F441797

General Info

Members Datasets Scaffolds Average Seq Length
428 228 856 137

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2784132148|2784590603
Length 164
Sequence LRLLSNRTVLALFPPQRDLRCSAVLTYAGGMSTTQERTAEQDLPYDVFSRACPSRGTLEHVTGRWGALTLGALYKGSFRFNELRRRVDGVSEKMLAQTLHALERDGLVHREAQPTNPPRVDYELTPLGHEVAGRLLALIECVEGRMDEVLASRERYDAQRTPTA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
9 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
14 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
36 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
45 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
53 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
54 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
55 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
56 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
59 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
60 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
61 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
62 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
65 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
66 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
67 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
68 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
69 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
70 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
199 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
205 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
206 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
207 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
208 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
209 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
212 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
213 2643221548 Streptomyces sp. Root55 Isolate Unclassified
214 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
215 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
216 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
217 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
218 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
219 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
220 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
221 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
222 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
223 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
224 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
225 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
226 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
227 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
228 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.23
Isolates 4.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0.7
Rhizoplane 1.17
Rhizosphere 79.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10016776 3300003316 Bacteria 4516
2 rootH2_10041607 3300003320 Bacteria 11882
3 rootL2_10152880 3300003322 Bacteria 1579
4 rootL2_10156802 3300003322 Bacteria 1687
5 rootH1_10007823 3300003323 Bacteria 7125
6 rootH1_10031148 3300003323 Bacteria 5530
7 rootH1_10081772 3300003323 Bacteria 4193
8 rootH1_10117709 3300003323 Bacteria 1658
9 Ga0006562J51391_1103643 3300003578 Bacteria 1565
10 Ga0068857_101845139 3300005577 Bacteria 592
11 Ga0075367_10008065 3300006178 Bacteria 5434
12 Ga0075367_10064980 3300006178 Bacteria 2184
13 Ga0075370_10060038 3300006353 Bacteria 2165
14 Ga0099826_10042327 3300006948 Bacteria 3151
15 Ga0105251_10014835 3300009011 Bacteria 4283
16 Ga0105245_11041450 3300009098 Bacteria 863
17 Ga0105243_10355628 3300009148 Bacteria 1346
18 Ga0105237_10940196 3300009545 Bacteria 871
19 Ga0105238_11260321 3300009551 Bacteria 765
20 Ga0105239_10328895 3300010375 Bacteria 1724
21 Ga0105239_11503812 3300010375 Bacteria 778
22 Ga0105246_10545848 3300011119 Bacteria 992
23 Ga0157369_10218826 3300013105 Bacteria 1994
24 Ga0157375_12254567 3300013308 Bacteria 649
25 Ga0182008_10000836 3300014497 Bacteria 21479
26 Ga0182007_10000165 3300015262 Bacteria 45550
27 Ga0182005_1026508 3300015265 Bacteria 1582
28 Ga0183367_1013 3300015688 Bacteria 334176
