	3300006237	Unclassified	1681
105	Ga0075370_10085911	3300006353	Bacteria	1812
106	Ga0068871_100042547	3300006358	Bacteria	3647
107	Ga0068871_100117265	3300006358	Unclassified	2245
108	Ga0075428_100110485	3300006844	Bacteria	2995
109	Ga0075430_100012390	3300006846	Bacteria	7254
110	Ga0075430_100035210	3300006846	Bacteria	4248
111	Ga0075431_100000867	3300006847	Bacteria	26566
112	Ga0075433_10002474	3300006852	Bacteria	14058
113	Ga0075429_100104020	3300006880	Unclassified	2480
114	Ga0068865_100259282	3300006881	Bacteria	1376
115	Ga0075436_100049476	3300006914	Bacteria	2900
116	Ga0097620_100032683	3300006931	Bacteria	5226
117	Ga0097620_100267761	3300006931	Bacteria	1800
118	Ga0075435_100001554	3300007076	Bacteria	14808
119	Ga0075435_100228023	3300007076	Bacteria	1582
120	Ga0111539_10000527	3300009094	Bacteria	48473
121	Ga0111539_10041599	3300009094	Bacteria	5523
122	Ga0111539_10500503	3300009094	Bacteria	1415
123	Ga0105243_10024175	3300009148	Bacteria	4634
124	Ga0105243_10154188	3300009148	Bacteria	1974
125	Ga0105242_10047936	3300009176	Bacteria	3471
126	Ga0105248_10198202	3300009177	Bacteria	2262
127	Ga0105248_10305877	3300009177	Unclassified	1790
128	Ga0105238_10178760	3300009551	Bacteria	2099
129	Ga0157338_1000667	3300012515	Bacteria	2139
130	Ga0157371_10225769	3300013102	Bacteria	1345
131	Ga0157370_10172442	3300013104	Bacteria	2011
132	Ga0157378_10017615	3300013297	Bacteria	6272
133	Ga0163162_10290417	3300013306	Bacteria	1767
134	Ga0163162_10353784	3300013306	Bacteria	1601
135	Ga0157372_10259898	3300013307	Bacteria	2016
136	Ga0157375_10014198	3300013308	Bacteria	7101
137	Ga0157375_10285895	3300013308	Bacteria	1812
138	Ga0157375_10288650	3300013308	Bacteria	1803
139	Ga0157377_10114453	3300014745	Bacteria	1626
140	Ga0157376_10041195	3300014969	Bacteria	3780
141	Ga0157376_10057688	3300014969	Bacteria	3249
142	Ga0157376_10284898	3300014969	Bacteria	1558
143	Ga0157376_10304884	3300014969	Bacteria	1509
144	Ga0209758_1001345	3300025297	Bacteria	29653
145	Ga0207697_10003964	3300025315	Bacteria	7195
146	Ga0207697_10028758	3300025315	Bacteria	2274
147	Ga0207682_10002501	3300025893	Bacteria	8214
148	Ga0207642_10059976	3300025899	Bacteria	1762
149	Ga0207647_10007434	3300025904	Bacteria	7914
150	Ga0207645_10085090	3300025907	Bacteria	2030
151	Ga0207705_10015442	3300025909	Bacteria	5480
152	Ga0207705_10156684	3300025909	Unclassified	1709
153	Ga0207671_10141723	3300025914	Bacteria	1852
154	Ga0207693_10003392	3300025915	Bacteria	13609
155	Ga0207693_10027650	3300025915	Bacteria	4483
156	Ga0207693_10222523	3300025915	Bacteria	1483
157	Ga0207663_10236937	3300025916	Bacteria	1336
158	Ga0207662_10014496	3300025918	Bacteria	4426
159	Ga0207662_10029325	3300025918	Bacteria	3187
160	Ga0207657_10117781	3300025919	Bacteria	2187
161	Ga0207657_10160835	3300025919	Bacteria	1824
162	Ga0207649_10037611	3300025920	Bacteria	2924
163	Ga0207681_10055188	3300025923	Bacteria	2705
164	Ga0207694_10033312	3300025924	Bacteria	3947
165	Ga0207650_10009804	3300025925	Bacteria	6549
166	Ga0207700_10014221	3300025928	Bacteria	5208
167	Ga0207644_10322917	3300025931	Bacteria	1248
168	Ga0207706_10028808	3300025933	Bacteria	4957
169	Ga0207706_10129460	3300025933	Bacteria	2220
170	Ga0207709_10017396	3300025935	Bacteria	4013
171	Ga0207709_10191470	3300025935	Bacteria	1453
172	Ga0207670_10111499	3300025936	Bacteria	1972
173	Ga0207670_10120148	3300025936	Bacteria	1909
174	Ga0207669_10099760	3300025937	Bacteria	1916
175	Ga0207669_10202451	3300025937	Bacteria	1442
176	Ga0207704_10038754	3300025938	Bacteria	2768
177	Ga0207704_10177718	3300025938	Bacteria	1534
178	Ga0207665_10037188	3300025939	Bacteria	3240
179	Ga0207691_10051305	3300025940	Bacteria	3773
180	Ga0207691_10059595	3300025940	Bacteria	3471
181	Ga0207689_10052597	3300025942	Bacteria	3355
182	Ga0207661_10261020	3300025944	Bacteria	1543
183	Ga0207667_10030324	3300025949	Bacteria	5852
184	Ga0207651_10033358	3300025960	Bacteria	3320
185	Ga0207712_10034551	3300025961	Bacteria	3427
186	Ga0207668_10051772	3300025972	Bacteria	2838
187	Ga0207658_10222154	3300025986	Bacteria	1590
188	Ga0207703_10195159	3300026035	Bacteria	1796
189	Ga0207639_10280403	3300026041	Bacteria	1465
190	Ga0207678_10071677	3300026067	Bacteria	2971
191	Ga0207678_10350902	3300026067	Bacteria	1272
192	Ga0207708_10007296	3300026075	Bacteria	8176
193	Ga0207708_10025604	3300026075	Bacteria	4465
194	Ga0207708_10073052	3300026075	Bacteria	2629
195	Ga0207641_10022095	3300026088	Bacteria	5234
196	Ga0207648_10006078	3300026089	Bacteria	12038
197	Ga0207648_10042645	3300026089	Bacteria	3983
198	Ga0207676_10002995	3300026095	Bacteria	12043
199	Ga0207676_10335171	3300026095	Bacteria	1393
200	Ga0207674_10452450	3300026116	Bacteria	1241
201	Ga0207675_100056402	3300026118	Bacteria	3664
202	Ga0207675_100238279	3300026118	Bacteria	1757
203	Ga0207683_10017584	3300026121	Bacteria	6097
204	Ga0207683_10035623	3300026121	Bacteria	4329
205	Ga0207683_10196996	3300026121	Bacteria	1830
206	Ga0207698_10036923	3300026142	Bacteria	3593
207	Ga0207698_10204185	3300026142	Bacteria	1772
208	Ga0209966_1004215	3300027695	Bacteria	2434
209	Ga0209813_10051551	3300027866	Bacteria	1288
210	Ga0207428_10000124	3300027907	Bacteria	105795
211	Ga0207428_10051858	3300027907	Bacteria	3278
212	Ga0207428_10155601	3300027907	Bacteria	1739
213	Ga0268266_10035045	3300028379	Bacteria	4268
214	Ga0268265_10092111	3300028380	Bacteria	2425
215	Ga0268264_10061242	3300028381	Bacteria	3156
216	Ga0265318_10026005	3300028577	Bacteria	2307
217	Ga0265338_10068636	3300028800	Bacteria	3052
