F441802

General Info

Members Datasets Scaffolds Average Seq Length
428 346 856 314

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889914905|2889919184
Length 346
Sequence ELAEGAHHEGGVPPPHLQEQTLNPMPTIAPLDLDAHCVAAAWLNDIPHFALADGVIHRLDHGHKRVEAHDGLLAAAPDGTRLVTGGEDGKVVAVLPDGSVELLAEVGRKWVTSVAAGPQGAVAFASGRIAYVRFADGRLREFQHPRSVEGLAFAPKGMRLAVARYNGATLHFPATEGKPAELEWAGAHMGITFSPDGRFLVTTMQENALHGWKLADGKHMRMAGYPVKVKSFSWSAKGRWLATSGAPAAIVWPFQAKDGPMGKTPLELGTRGDAMVTHVCCHPIEEIVAIGYADGMVLAARFADQKEVLLRRPGKGAVTAMSWDGEGRRLAFGCETGECGVVDISA

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
13 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
14 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
15 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
16 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
20 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
21 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
22 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
23 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
24 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
25 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
27 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
28 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
29 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
30 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
31 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
32 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
33 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
34 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
35 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
36 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
37 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
38 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
39 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
40 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
41 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
45 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
46 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
47 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
48 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
50 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
54 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
55 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
56 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
57 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
58 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
59 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
60 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
61 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
63 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
64 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
65 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
66 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
67 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
68 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
69 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
70 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
71 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
72 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
73 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
74 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
75 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
76 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
77 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
78 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
79 2512875024
80 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
81 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
82 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
83 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
84 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
85 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
86 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
87 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
88 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
89 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
90 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
91 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
92 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
93 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
94 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
95 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
96 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
97 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
98 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
99 2738543024 Aminobacter sp. AP02 Isolate Unclassified
100 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
101 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
102 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
103 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
104 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
105 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
106 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
107 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
108 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
109 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
110 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
111 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
112 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
113 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
114 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
115 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
116 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
117 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
118 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
119 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
120 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
121 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
122 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
123 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
124 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
125 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
126 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
127 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
128 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
129 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
130 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
131 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
132 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
133 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
134 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
135 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
136 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
137 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
138 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
139 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
140 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
141 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
142 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
143 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
144 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
145 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
146 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
147 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
148 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
149 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
150 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
151 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
152 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
153 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
154 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
155 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
156 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
157 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
158 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
159 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
160 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
161 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
162 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
163 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
164 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
165 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
166 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
167 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
168 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
169 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
170 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
171 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
172 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
173 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
174 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
175 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
176 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
177 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
178 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
179 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
180 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
181 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
182 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
183 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
184 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
185 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
186 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
187 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
188 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
189 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
190 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
191 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
192 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
193 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
194 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
195 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
196 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
197 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
198 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
199 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
200 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
201 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
202 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
203 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
204 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
205 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
206 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
207 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
208 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
209 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
210 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
211 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
212 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