29 Ga0209758_1056155 3300025297 Bacteria 1331
30 Ga0207426_1022080 3300025302 Bacteria 2190
31 Ga0207426_1066903 3300025302 Bacteria 1014
32 Ga0207713_1014470 3300025735 Bacteria 4097
33 Ga0207684_11089023 3300025910 Bacteria 665
34 Ga0207694_10655599 3300025924 Bacteria 884
35 Ga0207709_10173429 3300025935 Bacteria 1516
36 Ga0209371_1027802 3300027312 Bacteria 1269
37 Ga0307517_10018471 3300028786 Bacteria 9015
38 Ga0307515_10000785 3300028794 Bacteria 73213
39 Ga0268256_1031621 3300030500 Bacteria 1269
40 Ga0307511_10002093 3300030521 Bacteria 20897
41 Ga0307511_10032018 3300030521 Bacteria 4684
42 Ga0307512_10012198 3300030522 Bacteria 8123
43 Ga0307513_10185079 3300031456 Bacteria 1941
44 Ga0307509_10008643 3300031507 Bacteria 12925
45 Ga0307509_10082474 3300031507 Bacteria 3317
46 Ga0307509_10181160 3300031507 Bacteria 1971
47 Ga0307508_10001892 3300031616 Bacteria 23023
48 Ga0307508_10005086 3300031616 Bacteria 12614
49 Ga0307508_10044749 3300031616 Bacteria 3958
50 Ga0307508_10176375 3300031616 Bacteria 1740
51 Ga0307508_10248252 3300031616 Bacteria 1376
52 Ga0307514_10001588 3300031649 Bacteria 26793
53 Ga0307514_10192169 3300031649 Bacteria 1298
54 Ga0307514_10332841 3300031649 Bacteria 824
55 Ga0307516_10015511 3300031730 Bacteria 8014
56 Ga0307516_10155765 3300031730 Bacteria 2040
57 Ga0307516_10161452 3300031730 Bacteria 1991
58 Ga0307516_10189067 3300031730 Bacteria 1786
59 Ga0307516_10251164 3300031730 Bacteria 1463
60 Ga0307405_11754559 3300031731 Bacteria 551
61 Ga0307518_10020874 3300031838 Bacteria 4707
62 Ga0307518_10412386 3300031838 Bacteria 746
63 Ga0307412_11769897 3300031911 Bacteria 568
64 Ga0307416_100769797 3300032002 Bacteria 1056
65 Ga0307507_10088342 3300033179 Bacteria 2674
66 Ga0307507_10118214 3300033179 Bacteria 2132
67 Ga0307507_10356493 3300033179 Bacteria 856
68 Ga0307510_10006807 3300033180 Bacteria 13634
69 Ga0307510_10073987 3300033180 Bacteria 3370
70 Ga0307510_10091121 3300033180 Bacteria 2892
71 Ga0395900_0104635 3300037418 Bacteria 2908
72 Ga0395898_0034759 3300037466 Bacteria 5017
73 Ga0395898_0454663 3300037466 Bacteria 1219
74 Ga0395898_1830221 3300037466 Bacteria 528
75 Ga0395905_0342604 3300037471 Bacteria 1386
76 Ga0395901_0066202 3300038443 Bacteria 3764
77 Ga0439436_0003208 3300041404 Bacteria 4961
78 Ga0439439_0002766 3300041406 Bacteria 3780
79 Ga0439465_0134194 3300041413 Bacteria 876
80 Ga0451802_2066062 3300041460 Bacteria 510
81 Ga0451835_0543101 3300041492 Bacteria 562
82 Ga0451845_0821148 3300041501 Bacteria 942
83 Ga0451851_0258721 3300041507 Bacteria 822
84 Ga0451853_1497063 3300041512 Bacteria 1310
85 Ga0451853_1660674 3300041512 Bacteria 4040
86 Ga0451853_2844185 3300041512 Bacteria 1949
87 Ga0451853_3268851 3300041512 Bacteria 4183
88 Ga0439433_0008533 3300041999 Bacteria 2224
89 Ga0439433_0010475 3300041999 Bacteria 2025
90 Ga0439442_002559 3300042002 Bacteria 3567
91 Ga0439432_056602 3300042006 Bacteria 1215
92 Ga0439449_0024127 3300042007 Bacteria 2274
93 Ga0439449_0077559 3300042007 Bacteria 1225
94 Ga0439449_0108308 3300042007 Bacteria 1028
95 Ga0439450_065691 3300042008 Bacteria 883
96 Ga0439455_0025193 3300042012 Bacteria 1444
97 Ga0439457_000971 3300042014 Bacteria 8627
98 Ga0439457_002037 3300042014 Bacteria 5930
99 Ga0439457_038757 3300042014 Bacteria 1060
100 Ga0439457_059261 3300042014 Bacteria 866
101 Ga0439462_0201869 3300042015 Bacteria 566
102 Ga0450894_000040 3300042131 Bacteria 18899
103 Ga0450898_003503 3300042134 Bacteria 2261
104 Ga0450899_000406 3300042135 Bacteria 4785
105 Ga0450903_001199 3300042138 Bacteria 4871
106 Ga0450906_006145 3300042145 Bacteria 2433
107 Ga0439458_0000531 3300042157 Bacteria 9827
108 Ga0439458_0036095 3300042157 Bacteria 1189
109 Ga0466969_0110465 3300044656 Bacteria 1287
110 Ga0466972_0017956 3300044658 Bacteria 3538
111 Ga0466972_0069699 3300044658 Bacteria 1678
112 Ga0466972_0533175 3300044658 Bacteria 553
113 Ga0466965_0003354 3300044683 Bacteria 7020
114 Ga0466966_0000240 3300044684 Bacteria 36306
115 Ga0466966_0037560 3300044684 Bacteria 3122
116 Ga0466961_0000389 3300044693 Bacteria 28233
117 Ga0466961_0027828 3300044693 Bacteria 3635
118 Ga0466961_0696771 3300044693 Bacteria 608