218	Ga0265328_10000361	3300031239	Bacteria	21322
219	Ga0265325_10031859	3300031241	Bacteria	2818
220	Ga0265329_10005351	3300031242	Bacteria	5198
221	Ga0265340_10106185	3300031247	Bacteria	1301
222	Ga0265339_10095748	3300031249	Bacteria	1550
223	Ga0265331_10001401	3300031250	Bacteria	17695
224	Ga0265314_10000660	3300031711	Bacteria	42242
225	Ga0265314_10011017	3300031711	Bacteria	7498
226	Ga0265342_10028016	3300031712	Bacteria	3514
227	Ga0307405_10061516	3300031731	Bacteria	2374
228	Ga0307410_10108980	3300031852	Bacteria	2001
229	Ga0307411_10261548	3300032005	Bacteria	1367
230	Ga0373948_0000067	3300034817	Bacteria	10961
231	Ga0373950_0003655	3300034818	Bacteria	2213
232	Ga0373958_0007611	3300034819	Bacteria	1733
233	Ga0373938_0008272	3300034957	Bacteria	1854
234	Ga0373938_0039911	3300034957	Bacteria	1039
235	Ga0373940_0032519	3300035088	Bacteria	1398
236	Ga0373940_0043313	3300035088	Bacteria	1243
237	Ga0373949_0002305	3300035090	Bacteria	4963
238	Ga0373951_0012281	3300035091	Bacteria	1926
239	Ga0373952_0002130	3300035092	Bacteria	3557
240	Ga0373939_0002156	3300035114	Bacteria	4673
241	Ga0373939_0003364	3300035114	Bacteria	3754
242	Ga0373945_0066499	3300035116	Bacteria	1355
243	Ga0373953_0014761	3300035117	Bacteria	2817
244	Ga0373956_0035272	3300035119	Bacteria	2205
245	Ga0373943_0049713	3300035170	Bacteria	2058
246	Ga0373946_0022178	3300035171	Bacteria	2469
247	Ga0373946_0132874	3300035171	Bacteria	1146
248	Ga0373955_0003754	3300035172	Bacteria	6690
249	Ga0373955_0049079	3300035172	Bacteria	2291
250	Ga0373955_0276675	3300035172	Bacteria	1009
251	Ga0373942_0008186	3300035207	Bacteria	2432
252	Ga0373961_0013511	3300035241	Bacteria	2060
253	Ga0373962_0053270	3300035242	Bacteria	1170
254	Ga0373924_0020807	3300035410	Bacteria	2553
255	Ga0373924_0025460	3300035410	Bacteria	2340
256	Ga0373931_0010301	3300035691	Bacteria	4492
257	Ga0373927_0033939	3300035695	Bacteria	3320
258	Ga0373933_0005164	3300035724	Bacteria	7124
259	Ga0373947_0008683	3300035725	Bacteria	5847
260	Ga0373947_0066480	3300035725	Bacteria	2200
261	Ga0373937_0003541	3300036401	Bacteria	13147
262	Ga0373925_0047557	3300037068	Bacteria	3193
263	Ga0373925_0069120	3300037068	Bacteria	2667
264	Ga0395901_0204857	3300038443	Bacteria	2067
265	Ga0436365_0539632	3300039437	Bacteria	5194
266	Ga0466963_0168532	3300044694	Bacteria	1526
267	Ga0466963_0202525	3300044694	Bacteria	1388
268	Ga0453684_0124335	3300044712	Bacteria	3108
269	Ga0451576_0169118	3300045051	Bacteria	2281
270	Ga0466967_0303391	3300045976	Bacteria	1537
271	Ga0495592_0044311	3300046454	Bacteria	3325
272	Ga0495629_0002798	3300046459	Bacteria	13303
273	Ga0495641_0041398	3300046461	Bacteria	2140
274	Ga0495653_0020398	3300046463	Bacteria	5373
275	Ga0495653_0125194	3300046463	Bacteria	1826
276	Ga0495653_0278359	3300046463	Bacteria	1099
277	Ga0495580_0018697	3300046472	Bacteria	5157
278	Ga0495580_0033333	3300046472	Bacteria	3713
279	Ga0495582_0004712	3300046473	Bacteria	7665
280	Ga0495582_0008539	3300046473	Bacteria	5650
281	Ga0495605_0084226	3300046474	Bacteria	1483
282	Ga0495639_0009233	3300046475	Bacteria	4226
283	Ga0495662_0080825	3300046476	Bacteria	1580
284	Ga0495664_0095002	3300046477	Bacteria	1795
285	Ga0495664_0174849	3300046477	Bacteria	1302
286	Ga0495584_0035673	3300046491	Bacteria	2513
287	Ga0495585_0102042	3300046492	Bacteria	1533
288	Ga0495594_0078828	3300046499	Bacteria	1838
289	Ga0495607_0016993	3300046501	Bacteria	4684
290	Ga0495608_0050938	3300046511	Bacteria	2746
291	Ga0495608_0094991	3300046511	Bacteria	1926
292	Ga0495608_0235416	3300046511	Bacteria	1145
293	Ga0495618_0027620	3300046514	Bacteria	3532
294	Ga0495644_0002123	3300046523	Bacteria	7962
295	Ga0495666_0121947	3300046526	Bacteria	1220
296	Ga0495652_0098495	3300046529	Bacteria	2376
297	Ga0495665_0038182	3300046531	Bacteria	2561
298	Ga0495586_0029557	3300046535	Bacteria	2933
299	Ga0495587_0041786	3300046536	Bacteria	2735
300	Ga0495609_0045393	3300046538	Bacteria	1969
301	Ga0495633_0002652	3300046558	Bacteria	12452
302	Ga0495667_0024120	3300046559	Bacteria	4097
303	Ga0495667_0029298	3300046559	Bacteria	3705
304	Ga0495667_0088929	3300046559	Bacteria	2002
305	Ga0495635_0014348	3300046663	Bacteria	5542
306	Ga0495659_0026784	3300046664	Bacteria	1984
307	Ga0495661_0169522	3300046665	Bacteria	1165
308	Ga0495588_0122918	3300046674	Bacteria	1368
309	Ga0495657_0046055	3300046675	Bacteria	2956
310	Ga0495599_0164619	3300046678	Bacteria	1370
311	Ga0495599_0208676	3300046678	Bacteria	1198
312	Ga0495646_0123031	3300046680	Bacteria	1466
313	Ga0495647_0009424	3300046681	Bacteria	3308
314	Ga0495647_0024115	3300046681	Bacteria	2212
315	Ga0495658_0006386	3300046683	Bacteria	5791
316	Ga0495658_0020154	3300046683	Bacteria	3495
317	Ga0495658_0054801	3300046683	Bacteria	2269
318	Ga0495669_0187839	3300046684	Unclassified	986
319	Ga0495613_0014073	3300046689	Bacteria	5937
320	Ga0495613_0191896	3300046689	Bacteria	1443
321	Ga0495624_0053942	3300046690	Bacteria	2536
322	Ga0495670_0010119	3300046691	Bacteria	4640
323	Ga0495589_0052958	3300046794	Bacteria	2004
324	Ga0495600_0048601	3300046809	Bacteria	2767
325	Ga0495581_0014878	3300047315	Bacteria	4513
326	Ga0495581_0057888	3300047315	Bacteria	2237
327	Ga0495604_0021498	3300047317	Bacteria	5150
328	Ga0495604_0025948	3300047317	Bacteria	4667
329	Ga0495674_0079861	3300047319	Bacteria	2808
330	Ga0495672_0098053	3300047320	Bacteria	1595
331	Ga0495676_0123641	3300047321	Bacteria	1878
332	Ga0495680_0045744	3300047322	Bacteria	3455