119 Ga0466963_0000267 3300044694 Bacteria 23041
120 Ga0466963_0122147 3300044694 Bacteria 1793
121 Ga0466964_0003106 3300044706 Bacteria 6041
122 Ga0466964_0212980 3300044706 Bacteria 934
123 Ga0466971_0001898 3300044719 Bacteria 8881
124 Ga0466971_0168736 3300044719 Bacteria 1026
125 Ga0466968_0017995 3300044735 Bacteria 2831
126 Ga0466970_0006603 3300044765 Bacteria 5803
127 Ga0466970_0443389 3300044765 Bacteria 744
128 Ga0466957_0002240 3300044842 Bacteria 10371
129 Ga0466960_0215504 3300044901 Bacteria 1054
130 Ga0466960_0321564 3300044901 Bacteria 876
131 Ga0466960_0638581 3300044901 Bacteria 635
132 Ga0466959_0000365 3300045049 Bacteria 26771
133 Ga0466959_0133370 3300045049 Bacteria 1759
134 Ga0466958_0005465 3300045836 Bacteria 6844
135 Ga0466967_0056407 3300045976 Bacteria 3463
136 Ga0466967_0104213 3300045976 Bacteria 2596
137 Ga0495627_009318 3300046453 Bacteria 3619
138 Ga0495592_0017403 3300046454 Bacteria 5460
139 Ga0495592_0033300 3300046454 Bacteria 3887
140 Ga0495603_0003165 3300046455 Bacteria 9791
141 Ga0495603_0031785 3300046455 Bacteria 3177
142 Ga0495590_0036994 3300046457 Bacteria 1702
143 Ga0495590_0042533 3300046457 Bacteria 1584
144 Ga0495629_0003183 3300046459 Bacteria 12429
145 Ga0495629_0008148 3300046459 Bacteria 7709
146 Ga0495629_0027801 3300046459 Bacteria 4017
147 Ga0495629_0096583 3300046459 Bacteria 2061
148 Ga0495629_0153819 3300046459 Bacteria 1598
149 Ga0495629_0267691 3300046459 Bacteria 1174
150 Ga0495638_0007665 3300046460 Bacteria 7717
151 Ga0495638_0246434 3300046460 Bacteria 987
152 Ga0495651_0011653 3300046462 Bacteria 6759
153 Ga0495651_0118983 3300046462 Bacteria 1943
154 Ga0495582_0027475 3300046473 Bacteria 3120
155 Ga0495582_0152950 3300046473 Bacteria 1310
156 Ga0495582_0471460 3300046473 Bacteria 725
157 Ga0495605_0006096 3300046474 Bacteria 6956
158 Ga0495605_0024611 3300046474 Bacteria 3148
159 Ga0495662_0017558 3300046476 Bacteria 3463
160 Ga0495662_0127673 3300046476 Bacteria 1249
161 Ga0495662_0430648 3300046476 Bacteria 647
162 Ga0495664_0000502 3300046477 Bacteria 19509
163 Ga0495664_0012373 3300046477 Bacteria 4832
164 Ga0495584_0050960 3300046491 Bacteria 2085
165 Ga0495594_0041732 3300046499 Bacteria 2511
166 Ga0495594_0049547 3300046499 Bacteria 2308
167 Ga0495594_0058723 3300046499 Bacteria 2126
168 Ga0495594_0276325 3300046499 Bacteria 957
169 Ga0495594_0531672 3300046499 Bacteria 667
170 Ga0495596_0057790 3300046500 Bacteria 1513
171 Ga0495583_0048490 3300046506 Bacteria 1949
172 Ga0495583_0157059 3300046506 Bacteria 940
173 Ga0495606_0053408 3300046507 Bacteria 2622
174 Ga0495606_0193674 3300046507 Bacteria 1163
175 Ga0495608_0035374 3300046511 Bacteria 3369
176 Ga0495608_0264026 3300046511 Bacteria 1071
177 Ga0495610_0024236 3300046512 Bacteria 3279
178 Ga0495610_0378619 3300046512 Bacteria 527
179 Ga0495616_0015177 3300046513 Bacteria 4286
180 Ga0495618_0033336 3300046514 Bacteria 3229
181 Ga0495620_0003689 3300046515 Bacteria 8746
182 Ga0495620_0006863 3300046515 Bacteria 6223
183 Ga0495628_0022372 3300046516 Bacteria 5193
184 Ga0495630_0102871 3300046517 Bacteria 2161
185 Ga0495632_0116501 3300046519 Bacteria 1251
186 Ga0495643_0058939 3300046522 Bacteria 2041
187 Ga0495643_0191547 3300046522 Bacteria 987
188 Ga0495643_0222595 3300046522 Bacteria 894
189 Ga0495648_0035256 3300046524 Bacteria 3245
190 Ga0495666_0017901 3300046526 Bacteria 3528
191 Ga0495642_0064909 3300046528 Bacteria 1519
192 Ga0495652_0013439 3300046529 Bacteria 7368
193 Ga0495652_0174006 3300046529 Bacteria 1659
194 Ga0495654_0121139 3300046530 Bacteria 1184
195 Ga0495665_0083936 3300046531 Bacteria 1675
196 Ga0495640_0030528 3300046533 Bacteria 3857
197 Ga0495640_0048831 3300046533 Bacteria 2921
198 Ga0495640_0063692 3300046533 Bacteria 2496
199 Ga0495640_0439268 3300046533 Bacteria 798
200 Ga0495587_0232186 3300046536 Bacteria 1039
201 Ga0495609_0008816 3300046538 Bacteria 4909
202 Ga0495597_0020581 3300046542 Bacteria 3071
203 Ga0495597_0105127 3300046542 Bacteria 1187
204 Ga0495645_0025650 3300046543 Bacteria 4280
205 Ga0495645_0115884 3300046543 Bacteria 1892
206 Ga0495622_0017095 3300046557 Bacteria 3377
207 Ga0495622_0088562 3300046557 Bacteria 1423