333	Ga0495680_0084895	3300047322	Bacteria	2385
334	Ga0495680_0203709	3300047322	Bacteria	1418
335	Ga0495675_0123956	3300047444	Bacteria	1608
336	Ga0495675_0184299	3300047444	Bacteria	1277
337	Ga0495684_0010102	3300047471	Bacteria	7299
338	Ga0495684_0104593	3300047471	Bacteria	2139
339	Ga0495593_0017106	3300047673	Bacteria	4081
340	Ga0495593_0042047	3300047673	Bacteria	2454
341	Ga0495602_0021227	3300048088	Bacteria	6399
342	Ga0495614_0052748	3300048089	Bacteria	1743
343	Ga0495614_0098049	3300048089	Bacteria	1279
344	Ga0496100_0090689	3300048903	Bacteria	2084
345	Ga0496101_0032508	3300048904	Bacteria	3673
346	Ga0496102_0009166	3300048905	Bacteria	8490
347	Ga0496102_0057309	3300048905	Bacteria	3557
348	Ga0496103_0006282	3300048906	Bacteria	7105
349	Ga0496104_0032399	3300048907	Bacteria	4863
350	Ga0496105_0000273	3300048908	Bacteria	34154
351	Ga0496106_0003237	3300048909	Bacteria	12179
352	Ga0496106_0199710	3300048909	Bacteria	1591
353	Ga0496108_0004160	3300048911	Bacteria	11644
354	Ga0496108_0030008	3300048911	Bacteria	4506
355	Ga0496108_0169592	3300048911	Bacteria	1888
356	Ga0496108_0194258	3300048911	Bacteria	1760
357	Ga0496109_0037927	3300048912	Bacteria	4355
358	Ga0496109_0454401	3300048912	Bacteria	1210
359	Ga0496110_0023381	3300048913	Bacteria	5255
360	Ga0496110_0025810	3300048913	Bacteria	5023
361	Ga0496110_0413532	3300048913	Bacteria	1230
362	Ga0496110_0416162	3300048913	Bacteria	1225
363	Ga0496111_0033398	3300048914	Bacteria	3669
364	Ga0496111_0241099	3300048914	Unclassified	1343
365	Ga0496112_0129405	3300048915	Bacteria	2495
366	Ga0496114_0002383	3300048917	Bacteria	14295
367	Ga0496115_0030762	3300048918	Bacteria	4225
368	Ga0501031_0025836	3300049568	Bacteria	3831
369	Ga0501034_0031045	3300049571	Bacteria	5430
370	Ga0501034_0125111	3300049571	Bacteria	2556
371	Ga0501037_0146791	3300049573	Bacteria	1687
372	Ga0501040_0135933	3300049576	Bacteria	1731
373	Ga0501041_0243729	3300049577	Bacteria	1130
374	Ga0501043_0278395	3300049579	Bacteria	1283
375	Ga0501046_0198646	3300049580	Bacteria	1493
376	Ga0501048_0098314	3300049582	Bacteria	2065
377	Ga0501069_0127900	3300049585	Bacteria	1454
378	Ga0501070_0126790	3300049586	Bacteria	2109
379	Ga0501071_0043511	3300049587	Bacteria	3220
380	Ga0501072_0022242	3300049588	Bacteria	4919
381	Ga0501075_0053040	3300049591	Bacteria	3049
382	Ga0501076_0128724	3300049592	Bacteria	2052
383	Ga0501079_0031368	3300049741	Bacteria	4084
384	Ga0501079_0213626	3300049741	Bacteria	1507
385	Ga0501080_0163044	3300049742	Bacteria	2058
386	Ga0501083_0016271	3300049744	Bacteria	5208
387	nmdc:mga03683_7614_c1	3300050489	Bacteria	3768
388	nmdc:mga03n38_65567_c1	3300050490	Bacteria	1666
389	nmdc:mga00v17_155243_c1	3300050491	Bacteria	1472
390	nmdc:mga00v17_83067_c1	3300050491	Bacteria	2003
391	nmdc:mga0yw44_22963_c1	3300050492	Bacteria	3508
392	nmdc:mga0k408_27479_c1	3300050493	Bacteria	3231
393	nmdc:mga0k408_8543_c1	3300050493	Bacteria	5501
394	nmdc:mga06z11_17923_c1	3300050494	Bacteria	3225
395	nmdc:mga05p37_110526_c1	3300050507	Bacteria	3381
396	nmdc:mga05p37_169642_c1	3300050507	Bacteria	2662
397	nmdc:mga09592_116559_c1	3300050508	Bacteria	2292
398	nmdc:mga09592_233932_c1	3300050508	Bacteria	1592
399	nmdc:mga0qj67_20671_c1	3300050509	Bacteria	5042
400	nmdc:mga0qj67_75504_c1	3300050509	Bacteria	2694
401	nmdc:mga06r32_3769_c1	3300050510	Bacteria	13556
402	nmdc:mga06r32_47526_c1	3300050510	Bacteria	4099
403	nmdc:mga08y16_1374_c1	3300050511	Bacteria	24321
404	nmdc:mga08y16_20573_c1	3300050511	Bacteria	6966
405	nmdc:mga08y16_332241_c1	3300050511	Bacteria	1563
406	nmdc:mga0n895_27254_c1	3300050512	Bacteria	5426
407	nmdc:mga0n895_39699_c1	3300050512	Bacteria	4569
408	nmdc:mga0n895_50774_c1	3300050512	Bacteria	4067
409	nmdc:mga0rr50_4570_c1	3300050513	Bacteria	8146
410	nmdc:mga08x19_60760_c1	3300050514	Bacteria	2448
411	nmdc:mga0a205_1626_c1	3300050515	Bacteria	19318
412	nmdc:mga0sz30_25307_c1	3300050516	Bacteria	2427
413	Ga0495601_0002091	3300053077	Bacteria	11219
414	Ga0495601_0004000	3300053077	Bacteria	8485
415	Ga0495601_0044778	3300053077	Bacteria	2781
416	Ga0495612_0087303	3300053078	Bacteria	1316
417	Ga0495595_0000789	3300053084	Bacteria	12046
418	Ga0495595_0002304	3300053084	Bacteria	7440
419	Ga0495595_0108788	3300053084	Bacteria	1342
420	Ga0495619_0000105	3300053085	Bacteria	62599
421	Ga0495619_0011261	3300053085	Bacteria	5625
422	Ga0495619_0017872	3300053085	Bacteria	4494
423	Ga0500641_0013260	3300053096	Bacteria	3026
424	Ga0500641_0030710	3300053096	Bacteria	2114
425	Ga0500604_0006621	3300053151	Bacteria	3063
426	Ga0501082_0085455	3300060353	Bacteria	2721
427	Ga0501082_0156110	3300060353	Bacteria	1983
428	Ga0530510_0057151	3300061734	Bacteria	2819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005937	Ga0081455_10247152	Ga0081455_102471522	268
2	3300046684	Ga0495669_0187839	Ga0495669_0187839_157_972	271
3	3300005340	Ga0070689_100122745	Ga0070689_1001227453	272
4	3300025923	Ga0207681_10055188	Ga0207681_100551882	288
5	3300045976	Ga0466967_0303391	Ga0466967_0303391_97_996	296
6	3300032005	Ga0307411_10261548	Ga0307411_102615481	297
7	3300047315	Ga0495581_0057888	Ga0495581_0057888_890_1804	302
8	3300026118	Ga0207675_100056402	Ga0207675_1000564023	305
9	3300005331	Ga0070670_100060496	Ga0070670_1000604962	309
10	3300005354	Ga0070675_100005893	Ga0070675_1000058936	309
11	3300005456	Ga0070678_100233168	Ga0070678_1002331682	309
12	3300005459	Ga0068867_100203119	Ga0068867_1002031192	309
13	3300005543	Ga0070672_100093386	Ga0070672_1000933862	309