208 Ga0495622_0441246 3300046557 Bacteria 558
209 Ga0495633_0208348 3300046558 Bacteria 896
210 Ga0495667_0082281 3300046559 Bacteria 2092
211 Ga0495667_0156353 3300046559 Bacteria 1467
212 Ga0495668_0290127 3300046616 Bacteria 896
213 Ga0495634_0005627 3300046642 Bacteria 9600
214 Ga0495634_0288916 3300046642 Bacteria 994
215 Ga0495634_0533494 3300046642 Bacteria 685
216 Ga0495611_0007220 3300046648 Bacteria 4720
217 Ga0495611_0012087 3300046648 Bacteria 3668
218 Ga0495611_0055427 3300046648 Bacteria 1793
219 Ga0495625_0016697 3300046660 Bacteria 5766
220 Ga0495625_0174279 3300046660 Bacteria 1434
221 Ga0495625_0273184 3300046660 Bacteria 1090
222 Ga0495625_0386776 3300046660 Bacteria 876
223 Ga0495625_0475476 3300046660 Bacteria 768
224 Ga0495635_0000582 3300046663 Bacteria 23458
225 Ga0495635_0014773 3300046663 Bacteria 5463
226 Ga0495661_0044257 3300046665 Bacteria 2730
227 Ga0495588_0024836 3300046674 Bacteria 2980
228 Ga0495588_0026793 3300046674 Bacteria 2878
229 Ga0495588_0030383 3300046674 Bacteria 2715
230 Ga0495657_0035400 3300046675 Bacteria 3460
231 Ga0495657_0039019 3300046675 Bacteria 3265
232 Ga0495623_0038805 3300046679 Bacteria 3045
233 Ga0495623_0089651 3300046679 Bacteria 1890
234 Ga0495646_0000421 3300046680 Bacteria 22383
235 Ga0495646_0161261 3300046680 Bacteria 1241
236 Ga0495658_0072579 3300046683 Bacteria 2002
237 Ga0495613_0002587 3300046689 Bacteria 13598
238 Ga0495613_0017086 3300046689 Bacteria 5401
239 Ga0495613_0031964 3300046689 Bacteria 3909
240 Ga0495613_0071498 3300046689 Bacteria 2528
241 Ga0495624_0069017 3300046690 Bacteria 2202
242 Ga0495624_0089046 3300046690 Bacteria 1905
243 Ga0495624_0126548 3300046690 Bacteria 1568
244 Ga0495671_0005930 3300046692 Bacteria 7103
245 Ga0495671_0218147 3300046692 Bacteria 923
246 Ga0495649_0016766 3300046694 Bacteria 4148
247 Ga0495649_0212675 3300046694 Bacteria 1001
248 Ga0495589_0045108 3300046794 Bacteria 2190
249 Ga0495600_0014683 3300046809 Bacteria 4937
250 Ga0495600_0046751 3300046809 Bacteria 2823
251 Ga0495600_0110188 3300046809 Bacteria 1792
252 Ga0495660_0045082 3300046810 Bacteria 2422
253 Ga0495660_0147698 3300046810 Bacteria 1163
254 Ga0495581_0004441 3300047315 Bacteria 8107
255 Ga0495581_0027212 3300047315 Bacteria 3316
256 Ga0495581_0066957 3300047315 Bacteria 2077
257 Ga0495581_0080166 3300047315 Bacteria 1889
258 Ga0495581_0342916 3300047315 Bacteria 872
259 Ga0495604_0000696 3300047317 Bacteria 28563
260 Ga0495604_0106645 3300047317 Bacteria 2049
261 Ga0495636_0017767 3300047318 Bacteria 2849
262 Ga0495636_0019433 3300047318 Bacteria 2732
263 Ga0495636_0046609 3300047318 Bacteria 1808
264 Ga0495636_0073897 3300047318 Bacteria 1459
265 Ga0495636_0193669 3300047318 Bacteria 926
266 Ga0495674_0158206 3300047319 Bacteria 1897
267 Ga0495674_0276441 3300047319 Bacteria 1377
268 Ga0495672_0017495 3300047320 Bacteria 4795
269 Ga0495676_0000541 3300047321 Bacteria 30996
270 Ga0495676_0006647 3300047321 Bacteria 10659
271 Ga0495676_0030080 3300047321 Bacteria 4615
272 Ga0495676_0033854 3300047321 Bacteria 4294
273 Ga0495676_0142036 3300047321 Bacteria 1719
274 Ga0495676_0536889 3300047321 Bacteria 765
275 Ga0495683_0095886 3300047323 Bacteria 1431
276 Ga0495687_001481 3300047443 Bacteria 21470
277 Ga0495687_009573 3300047443 Bacteria 5400
278 Ga0495687_018988 3300047443 Bacteria 3383
279 Ga0495687_134223 3300047443 Bacteria 871
280 Ga0495675_0032437 3300047444 Bacteria 3333
281 Ga0495675_0051555 3300047444 Bacteria 2613
282 Ga0495675_0162751 3300047444 Bacteria 1373
283 Ga0495677_0080674 3300047445 Bacteria 1219
284 Ga0495685_003248 3300047447 Bacteria 5174
285 Ga0495685_003932 3300047447 Bacteria 4770
286 Ga0495685_020299 3300047447 Bacteria 2283
287 Ga0495685_026598 3300047447 Bacteria 1990
288 Ga0495685_106757 3300047447 Bacteria 923
289 Ga0495685_268400 3300047447 Bacteria 539
290 Ga0495681_0014284 3300047470 Bacteria 4559
291 Ga0495681_0044535 3300047470 Bacteria 2131
292 Ga0495681_0180352 3300047470 Bacteria 868
293 Ga0495684_0204056 3300047471 Bacteria 1456
294 Ga0495686_0021868 3300047472 Bacteria 4238
295 Ga0495593_0000138 3300047673 Bacteria 35243
296 Ga0495593_0031416 3300047673 Bacteria 2900
297 Ga0495602_0067527 3300048088 Bacteria 3076
298 Ga0495614_0007691 3300048089 Bacteria 4787
299 Ga0495614_0014937 3300048089 Bacteria 3392
300 Ga0495614_0027261 3300048089 Bacteria 2463
301 Ga0495614_0062542 3300048089 Bacteria 1599
302 Ga0495626_0103069 3300048091 Bacteria 1242
303 Ga0495626_0197902 3300048091 Bacteria 825
304 Ga0496109_0096429 3300048912 Bacteria 2740
305 Ga0496110_0209720 3300048913 Bacteria 1771
306 Ga0496111_0442102 3300048914 Bacteria 960
307 Ga0495678_049291 3300049459 Bacteria 1637
308 Ga0495678_107114 3300049459 Bacteria 959
309 Ga0501031_0332206 3300049568 Bacteria 984
310 Ga0501032_0016514 3300049569 Bacteria 5191
311 Ga0501032_0259278 3300049569 Bacteria 1127
312 Ga0501033_0035364 3300049570 Bacteria 3745
313 Ga0501033_0049247 3300049570 Bacteria 3127
314 Ga0501033_0090118 3300049570 Bacteria 2243
315 Ga0501033_0575888 3300049570 Bacteria 774
316 Ga0501034_0027494 3300049571 Bacteria 5787
317 Ga0501034_0034644 3300049571 Bacteria 5119
318 Ga0501034_0079169 3300049571 Bacteria 3290
319 Ga0501034_0112914 3300049571 Bacteria 2707
320 Ga0501034_0204483 3300049571 Bacteria 1931
321 Ga0501034_0218169 3300049571 Bacteria 1860
322 Ga0501036_0059141 3300049572 Bacteria 3247
323 Ga0501036_0082518 3300049572 Bacteria 2717
324 Ga0501036_0191732 3300049572 Bacteria 1719
325 Ga0501036_0476473 3300049572 Bacteria 1039
326 Ga0501036_0626876 3300049572 Bacteria 891
327 Ga0501037_0054519 3300049573 Bacteria 2924
328 Ga0501037_0106615 3300049573 Bacteria 2019
329 Ga0501037_0144710 3300049573 Bacteria 1700
330 Ga0501037_0155950 3300049573 Bacteria 1629
331 Ga0501038_0045692 3300049574 Bacteria 3800
332 Ga0501038_0060500 3300049574 Bacteria 3241
333 Ga0501038_0072080 3300049574 Bacteria 2928
334 Ga0501038_0077679 3300049574 Bacteria 2802
335 Ga0501038_0160902 3300049574 Bacteria 1824
336 Ga0501038_0194498 3300049574 Bacteria 1631
337 Ga0501039_0087688 3300049575 Bacteria 2424
338 Ga0501039_0225727 3300049575 Bacteria 1472
339 Ga0501039_0273606 3300049575 Bacteria 1327
340 Ga0501039_0279056 3300049575 Bacteria 1313
341 Ga0501042_1319495 3300049578 Bacteria 526
342 Ga0501043_0014482 3300049579 Bacteria 6174
343 Ga0501043_0035767 3300049579 Bacteria 3907
344 Ga0501043_0036303 3300049579 Bacteria 3876
345 Ga0501043_0077557 3300049579 Bacteria 2610
346 Ga0501043_0635360 3300049579 Bacteria 785
347 Ga0501046_0045118 3300049580 Bacteria 3503
348 Ga0501046_0094447 3300049580 Bacteria 2298
349 Ga0501047_0035587 3300049581 Bacteria 4810
350 Ga0501047_0040478 3300049581 Bacteria 4507
351 Ga0501047_0074351 3300049581 Bacteria 3271
352 Ga0501047_0175471 3300049581 Bacteria 2010
353 Ga0501047_0221069 3300049581 Bacteria 1750
354 Ga0501047_0730856 3300049581 Bacteria 806
355 Ga0501047_1379867 3300049581 Bacteria 519
356 Ga0501048_0012799 3300049582 Bacteria 6234
357 Ga0501048_0993406 3300049582 Bacteria 604
358 Ga0501067_0562709 3300049583 Bacteria 639
359 Ga0501068_0146122 3300049584 Bacteria 1484
360 Ga0501068_0150590 3300049584 Bacteria 1462
361 Ga0501070_0003785 3300049586 Bacteria 13074
362 Ga0501070_0239760 3300049586 Bacteria 1484
363 Ga0501070_0611826 3300049586 Bacteria 868
364 Ga0501070_0782653 3300049586 Bacteria 750
365 Ga0501072_0309937 3300049588 Bacteria 1255
366 Ga0501073_0128062 3300049589 Bacteria 1760
367 Ga0501073_0217245 3300049589 Bacteria 1321
368 Ga0501073_0349983 3300049589 Bacteria 1020
369 Ga0501074_0007152 3300049590 Bacteria 8062
370 Ga0501074_0779447 3300049590 Bacteria 674
371 Ga0501257_016803 3300049686 Bacteria 1699
372 Ga0501080_0099635 3300049742 Bacteria 2696
373 Ga0501083_0569006 3300049744 Bacteria 737
374 Ga0501035_0026858 3300049822 Bacteria 5264
375 Ga0501035_0035671 3300049822 Bacteria 4512
376 Ga0501035_0049418 3300049822 Bacteria 3769
377 Ga0501035_0089924 3300049822 Bacteria 2703
378 Ga0501035_0133395 3300049822 Bacteria 2163
379 Ga0501035_0173398 3300049822 Bacteria 1862
380 Ga0501044_0019710 3300049823 Bacteria 7208
381 Ga0501044_0035413 3300049823 Bacteria 5227
382 Ga0501044_0066386 3300049823 Bacteria 3678
383 Ga0501044_0082533 3300049823 Bacteria 3252
384 Ga0501044_0120226 3300049823 Bacteria 2628
385 Ga0501044_0266716 3300049823 Bacteria 1649
386 Ga0501044_0588194 3300049823 Bacteria 1007