14	3300005618	Ga0068864_100009619	Ga0068864_1000096195	309
15	3300005841	Ga0068863_100017555	Ga0068863_1000175556	309
16	3300006237	Ga0097621_100043576	Ga0097621_1000435763	309
17	3300013308	Ga0157375_10014198	Ga0157375_100141986	309
18	3300014969	Ga0157376_10041195	Ga0157376_100411953	309
19	3300025918	Ga0207662_10029325	Ga0207662_100293253	309
20	3300025935	Ga0207709_10017396	Ga0207709_100173962	309
21	3300025940	Ga0207691_10051305	Ga0207691_100513054	309
22	3300026095	Ga0207676_10002995	Ga0207676_100029957	309
23	3300026121	Ga0207683_10196996	Ga0207683_101969962	309
24	3300048913	Ga0496110_0416162	Ga0496110_0416162_35_1015	309
25	3300005329	Ga0070683_100150753	Ga0070683_1001507533	312
26	3300005535	Ga0070684_100073096	Ga0070684_1000730962	312
27	3300005331	Ga0070670_100069449	Ga0070670_1000694492	315
28	3300005338	Ga0068868_100018747	Ga0068868_1000187476	315
29	3300005356	Ga0070674_100019468	Ga0070674_1000194682	315
30	3300005535	Ga0070684_100110312	Ga0070684_1001103122	315
31	3300009177	Ga0105248_10305877	Ga0105248_103058772	315
32	3300048911	Ga0496108_0004160	Ga0496108_0004160_3182_4135	315
33	3300048913	Ga0496110_0023381	Ga0496110_0023381_809_1762	315
34	3300050493	nmdc:mga0k408_27479_c1	nmdc:mga0k408_27479_c1_1018_1974	316
35	3300005340	Ga0070689_100182635	Ga0070689_1001826351	317
36	3300005347	Ga0070668_100098185	Ga0070668_1000981852	317
37	3300005354	Ga0070675_100321264	Ga0070675_1003212641	317
38	3300005367	Ga0070667_100142143	Ga0070667_1001421432	317
39	3300005457	Ga0070662_100036782	Ga0070662_1000367822	317
40	3300005617	Ga0068859_100267766	Ga0068859_1002677662	317
41	3300006931	Ga0097620_100267761	Ga0097620_1002677612	317
42	3300014969	Ga0157376_10284898	Ga0157376_102848981	317
43	3300025315	Ga0207697_10003964	Ga0207697_100039642	317
44	3300025893	Ga0207682_10002501	Ga0207682_100025018	317
45	3300025931	Ga0207644_10322917	Ga0207644_103229171	317
46	3300025933	Ga0207706_10028808	Ga0207706_100288082	317
47	3300025936	Ga0207670_10111499	Ga0207670_101114992	317
48	3300025942	Ga0207689_10052597	Ga0207689_100525972	317
49	3300026075	Ga0207708_10025604	Ga0207708_100256042	317
50	3300026089	Ga0207648_10006078	Ga0207648_100060784	317
51	3300026095	Ga0207676_10335171	Ga0207676_103351711	317
52	3300026067	Ga0207678_10350902	Ga0207678_103509022	318
53	3300046683	Ga0495658_0020154	Ga0495658_0020154_1464_2444	319
54	3300047320	Ga0495672_0098053	Ga0495672_0098053_277_1236	319
55	3300048911	Ga0496108_0194258	Ga0496108_0194258_218_1180	319
56	3300048913	Ga0496110_0413532	Ga0496110_0413532_227_1189	319
57	3300005834	Ga0068851_10041029	Ga0068851_100410292	320
58	3300013297	Ga0157378_10017615	Ga0157378_100176154	320
59	3300013306	Ga0163162_10353784	Ga0163162_103537842	320
60	3300014969	Ga0157376_10057688	Ga0157376_100576883	320
61	3300014969	Ga0157376_10304884	Ga0157376_103048842	320
62	3300025909	Ga0207705_10156684	Ga0207705_101566842	320
63	3300046472	Ga0495580_0033333	Ga0495580_0033333_850_1812	320
64	3300048914	Ga0496111_0241099	Ga0496111_0241099_235_1203	320
65	3300005441	Ga0070700_100072489	Ga0070700_1000724892	321
66	3300009094	Ga0111539_10041599	Ga0111539_100415992	321
67	3300026075	Ga0207708_10073052	Ga0207708_100730523	321
68	3300031241	Ga0265325_10031859	Ga0265325_100318593	321
69	3300050511	nmdc:mga08y16_20573_c1	nmdc:mga08y16_20573_c1_4489_5463	321
70	3300003215	JGI25153J46596_10017951	JGI25153J46596_100179514	322
71	3300005547	Ga0070693_100005990	Ga0070693_1000059902	322
72	3300006177	Ga0075362_10040763	Ga0075362_100407633	322
73	3300006195	Ga0075366_10004543	Ga0075366_100045437	322
74	3300006195	Ga0075366_10035135	Ga0075366_100351353	322
75	3300006914	Ga0075436_100049476	Ga0075436_1000494763	322
76	3300025297	Ga0209758_1001345	Ga0209758_100134519	322
77	3300028800	Ga0265338_10068636	Ga0265338_100686362	322
78	3300031247	Ga0265340_10106185	Ga0265340_101061852	322
79	3300031249	Ga0265339_10095748	Ga0265339_100957481	322
80	3300031712	Ga0265342_10028016	Ga0265342_100280165	322
81	3300035172	Ga0373955_0276675	Ga0373955_0276675_11_979	322
82	3300046463	Ga0495653_0020398	Ga0495653_0020398_2198_3166	322
83	3300046473	Ga0495582_0008539	Ga0495582_0008539_4410_5378	322
84	3300046475	Ga0495639_0009233	Ga0495639_0009233_36_1004	322
85	3300046476	Ga0495662_0080825	Ga0495662_0080825_388_1356	322
86	3300046514	Ga0495618_0027620	Ga0495618_0027620_416_1384	322
87	3300046529	Ga0495652_0098495	Ga0495652_0098495_247_1215	322
88	3300046531	Ga0495665_0038182	Ga0495665_0038182_590_1558	322
89	3300046663	Ga0495635_0014348	Ga0495635_0014348_3444_4412	322
90	3300046678	Ga0495599_0208676	Ga0495599_0208676_110_1078	322
91	3300046680	Ga0495646_0123031	Ga0495646_0123031_354_1322	322
92	3300046681	Ga0495647_0009424	Ga0495647_0009424_1646_2614	322
93	3300046683	Ga0495658_0054801	Ga0495658_0054801_795_1763	322
94	3300046809	Ga0495600_0048601	Ga0495600_0048601_1139_2107	322
95	3300047317	Ga0495604_0021498	Ga0495604_0021498_3843_4811	322
96	3300047322	Ga0495680_0203709	Ga0495680_0203709_421_1389	322
97	3300047444	Ga0495675_0184299	Ga0495675_0184299_21_989	322
98	3300047673	Ga0495593_0042047	Ga0495593_0042047_374_1342	322
99	3300048089	Ga0495614_0052748	Ga0495614_0052748_726_1694	322
100	3300050489	nmdc:mga03683_7614_c1	nmdc:mga03683_7614_c1_1833_2807	322
101	3300050493	nmdc:mga0k408_8543_c1	nmdc:mga0k408_8543_c1_15_989	322
102	3300050514	nmdc:mga08x19_60760_c1	nmdc:mga08x19_60760_c1_405_1373	322
103	3300053077	Ga0495601_0044778	Ga0495601_0044778_1002_1970	322
104	3300053084	Ga0495595_0002304	Ga0495595_0002304_3444_4412	322