387 Ga0501045_0443356 3300049824 Bacteria 965
388 Ga0501045_0700435 3300049824 Bacteria 747
389 nmdc:mga06z11_103571_c1 3300050494 Bacteria 1565
390 nmdc:mga06z11_1179_c1 3300050494 Bacteria 9607
391 nmdc:mga07m45_17626_c1 3300050496 Bacteria 3239
392 Ga0495612_0009457 3300053078 Bacteria 3952
393 Ga0495619_0247340 3300053085 Bacteria 1235
394 Ga0500583_0292757 3300053092 Bacteria 798
395 Ga0500640_037752 3300053095 Bacteria 2122
396 Ga0500650_0451082 3300053098 Bacteria 551
397 Ga0500553_074418 3300053101 Bacteria 1550
398 Ga0500560_003067 3300053107 Bacteria 3316
399 Ga0500572_005335 3300053111 Bacteria 2908
400 Ga0500608_093780 3300053122 Bacteria 1399
401 Ga0500614_061313 3300053123 Bacteria 1012
402 Ga0500618_030975 3300053125 Bacteria 1256
403 Ga0500655_097605 3300053133 Bacteria 614
404 Ga0500579_096016 3300053143 Bacteria 1572
405 Ga0500600_0080834 3300053149 Bacteria 1758
406 Ga0500624_001051 3300053157 Bacteria 5411
407 Ga0500633_0377498 3300053160 Bacteria 514
408 Ga0500634_0217410 3300053161 Bacteria 824
409 Ga0466962_0001206 3300061719 Bacteria 11873
410 Ga0466962_0204419 3300061719 Bacteria 965
411 2784590603 2784132148 Bacteria 8627943
412 2616699981 2616644814 Bacteria 11555299
413 2643761493 2643221548 Bacteria 8053412
414 2644458806 2643221682 Bacteria 6743283
415 2785340983 2784746763 Bacteria 9783172
416 2793983716 2791355406 Bacteria 11364898
417 2811845921 2808606982 Bacteria 7791042
418 2862389207 2862382967 Bacteria 10317375
419 2863408851 2863404153 Bacteria 9672205
420 2868091523 2868088558 Bacteria 7609351
421 2990061096 2990059506 Bacteria 9321252
422 2997603977 2997600082 Bacteria 9896405
423 8008563020 8008558824 Bacteria 10610750
424 8047895854 8047893842 Bacteria 11723082
425 8048363080 8048356638 Bacteria 11044339
426 8048372878 8048369669 Bacteria 11666822
427 8048381812 8048379754 Bacteria 11877923
428 8048409226 8048406513 Bacteria 8936924
429 rootH1_10016776
430 rootH2_10041607
431 rootL2_10152880
432 rootL2_10156802
433 rootH1_10007823
434 rootH1_10031148
435 rootH1_10081772
436 rootH1_10117709
437 Ga0006562J51391_1103643
438 Ga0068857_101845139
439 Ga0075367_10008065
440 Ga0075367_10064980
441 Ga0075370_10060038
442 Ga0099826_10042327
443 Ga0105251_10014835
444 Ga0105245_11041450
445 Ga0105243_10355628
446 Ga0105237_10940196
447 Ga0105238_11260321
448 Ga0105239_10328895
449 Ga0105239_11503812
450 Ga0105246_10545848
451 Ga0157369_10218826
452 Ga0157375_12254567
453 Ga0182008_10000836
454 Ga0182007_10000165
455 Ga0182005_1026508
456 Ga0183367_1013
457 Ga0209758_1056155
458 Ga0207426_1022080
459 Ga0207426_1066903
460 Ga0207713_1014470
461 Ga0207684_11089023
462 Ga0207694_10655599
463 Ga0207709_10173429
464 Ga0209371_1027802
465 Ga0307517_10018471
466 Ga0307515_10000785
467 Ga0268256_1031621
468 Ga0307511_10002093
469 Ga0307511_10032018
470 Ga0307512_10012198
471 Ga0307513_10185079
472 Ga0307509_10008643
473 Ga0307509_10082474
474 Ga0307509_10181160
475 Ga0307508_10001892
476 Ga0307508_10005086
477 Ga0307508_10044749
478 Ga0307508_10176375
479 Ga0307508_10248252
480 Ga0307514_10001588
481 Ga0307514_10192169
482 Ga0307514_10332841
483 Ga0307516_10015511
484 Ga0307516_10155765
485 Ga0307516_10161452
486 Ga0307516_10189067
487 Ga0307516_10251164
488 Ga0307405_11754559
489 Ga0307518_10020874
490 Ga0307518_10412386
491 Ga0307412_11769897
492 Ga0307416_100769797
493 Ga0307507_10088342
494 Ga0307507_10118214
495 Ga0307507_10356493
496 Ga0307510_10006807
497 Ga0307510_10073987
498 Ga0307510_10091121
499 Ga0395900_0104635
500 Ga0395898_0034759
501 Ga0395898_0454663
502 Ga0395898_1830221
503 Ga0395905_0342604
504 Ga0395901_0066202
505 Ga0439436_0003208
506 Ga0439439_0002766
507 Ga0439465_0134194
508 Ga0451802_2066062
509 Ga0451835_0543101
510 Ga0451845_0821148
511 Ga0451851_0258721
512 Ga0451853_1497063
513 Ga0451853_1660674
514 Ga0451853_2844185
515 Ga0451853_3268851
516 Ga0439433_0008533
517 Ga0439433_0010475
518 Ga0439442_002559
519 Ga0439432_056602
520 Ga0439449_0024127
521 Ga0439449_0077559
522 Ga0439449_0108308
523 Ga0439450_065691
524 Ga0439455_0025193
525 Ga0439457_000971
526 Ga0439457_002037
527 Ga0439457_038757
528 Ga0439457_059261
529 Ga0439462_0201869
530 Ga0450894_000040
531 Ga0450898_003503
532 Ga0450899_000406
533 Ga0450903_001199
534 Ga0450906_006145
535 Ga0439458_0000531
536 Ga0439458_0036095
537 Ga0466969_0110465
538 Ga0466972_0017956
539 Ga0466972_0069699
540 Ga0466972_0533175
541 Ga0466965_0003354
542 Ga0466966_0000240
543 Ga0466966_0037560
544 Ga0466961_0000389
545 Ga0466961_0027828
546 Ga0466961_0696771
547 Ga0466963_0000267
548 Ga0466963_0122147
549 Ga0466964_0003106
550 Ga0466964_0212980
551 Ga0466971_0001898
552 Ga0466971_0168736
553 Ga0466968_0017995
554 Ga0466970_0006603
555 Ga0466970_0443389
556 Ga0466957_0002240
557 Ga0466960_0215504
558 Ga0466960_0321564
559 Ga0466960_0638581
560 Ga0466959_0000365
561 Ga0466959_0133370
562 Ga0466958_0005465
563 Ga0466967_0056407
564 Ga0466967_0104213
565 Ga0495627_009318
566 Ga0495592_0017403
567 Ga0495592_0033300
568 Ga0495603_0003165
569 Ga0495603_0031785
570 Ga0495590_0036994
571 Ga0495590_0042533
572 Ga0495629_0003183
573 Ga0495629_0008148
574 Ga0495629_0027801
575 Ga0495629_0096583
576 Ga0495629_0153819
577 Ga0495629_0267691
578 Ga0495638_0007665
579 Ga0495638_0246434
580 Ga0495651_0011653
581 Ga0495651_0118983
582 Ga0495582_0027475
583 Ga0495582_0152950
584 Ga0495582_0471460
585 Ga0495605_0006096
586 Ga0495605_0024611
587 Ga0495662_0017558
588 Ga0495662_0127673
589 Ga0495662_0430648
590 Ga0495664_0000502
591 Ga0495664_0012373
592 Ga0495584_0050960
593 Ga0495594_0041732
594 Ga0495594_0049547
595 Ga0495594_0058723
596 Ga0495594_0276325
597 Ga0495594_0531672
598 Ga0495596_0057790
599 Ga0495583_0048490
600 Ga0495583_0157059
601 Ga0495606_0053408
602 Ga0495606_0193674
603 Ga0495608_0035374
604 Ga0495608_0264026
605 Ga0495610_0024236
606 Ga0495610_0378619
607 Ga0495616_0015177
608 Ga0495618_0033336
609 Ga0495620_0003689
610 Ga0495620_0006863
611 Ga0495628_0022372
612 Ga0495630_0102871
613 Ga0495632_0116501
614 Ga0495643_0058939
615 Ga0495643_0191547
616 Ga0495643_0222595
617 Ga0495648_0035256
618 Ga0495666_0017901
619 Ga0495642_0064909
620 Ga0495652_0013439
621 Ga0495652_0174006
622 Ga0495654_0121139
623 Ga0495665_0083936
624 Ga0495640_0030528
625 Ga0495640_0048831
626 Ga0495640_0063692
627 Ga0495640_0439268
628 Ga0495587_0232186
629 Ga0495609_0008816
630 Ga0495597_0020581
631 Ga0495597_0105127
632 Ga0495645_0025650
633 Ga0495645_0115884
634 Ga0495622_0017095
635 Ga0495622_0088562
636 Ga0495622_0441246
637 Ga0495633_0208348
638 Ga0495667_0082281
639 Ga0495667_0156353
640 Ga0495668_0290127
641 Ga0495634_0005627
642 Ga0495634_0288916
643 Ga0495634_0533494
644 Ga0495611_0007220
645 Ga0495611_0012087
646 Ga0495611_0055427
647 Ga0495625_0016697
648 Ga0495625_0174279
649 Ga0495625_0273184
650 Ga0495625_0386776
651 Ga0495625_0475476
652 Ga0495635_0000582
653 Ga0495635_0014773
654 Ga0495661_0044257
655 Ga0495588_0024836
656 Ga0495588_0026793
657 Ga0495588_0030383
658 Ga0495657_0035400
659 Ga0495657_0039019
660 Ga0495623_0038805
661 Ga0495623_0089651
662 Ga0495646_0000421
663 Ga0495646_0161261
664 Ga0495658_0072579
665 Ga0495613_0002587
666 Ga0495613_0017086
667 Ga0495613_0031964
668 Ga0495613_0071498
669 Ga0495624_0069017
670 Ga0495624_0089046
671 Ga0495624_0126548
672 Ga0495671_0005930
673 Ga0495671_0218147
674 Ga0495649_0016766
675 Ga0495649_0212675
676 Ga0495589_0045108
677 Ga0495600_0014683
678 Ga0495600_0046751
679 Ga0495600_0110188
680 Ga0495660_0045082
681 Ga0495660_0147698
682 Ga0495581_0004441
683 Ga0495581_0027212
684 Ga0495581_0066957
685 Ga0495581_0080166
686 Ga0495581_0342916
687 Ga0495604_0000696
688 Ga0495604_0106645
689 Ga0495636_0017767
690 Ga0495636_0019433
691 Ga0495636_0046609
692 Ga0495636_0073897
693 Ga0495636_0193669
694 Ga0495674_0158206
695 Ga0495674_0276441
696 Ga0495672_0017495
697 Ga0495676_0000541
698 Ga0495676_0006647
699 Ga0495676_0030080
700 Ga0495676_0033854
701 Ga0495676_0142036
702 Ga0495676_0536889
703 Ga0495683_0095886
704 Ga0495687_001481
705 Ga0495687_009573
706 Ga0495687_018988
707 Ga0495687_134223
708 Ga0495675_0032437
709 Ga0495675_0051555
710 Ga0495675_0162751
711 Ga0495677_0080674
712 Ga0495685_003248
713 Ga0495685_003932
714 Ga0495685_020299
715 Ga0495685_026598
716 Ga0495685_106757
717 Ga0495685_268400
718 Ga0495681_0014284
719 Ga0495681_0044535
720 Ga0495681_0180352
721 Ga0495684_0204056
722 Ga0495686_0021868