105	3300013308	Ga0157375_10285895	Ga0157375_102858952	323
106	3300025915	Ga0207693_10003392	Ga0207693_100033927	323
107	3300025937	Ga0207669_10202451	Ga0207669_102024512	323
108	3300025938	Ga0207704_10177718	Ga0207704_101777182	323
109	3300046474	Ga0495605_0084226	Ga0495605_0084226_436_1413	323
110	3300047471	Ga0495684_0104593	Ga0495684_0104593_474_1445	323
111	3300005983	Ga0081540_1020893	Ga0081540_10208932	324
112	3300006846	Ga0075430_100012390	Ga0075430_1000123908	324
113	3300006847	Ga0075431_100000867	Ga0075431_10000086718	324
114	3300035117	Ga0373953_0014761	Ga0373953_0014761_1176_2156	324
115	3300035119	Ga0373956_0035272	Ga0373956_0035272_656_1636	324
116	3300035172	Ga0373955_0003754	Ga0373955_0003754_527_1507	324
117	3300035410	Ga0373924_0020807	Ga0373924_0020807_461_1441	324
118	3300035724	Ga0373933_0005164	Ga0373933_0005164_1007_1987	324
119	3300046463	Ga0495653_0125194	Ga0495653_0125194_449_1429	324
120	3300046511	Ga0495608_0094991	Ga0495608_0094991_214_1194	324
121	3300046536	Ga0495587_0041786	Ga0495587_0041786_1015_1995	324
122	3300046559	Ga0495667_0024120	Ga0495667_0024120_2153_3133	324
123	3300046678	Ga0495599_0164619	Ga0495599_0164619_197_1177	324
124	3300047444	Ga0495675_0123956	Ga0495675_0123956_116_1096	324
125	3300048088	Ga0495602_0021227	Ga0495602_0021227_4429_5409	324
126	3300053077	Ga0495601_0004000	Ga0495601_0004000_1579_2559	324
127	3300053078	Ga0495612_0087303	Ga0495612_0087303_294_1274	324
128	3300053084	Ga0495595_0000789	Ga0495595_0000789_756_1736	324
129	3300053085	Ga0495619_0017872	Ga0495619_0017872_2376_3356	324
130	3300005844	Ga0068862_100364750	Ga0068862_1003647502	325
131	3300006042	Ga0075368_10020575	Ga0075368_100205752	325
132	3300006042	Ga0075368_10038160	Ga0075368_100381603	325
133	3300006048	Ga0075363_100206481	Ga0075363_1002064811	325
134	3300006178	Ga0075367_10133343	Ga0075367_101333432	325
135	3300006186	Ga0075369_10006562	Ga0075369_100065626	325
136	3300006195	Ga0075366_10161833	Ga0075366_101618332	325
137	3300006846	Ga0075430_100035210	Ga0075430_1000352104	325
138	3300006880	Ga0075429_100104020	Ga0075429_1001040202	325
139	3300027866	Ga0209813_10051551	Ga0209813_100515512	325
140	3300027907	Ga0207428_10051858	Ga0207428_100518583	325
141	3300031731	Ga0307405_10061516	Ga0307405_100615163	325
142	3300050490	nmdc:mga03n38_65567_c1	nmdc:mga03n38_65567_c1_181_1173	325
143	3300050491	nmdc:mga00v17_155243_c1	nmdc:mga00v17_155243_c1_167_1159	325
144	3300050492	nmdc:mga0yw44_22963_c1	nmdc:mga0yw44_22963_c1_691_1683	325
145	3300050494	nmdc:mga06z11_17923_c1	nmdc:mga06z11_17923_c1_2110_3102	325
146	3300050508	nmdc:mga09592_116559_c1	nmdc:mga09592_116559_c1_28_1059	325
147	3300050508	nmdc:mga09592_233932_c1	nmdc:mga09592_233932_c1_48_1031	325
148	3300050509	nmdc:mga0qj67_20671_c1	nmdc:mga0qj67_20671_c1_2734_3717	325
149	3300050509	nmdc:mga0qj67_75504_c1	nmdc:mga0qj67_75504_c1_51_1082	325
150	3300050510	nmdc:mga06r32_3769_c1	nmdc:mga06r32_3769_c1_9040_10023	325
151	3300050510	nmdc:mga06r32_47526_c1	nmdc:mga06r32_47526_c1_1775_2806	325
152	3300050516	nmdc:mga0sz30_25307_c1	nmdc:mga0sz30_25307_c1_1315_2307	325
153	3300005290	Ga0065712_10119657	Ga0065712_101196572	326
154	3300005344	Ga0070661_100057734	Ga0070661_1000577343	326
155	3300005364	Ga0070673_100051440	Ga0070673_1000514402	326
156	3300005456	Ga0070678_100098242	Ga0070678_1000982423	326
157	3300005457	Ga0070662_100033115	Ga0070662_1000331153	326
158	3300005543	Ga0070672_100033284	Ga0070672_1000332843	326
159	3300005578	Ga0068854_100012380	Ga0068854_1000123806	326
160	3300005616	Ga0068852_100084344	Ga0068852_1000843442	326
161	3300006237	Ga0097621_100212909	Ga0097621_1002129092	326
162	3300006358	Ga0068871_100117265	Ga0068871_1001172652	326
163	3300006844	Ga0075428_100110485	Ga0075428_1001104853	326
164	3300009094	Ga0111539_10000527	Ga0111539_1000052748	326
165	3300025920	Ga0207649_10037611	Ga0207649_100376113	326
166	3300025925	Ga0207650_10009804	Ga0207650_100098048	326
167	3300025960	Ga0207651_10033358	Ga0207651_100333584	326
168	3300026121	Ga0207683_10017584	Ga0207683_100175842	326
169	3300028577	Ga0265318_10026005	Ga0265318_100260052	326
170	3300031239	Ga0265328_10000361	Ga0265328_1000036112	326
171	3300031242	Ga0265329_10005351	Ga0265329_100053514	326
172	3300031250	Ga0265331_10001401	Ga0265331_1000140119	326
173	3300031711	Ga0265314_10000660	Ga0265314_1000066024	326
174	3300031852	Ga0307410_10108980	Ga0307410_101089802	326
175	3300044694	Ga0466963_0168532	Ga0466963_0168532_21_1010	326
176	3300049741	Ga0501079_0213626	Ga0501079_0213626_113_1099	326
177	3300050507	nmdc:mga05p37_169642_c1	nmdc:mga05p37_169642_c1_384_1439	326
178	3300050511	nmdc:mga08y16_1374_c1	nmdc:mga08y16_1374_c1_42_1049	326
179	3300060353	Ga0501082_0156110	Ga0501082_0156110_831_1817	326
180	3300005327	Ga0070658_10171637	Ga0070658_101716372	327
181	3300005435	Ga0070714_100017605	Ga0070714_1000176054	327
182	3300005616	Ga0068852_100016330	Ga0068852_1000163303	327
183	3300005616	Ga0068852_100220692	Ga0068852_1002206923	327
184	3300006058	Ga0075432_10010154	Ga0075432_100101543	327
185	3300006175	Ga0070712_100228021	Ga0070712_1002280211	327
186	3300006852	Ga0075433_10002474	Ga0075433_1000247416	327
187	3300007076	Ga0075435_100001554	Ga0075435_1000015546	327
188	3300009094	Ga0111539_10500503	Ga0111539_105005031	327
189	3300013307	Ga0157372_10259898	Ga0157372_102598982	327
190	3300025909	Ga0207705_10015442	Ga0207705_100154423	327
191	3300025915	Ga0207693_10222523	Ga0207693_102225231	327
192	3300025924	Ga0207694_10033312	Ga0207694_100333124	327
193	3300025949	Ga0207667_10030324	Ga0207667_100303244	327
194	3300026142	Ga0207698_10036923	Ga0207698_100369235	327
195	3300026142	Ga0207698_10204185	Ga0207698_102041851	327
196	3300027907	Ga0207428_10000124	Ga0207428_10000124112	327
197	3300038443	Ga0395901_0204857	Ga0395901_0204857_36_1025	327
198	3300044694	Ga0466963_0202525	Ga0466963_0202525_317_1306	327
199	3300049568	Ga0501031_0025836	Ga0501031_0025836_2348_3337	327
200	3300049571	Ga0501034_0031045	Ga0501034_0031045_957_1946	327
201	3300049571	Ga0501034_0125111	Ga0501034_0125111_987_1973	327
202	3300049573	Ga0501037_0146791	Ga0501037_0146791_598_1587	327
203	3300049576	Ga0501040_0135933	Ga0501040_0135933_53_1042	327
204	3300049577	Ga0501041_0243729	Ga0501041_0243729_88_1089	327
205	3300049579	Ga0501043_0278395	Ga0501043_0278395_248_1237	327
206	3300049580	Ga0501046_0198646	Ga0501046_0198646_57_1046	327
207	3300049582	Ga0501048_0098314	Ga0501048_0098314_814_1803	327
208	3300049585	Ga0501069_0127900	Ga0501069_0127900_439_1428	327
209	3300049586	Ga0501070_0126790	Ga0501070_0126790_772_1758	327
210	3300049587	Ga0501071_0043511	Ga0501071_0043511_1653_2642	327
211	3300049588	Ga0501072_0022242	Ga0501072_0022242_446_1435	327
212	3300049591	Ga0501075_0053040	Ga0501075_0053040_1515_2504	327
213	3300049592	Ga0501076_0128724	Ga0501076_0128724_196_1185	327
214	3300049741	Ga0501079_0031368	Ga0501079_0031368_2658_3647	327
215	3300049742	Ga0501080_0163044	Ga0501080_0163044_105_1091	327
216	3300049744	Ga0501083_0016271	Ga0501083_0016271_623_1612	327
217	3300050491	nmdc:mga00v17_83067_c1	nmdc:mga00v17_83067_c1_642_1646	327
218	3300050511	nmdc:mga08y16_332241_c1	nmdc:mga08y16_332241_c1_474_1457	327
219	3300050512	nmdc:mga0n895_27254_c1	nmdc:mga0n895_27254_c1_1940_2923	327
220	3300050513	nmdc:mga0rr50_4570_c1	nmdc:mga0rr50_4570_c1_114_1097	327
221	3300050515	nmdc:mga0a205_1626_c1	nmdc:mga0a205_1626_c1_3945_4928	327
222	3300060353	Ga0501082_0085455	Ga0501082_0085455_990_1979	327
223	3300061734	Ga0530510_0057151	Ga0530510_0057151_1470_2459	327
224	3300005334	Ga0068869_100090317	Ga0068869_1000903172	328
225	3300005335	Ga0070666_10069023	Ga0070666_100690232	328
226	3300005337	Ga0070682_100131093	Ga0070682_1001310931	328
227	3300005338	Ga0068868_100016130	Ga0068868_1000161307	328
228	3300005340	Ga0070689_100100233	Ga0070689_1001002331	328
229	3300005355	Ga0070671_100020376	Ga0070671_1000203765	328
230	3300005355	Ga0070671_100028755	Ga0070671_1000287554	328
231	3300005364	Ga0070673_100213120	Ga0070673_1002131201	328
232	3300005365	Ga0070688_100027545	Ga0070688_1000275454	328
233	3300005434	Ga0070709_10227679	Ga0070709_102276791	328
234	3300005436	Ga0070713_100013256	Ga0070713_1000132565	328
235	3300005439	Ga0070711_100032052	Ga0070711_1000320524	328
236	3300005455	Ga0070663_100051972	Ga0070663_1000519722	328
237	3300005456	Ga0070678_100029626	Ga0070678_1000296264	328
238	3300005466	Ga0070685_10102675	Ga0070685_101026752	328
239	3300005543	Ga0070672_100215919	Ga0070672_1002159191	328
240	3300006028	Ga0070717_10005794	Ga0070717_1000579410	328
241	3300006173	Ga0070716_100021457	Ga0070716_1000214574	328
242	3300006353	Ga0075370_10085911	Ga0075370_100859112	328
243	3300006358	Ga0068871_100042547	Ga0068871_1000425472	328
244	3300007076	Ga0075435_100228023	Ga0075435_1002280232	328
245	3300009148	Ga0105243_10024175	Ga0105243_100241753	328
246	3300009176	Ga0105242_10047936	Ga0105242_100479364	328
247	3300009177	Ga0105248_10198202	Ga0105248_101982022	328
248	3300009551	Ga0105238_10178760	Ga0105238_101787602	328
249	3300012515	Ga0157338_1000667	Ga0157338_10006673	328
250	3300013104	Ga0157370_10172442	Ga0157370_101724422	328
251	3300014745	Ga0157377_10114453	Ga0157377_101144532	328
252	3300025907	Ga0207645_10085090	Ga0207645_100850903	328
253	3300025914	Ga0207671_10141723	Ga0207671_101417233	328
254	3300025915	Ga0207693_10027650	Ga0207693_100276503	328
255	3300025919	Ga0207657_10117781	Ga0207657_101177812	328
256	3300025928	Ga0207700_10014221	Ga0207700_100142213	328
257	3300025936	Ga0207670_10120148	Ga0207670_101201482	328
258	3300025938	Ga0207704_10038754	Ga0207704_100387542	328
259	3300025939	Ga0207665_10037188	Ga0207665_100371881	328
260	3300025940	Ga0207691_10059595	Ga0207691_100595954	328
261	3300025944	Ga0207661_10261020	Ga0207661_102610202	328
262	3300026088	Ga0207641_10022095	Ga0207641_100220955	328
263	3300026121	Ga0207683_10035623	Ga0207683_100356234	328
264	3300028379	Ga0268266_10035045	Ga0268266_100350454	328
265	3300034819	Ga0373958_0007611	Ga0373958_0007611_693_1679	328
266	3300034957	Ga0373938_0008272	Ga0373938_0008272_158_1144	328
267	3300035088	Ga0373940_0043313	Ga0373940_0043313_228_1214	328
268	3300035091	Ga0373951_0012281	Ga0373951_0012281_265_1251	328
269	3300035092	Ga0373952_0002130	Ga0373952_0002130_2075_3061	328
270	3300035114	Ga0373939_0002156	Ga0373939_0002156_3056_4042	328
271	3300035116	Ga0373945_0066499	Ga0373945_0066499_34_1020	328
272	3300035170	Ga0373943_0049713	Ga0373943_0049713_395_1381	328
273	3300035171	Ga0373946_0022178	Ga0373946_0022178_698_1684	328
274	3300035171	Ga0373946_0132874	Ga0373946_0132874_130_1116	328
275	3300035172	Ga0373955_0049079	Ga0373955_0049079_204_1190	328
276	3300035207	Ga0373942_0008186	Ga0373942_0008186_976_1962	328
277	3300035410	Ga0373924_0025460	Ga0373924_0025460_130_1116	328
278	3300035691	Ga0373931_0010301	Ga0373931_0010301_993_1979	328
279	3300035695	Ga0373927_0033939	Ga0373927_0033939_1651_2637	328
280	3300035725	Ga0373947_0008683	Ga0373947_0008683_4183_5169	328