723 Ga0495593_0000138
724 Ga0495593_0031416
725 Ga0495602_0067527
726 Ga0495614_0007691
727 Ga0495614_0014937
728 Ga0495614_0027261
729 Ga0495614_0062542
730 Ga0495626_0103069
731 Ga0495626_0197902
732 Ga0496109_0096429
733 Ga0496110_0209720
734 Ga0496111_0442102
735 Ga0495678_049291
736 Ga0495678_107114
737 Ga0501031_0332206
738 Ga0501032_0016514
739 Ga0501032_0259278
740 Ga0501033_0035364
741 Ga0501033_0049247
742 Ga0501033_0090118
743 Ga0501033_0575888
744 Ga0501034_0027494
745 Ga0501034_0034644
746 Ga0501034_0079169
747 Ga0501034_0112914
748 Ga0501034_0204483
749 Ga0501034_0218169
750 Ga0501036_0059141
751 Ga0501036_0082518
752 Ga0501036_0191732
753 Ga0501036_0476473
754 Ga0501036_0626876
755 Ga0501037_0054519
756 Ga0501037_0106615
757 Ga0501037_0144710
758 Ga0501037_0155950
759 Ga0501038_0045692
760 Ga0501038_0060500
761 Ga0501038_0072080
762 Ga0501038_0077679
763 Ga0501038_0160902
764 Ga0501038_0194498
765 Ga0501039_0087688
766 Ga0501039_0225727
767 Ga0501039_0273606
768 Ga0501039_0279056
769 Ga0501042_1319495
770 Ga0501043_0014482
771 Ga0501043_0035767
772 Ga0501043_0036303
773 Ga0501043_0077557
774 Ga0501043_0635360
775 Ga0501046_0045118
776 Ga0501046_0094447
777 Ga0501047_0035587
778 Ga0501047_0040478
779 Ga0501047_0074351
780 Ga0501047_0175471
781 Ga0501047_0221069
782 Ga0501047_0730856
783 Ga0501047_1379867
784 Ga0501048_0012799
785 Ga0501048_0993406
786 Ga0501067_0562709
787 Ga0501068_0146122
788 Ga0501068_0150590
789 Ga0501070_0003785
790 Ga0501070_0239760
791 Ga0501070_0611826
792 Ga0501070_0782653
793 Ga0501072_0309937
794 Ga0501073_0128062
795 Ga0501073_0217245
796 Ga0501073_0349983
797 Ga0501074_0007152
798 Ga0501074_0779447
799 Ga0501257_016803
800 Ga0501080_0099635
801 Ga0501083_0569006
802 Ga0501035_0026858
803 Ga0501035_0035671
804 Ga0501035_0049418
805 Ga0501035_0089924
806 Ga0501035_0133395
807 Ga0501035_0173398
808 Ga0501044_0019710
809 Ga0501044_0035413
810 Ga0501044_0066386
811 Ga0501044_0082533
812 Ga0501044_0120226
813 Ga0501044_0266716
814 Ga0501044_0588194
815 Ga0501045_0443356
816 Ga0501045_0700435
817 nmdc:mga06z11_103571_c1
818 nmdc:mga06z11_1179_c1
819 nmdc:mga07m45_17626_c1
820 Ga0495612_0009457
821 Ga0495619_0247340
822 Ga0500583_0292757
823 Ga0500640_037752
824 Ga0500650_0451082
825 Ga0500553_074418
826 Ga0500560_003067
827 Ga0500572_005335
828 Ga0500608_093780
829 Ga0500614_061313
830 Ga0500618_030975
831 Ga0500655_097605
832 Ga0500579_096016
833 Ga0500600_0080834
834 Ga0500624_001051
835 Ga0500633_0377498
836 Ga0500634_0217410
837 Ga0466962_0001206
838 Ga0466962_0204419
839 2784590603
840 2616699981
841 2643761493
842 2644458806
843 2785340983
844 2793983716
845 2811845921
846 2862389207
847 2863408851
848 2868091523
849 2990061096
850 2997603977
851 8008563020
852 8047895854
853 8048363080
854 8048372878
855 8048381812
856 8048409226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

60

149

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yyv-assembly1.cif.gz_B putative transcriptional regulator ytfh from salmonella typhimurium 0.9526 15 123
1yyv-assembly1.cif.gz_B putative transcriptional regulator ytfh from salmonella typhimurium 0.9202 15 123
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9066 21 113
4a5n-assembly2.cif.gz_D redoxregulator hypr in its reduced form 0.906 22 120
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.8996 23 120
ID Description Score Start End Superfamily
af_P0ACN2_1_125_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9759 15 125 1.10.10.10
1yyvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9499 15 123 1.10.10.10
1yyvB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 15 123 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8987 38 93 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8873 38 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4ZCZ5-F1-model_v4 Transcriptional regulator 0.996 15 118 GO:0003677
AF-A0A367F9D2-F1-model_v4 Transcriptional regulator 0.9941 11 128 GO:0003677
AF-A0A2S7EWN3-F1-model_v4 Transcriptional regulator 0.9932 15 121 GO:0003677
AF-A0A3M5VND0-F1-model_v4 deleted 0.993 15 128
AF-A0A1H9U7R9-F1-model_v4 Transcriptional regulator, HxlR family 0.9929 12 127 GO:0003677

Map