281	3300035725	Ga0373947_0066480	Ga0373947_0066480_812_1798	328
282	3300036401	Ga0373937_0003541	Ga0373937_0003541_2801_3787	328
283	3300037068	Ga0373925_0047557	Ga0373925_0047557_382_1368	328
284	3300037068	Ga0373925_0069120	Ga0373925_0069120_482_1468	328
285	3300039437	Ga0436365_0539632	Ga0436365_0539632_2172_3164	328
286	3300046454	Ga0495592_0044311	Ga0495592_0044311_1342_2328	328
287	3300046459	Ga0495629_0002798	Ga0495629_0002798_11554_12540	328
288	3300046461	Ga0495641_0041398	Ga0495641_0041398_757_1743	328
289	3300046463	Ga0495653_0278359	Ga0495653_0278359_26_1012	328
290	3300046472	Ga0495580_0018697	Ga0495580_0018697_304_1290	328
291	3300046473	Ga0495582_0004712	Ga0495582_0004712_5204_6190	328
292	3300046477	Ga0495664_0095002	Ga0495664_0095002_526_1512	328
293	3300046477	Ga0495664_0174849	Ga0495664_0174849_263_1249	328
294	3300046491	Ga0495584_0035673	Ga0495584_0035673_1338_2324	328
295	3300046492	Ga0495585_0102042	Ga0495585_0102042_382_1368	328
296	3300046499	Ga0495594_0078828	Ga0495594_0078828_177_1163	328
297	3300046501	Ga0495607_0016993	Ga0495607_0016993_3585_4571	328
298	3300046511	Ga0495608_0050938	Ga0495608_0050938_308_1294	328
299	3300046511	Ga0495608_0235416	Ga0495608_0235416_117_1103	328
300	3300046523	Ga0495644_0002123	Ga0495644_0002123_81_1067	328
301	3300046526	Ga0495666_0121947	Ga0495666_0121947_192_1178	328
302	3300046535	Ga0495586_0029557	Ga0495586_0029557_82_1068	328
303	3300046538	Ga0495609_0045393	Ga0495609_0045393_76_1062	328
304	3300046558	Ga0495633_0002652	Ga0495633_0002652_11269_12255	328
305	3300046559	Ga0495667_0029298	Ga0495667_0029298_682_1668	328
306	3300046559	Ga0495667_0088929	Ga0495667_0088929_770_1756	328
307	3300046664	Ga0495659_0026784	Ga0495659_0026784_912_1898	328
308	3300046665	Ga0495661_0169522	Ga0495661_0169522_72_1058	328
309	3300046674	Ga0495588_0122918	Ga0495588_0122918_337_1323	328
310	3300046675	Ga0495657_0046055	Ga0495657_0046055_560_1546	328
311	3300046681	Ga0495647_0024115	Ga0495647_0024115_743_1729	328
312	3300046683	Ga0495658_0006386	Ga0495658_0006386_730_1716	328
313	3300046689	Ga0495613_0014073	Ga0495613_0014073_874_1860	328
314	3300046689	Ga0495613_0191896	Ga0495613_0191896_204_1190	328
315	3300046690	Ga0495624_0053942	Ga0495624_0053942_1540_2526	328
316	3300046691	Ga0495670_0010119	Ga0495670_0010119_3316_4302	328
317	3300046794	Ga0495589_0052958	Ga0495589_0052958_655_1641	328
318	3300047315	Ga0495581_0014878	Ga0495581_0014878_1158_2144	328
319	3300047317	Ga0495604_0025948	Ga0495604_0025948_2388_3374	328
320	3300047319	Ga0495674_0079861	Ga0495674_0079861_332_1318	328
321	3300047321	Ga0495676_0123641	Ga0495676_0123641_339_1325	328
322	3300047322	Ga0495680_0045744	Ga0495680_0045744_2151_3137	328
323	3300047322	Ga0495680_0084895	Ga0495680_0084895_253_1239	328
324	3300047471	Ga0495684_0010102	Ga0495684_0010102_5720_6706	328
325	3300047673	Ga0495593_0017106	Ga0495593_0017106_285_1271	328
326	3300048089	Ga0495614_0098049	Ga0495614_0098049_66_1052	328
327	3300048903	Ga0496100_0090689	Ga0496100_0090689_729_1715	328
328	3300048904	Ga0496101_0032508	Ga0496101_0032508_2671_3657	328
329	3300048905	Ga0496102_0009166	Ga0496102_0009166_1253_2239	328
330	3300048906	Ga0496103_0006282	Ga0496103_0006282_4603_5589	328
331	3300048907	Ga0496104_0032399	Ga0496104_0032399_886_1872	328
332	3300048909	Ga0496106_0003237	Ga0496106_0003237_2732_3718	328
333	3300048911	Ga0496108_0030008	Ga0496108_0030008_2864_3850	328
334	3300048912	Ga0496109_0037927	Ga0496109_0037927_2530_3516	328
335	3300048913	Ga0496110_0025810	Ga0496110_0025810_3462_4448	328
336	3300048914	Ga0496111_0033398	Ga0496111_0033398_2667_3653	328
337	3300048915	Ga0496112_0129405	Ga0496112_0129405_620_1606	328
338	3300048917	Ga0496114_0002383	Ga0496114_0002383_8671_9657	328
339	3300048918	Ga0496115_0030762	Ga0496115_0030762_582_1568	328
340	3300050512	nmdc:mga0n895_39699_c1	nmdc:mga0n895_39699_c1_110_1096	328
341	3300053077	Ga0495601_0002091	Ga0495601_0002091_3841_4827	328
342	3300053085	Ga0495619_0000105	Ga0495619_0000105_46680_47666	328
343	3300053085	Ga0495619_0011261	Ga0495619_0011261_1594_2580	328
344	3300053096	Ga0500641_0013260	Ga0500641_0013260_1356_2342	328
345	3300053096	Ga0500641_0030710	Ga0500641_0030710_654_1673	328
346	3300053151	Ga0500604_0006621	Ga0500604_0006621_159_1145	328
347	3300003911	JGI25405J52794_10009486	JGI25405J52794_100094862	329
348	3300005937	Ga0081455_10001351	Ga0081455_1000135123	329
349	3300005937	Ga0081455_10052290	Ga0081455_100522902	329
350	3300031711	Ga0265314_10011017	Ga0265314_100110173	329
351	3300050507	nmdc:mga05p37_110526_c1	nmdc:mga05p37_110526_c1_448_1437	329
352	3300050512	nmdc:mga0n895_50774_c1	nmdc:mga0n895_50774_c1_2175_3164	329
353	3300000042	ARSoilYngRDRAFT_c00285	ARSoilYngRDRAFT_002851	330
354	3300000044	ARSoilOldRDRAFT_c000264	ARSoilOldRDRAFT_0002643	330
355	3300000045	ARCol0oldRDRAFT_c00257	ARCol0oldRDRAFT_002573	330
356	3300000652	ARCol0yngRDRAFT_1000034	ARCol0yngRDRAFT_100003418	330
357	3300001990	JGI24737J22298_10006975	JGI24737J22298_100069755	330
358	3300005290	Ga0065712_10147479	Ga0065712_101474791	330
359	3300005340	Ga0070689_100130699	Ga0070689_1001306992	330
360	3300005341	Ga0070691_10068386	Ga0070691_100683862	330
361	3300005343	Ga0070687_100020324	Ga0070687_1000203243	330
362	3300005347	Ga0070668_100120161	Ga0070668_1001201613	330
363	3300005353	Ga0070669_100062445	Ga0070669_1000624455	330
364	3300005364	Ga0070673_100346280	Ga0070673_1003462802	330
365	3300005365	Ga0070688_100134455	Ga0070688_1001344553	330
366	3300005366	Ga0070659_100013416	Ga0070659_1000134166	330
367	3300005438	Ga0070701_10003764	Ga0070701_100037643	330
368	3300005440	Ga0070705_100093428	Ga0070705_1000934282	330
369	3300005444	Ga0070694_100023686	Ga0070694_1000236863	330
370	3300005455	Ga0070663_100118789	Ga0070663_1001187892	330
371	3300005458	Ga0070681_10185725	Ga0070681_101857252	330
372	3300005459	Ga0068867_100099942	Ga0068867_1000999424	330
373	3300005471	Ga0070698_100348680	Ga0070698_1003486801	330
374	3300005535	Ga0070684_100115926	Ga0070684_1001159262	330
375	3300005539	Ga0068853_100109769	Ga0068853_1001097692	330
376	3300005544	Ga0070686_100052086	Ga0070686_1000520862	330
377	3300005545	Ga0070695_100054286	Ga0070695_1000542863	330
378	3300005546	Ga0070696_100027672	Ga0070696_1000276721	330
379	3300005563	Ga0068855_100234512	Ga0068855_1002345122	330
380	3300005617	Ga0068859_100032685	Ga0068859_1000326853	330
381	3300005843	Ga0068860_100125617	Ga0068860_1001256173	330
382	3300005844	Ga0068862_100004105	Ga0068862_10000410510	330
383	3300005937	Ga0081455_10000237	Ga0081455_1000023714	330
384	3300006881	Ga0068865_100259282	Ga0068865_1002592822	330
385	3300006931	Ga0097620_100032683	Ga0097620_1000326833	330
386	3300009148	Ga0105243_10154188	Ga0105243_101541882	330
387	3300013102	Ga0157371_10225769	Ga0157371_102257692	330
388	3300013306	Ga0163162_10290417	Ga0163162_102904172	330
389	3300013308	Ga0157375_10288650	Ga0157375_102886503	330
390	3300025315	Ga0207697_10028758	Ga0207697_100287583	330
391	3300025899	Ga0207642_10059976	Ga0207642_100599762	330
392	3300025904	Ga0207647_10007434	Ga0207647_100074343	330
393	3300025916	Ga0207663_10236937	Ga0207663_102369371	330
394	3300025918	Ga0207662_10014496	Ga0207662_100144966	330
395	3300025919	Ga0207657_10160835	Ga0207657_101608352	330
396	3300025933	Ga0207706_10129460	Ga0207706_101294602	330
397	3300025935	Ga0207709_10191470	Ga0207709_101914702	330
398	3300025937	Ga0207669_10099760	Ga0207669_100997602	330
399	3300025961	Ga0207712_10034551	Ga0207712_100345514	330
400	3300025972	Ga0207668_10051772	Ga0207668_100517722	330
401	3300025986	Ga0207658_10222154	Ga0207658_102221541	330
402	3300026035	Ga0207703_10195159	Ga0207703_101951593	330
403	3300026041	Ga0207639_10280403	Ga0207639_102804032	330
404	3300026067	Ga0207678_10071677	Ga0207678_100716773	330
405	3300026075	Ga0207708_10007296	Ga0207708_100072968	330
406	3300026089	Ga0207648_10042645	Ga0207648_100426454	330
407	3300026116	Ga0207674_10452450	Ga0207674_104524501	330
408	3300026118	Ga0207675_100238279	Ga0207675_1002382792	330
409	3300027695	Ga0209966_1004215	Ga0209966_10042154	330
410	3300027907	Ga0207428_10155601	Ga0207428_101556012	330
411	3300028380	Ga0268265_10092111	Ga0268265_100921113	330
412	3300028381	Ga0268264_10061242	Ga0268264_100612422	330
413	3300034817	Ga0373948_0000067	Ga0373948_0000067_23_1015	330
414	3300034818	Ga0373950_0003655	Ga0373950_0003655_542_1534	330
415	3300034957	Ga0373938_0039911	Ga0373938_0039911_10_1002	330
416	3300035088	Ga0373940_0032519	Ga0373940_0032519_48_1040	330
417	3300035090	Ga0373949_0002305	Ga0373949_0002305_2960_3952	330
418	3300035114	Ga0373939_0003364	Ga0373939_0003364_568_1560	330
419	3300035241	Ga0373961_0013511	Ga0373961_0013511_359_1351	330
420	3300035242	Ga0373962_0053270	Ga0373962_0053270_162_1154	330
421	3300044712	Ga0453684_0124335	Ga0453684_0124335_2103_3095	330
422	3300045051	Ga0451576_0169118	Ga0451576_0169118_719_1711	330
423	3300048905	Ga0496102_0057309	Ga0496102_0057309_1844_2836	330
424	3300048908	Ga0496105_0000273	Ga0496105_0000273_15027_16019	330
425	3300048909	Ga0496106_0199710	Ga0496106_0199710_36_1028	330
426	3300048911	Ga0496108_0169592	Ga0496108_0169592_219_1211	330
427	3300048912	Ga0496109_0454401	Ga0496109_0454401_27_1019	330
428	3300053084	Ga0495595_0108788	Ga0495595_0108788_127_1119	330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

71

347

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2qpq-assembly3.cif.gz_C	structure of bug27 from bordetella pertussis	0.9551	31	328
2qpq-assembly2.cif.gz_B	structure of bug27 from bordetella pertussis	0.9479	29	328
2qpq-assembly3.cif.gz_C	structure of bug27 from bordetella pertussis	0.9457	31	328
2qpq-assembly2.cif.gz_B	structure of bug27 from bordetella pertussis	0.9416	29	328
8hk9-assembly2.cif.gz_A	apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis	0.9398	32	326

ID	Description	Score	Start	End	Superfamily
4x9tA02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9249	130	244	3.40.190.10
2qpqB01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1	0.9159	29	328	3.40.190.150
2qpqC02	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II	0.9133	130	254	3.40.190.10
2dvzA01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1	0.9102	29	328	3.40.190.150
2qpqB01	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1	0.9056	29	328	3.40.190.150

ID	Description	Score	Start	End
AF-A0A3A3FMR4-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9661	47	328
AF-A0A536SFT4-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9654	57	328
AF-A0A853GVT4-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9649	38	328
AF-A0A536SS29-F1-model_v4	Tripartite tricarboxylate transporter substrate binding protein	0.9649	37	328
AF-A0A2L1CQM3-F1-model_v4	deleted	0.9624	57	328

Feature Viewer

pLDDT	pTM	Quality
89.04	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F441779

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

71

347

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map