213 2936381700 Rhizobium chutanense C16 Isolate Unclassified
214 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
215 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
216 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
217 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
218 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
219 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
220 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
221 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
222 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
223 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
224 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
225 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
226 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
227 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
228 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
229 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
230 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
231 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
232 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
233 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
234 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
235 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
236 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
237 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
238 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
239 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
240 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
241 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
242 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
243 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
244 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
245 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
246 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
247 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
248 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
249 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
250 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
251 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
252 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
253 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
254 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
255 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
256 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
257 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
258 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
259 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
260 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
261 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
262 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
263 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
264 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
265 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
266 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
267 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
268 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
269 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
270 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
271 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
272 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
273 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
274 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
275 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
276 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
277 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
278 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
279 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
280 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
281 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
282 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
283 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
284 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
285 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
286 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
287 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
288 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
289 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
290 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
291 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
292 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
293 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
294 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
295 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
296 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
297 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
298 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
299 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
300 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
301 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
302 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
303 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
304 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
305 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
306 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
307 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
308 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
309 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
310 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
311 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
312 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
313 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
314 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
315 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
316 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
317 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
318 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
319 3004167301 Mesorhizobium loti 582 Isolate Unclassified
320 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
321 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
322 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
323 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
324 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
325 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
326 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
327 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
328 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
329 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
330 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
331 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
332 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
333 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
334 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
335 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
336 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
337 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
338 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
339 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
340 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
341 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
342 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
343 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
344 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
345 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
346 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 35.28
Metatranscriptomes 0.23
Isolates 64.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 52.8
Rhizoplane 0.47
Rhizosphere 29.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10007364 3300003187 Bacteria 5405
2 JGI25165J46597_1000147 3300003214 Bacteria 116564
3 JGI25160J50197_1001518 3300003354 Bacteria 11518
4 Ga0070659_100050908 3300005366 Bacteria 3256
5 Ga0070663_100041361 3300005455 Bacteria 3232
6 Ga0070663_100095456 3300005455 Bacteria 2210
7 Ga0070681_10039433 3300005458 Bacteria 4735
8 Ga0070665_100186034 3300005548 Bacteria 2078
9 Ga0081455_10001738 3300005937 Bacteria 26328
10 Ga0081538_10009993 3300005981 Bacteria 7826
11 Ga0075365_10013154 3300006038 Bacteria 4936
12 Ga0075365_10015248 3300006038 Bacteria 4644
13 Ga0075367_10008411 3300006178 Bacteria 5345
14 Ga0075367_10027829 3300006178 Bacteria 3219
15 Ga0182005_1008171 3300015265 Bacteria 3097
16 Ga0209233_1000034 3300025261 Bacteria 578898
17 Ga0209025_1000052 3300025294 Bacteria 324648
18 Ga0209564_1000503 3300025295 Bacteria 64437
19 Ga0209564_1008843 3300025295 Bacteria 4900
20 Ga0207650_10000203 3300025925 Bacteria 68710
21 Ga0207690_10179635 3300025932 Bacteria 1592
22 Ga0268266_10053560 3300028379 Bacteria 3467
23 Ga0265330_10057106 3300031235 Bacteria 1703
24 Ga0265340_10001277 3300031247 Bacteria 14437
25 Ga0265331_10025120 3300031250 Bacteria 3009
26 Ga0265316_10010284 3300031344 Bacteria 8533
27 Ga0265313_10000448 3300031595 Bacteria 43625
28 Ga0265314_10105583 3300031711 Bacteria 1801
29 Ga0316593_10011674 3300032168 Bacteria 2560
30 Ga0495648_0002080 3300046524 Bacteria 18945
31 Ga0495668_0118460 3300046616 Bacteria 1448
32 Ga0495661_0004641 3300046665 Bacteria 9884
33 Ga0495660_0080574 3300046810 Bacteria 1708
34 Ga0495686_0210554 3300047472 Bacteria 1111
35 Ga0496116_0005695 3300048919 Bacteria 11461
36 Ga0496117_0010892 3300048920 Bacteria 8199
37 Ga0496117_0012118 3300048920 Bacteria 7645
38 Ga0496117_0071447 3300048920 Bacteria 2325
39 Ga0496118_0033560 3300048921 Bacteria 4208
40 Ga0496118_0073986 3300048921 Bacteria 2437
41 Ga0496122_0000024 3300048925 Bacteria 372400
42 Ga0496122_0011607 3300048925 Bacteria 8893
43 Ga0496123_0000086 3300048926 Bacteria 183266
44 Ga0496123_0025052 3300048926 Bacteria 4509
45 Ga0496124_0001738 3300048927 Bacteria 30551
46 Ga0496125_0000099 3300048928 Bacteria 203333
47 Ga0496125_0003103 3300048928 Bacteria 20706
48 Ga0496125_0008703 3300048928 Bacteria 10564
49 Ga0496126_0001430 3300048929 Bacteria 37517
50 Ga0501031_0000006 3300049568 Bacteria 176019
51 Ga0501031_0049257 3300049568 Bacteria 2746
52 Ga0501031_0095994 3300049568 Bacteria 1934
53 Ga0501032_0000016 3300049569 Bacteria 174688
54 Ga0501032_0000324 3300049569 Bacteria 39970
55 Ga0501032_0044642 3300049569 Bacteria 2999
56 Ga0501033_0000101 3300049570 Bacteria 81870
57 Ga0501033_0001367 3300049570 Bacteria 21762
58 Ga0501033_0004328 3300049570 Bacteria 11391
59 Ga0501033_0015133 3300049570 Bacteria 5853
60 Ga0501033_0019191 3300049570 Bacteria 5170
61 Ga0501033_0049759 3300049570 Bacteria 3111
62 Ga0501033_0069853 3300049570 Bacteria 2581
63 Ga0501034_0000153 3300049571 Bacteria 129892
64 Ga0501034_0000168 3300049571 Bacteria 122667
65 Ga0501034_0011175 3300049571 Bacteria 9319
66 Ga0501034_0122598 3300049571 Bacteria 2585
67 Ga0501034_0174659 3300049571 Bacteria 2115
68 Ga0501034_0384201 3300049571 Bacteria 1328
69 Ga0501036_0000019 3300049572 Bacteria 118632
70 Ga0501036_0038168 3300049572 Bacteria 4064
71 Ga0501036_0063256 3300049572 Bacteria 3133
72 Ga0501037_0000013 3300049573 Bacteria 174688
73 Ga0501037_0000895 3300049573 Bacteria 22218
74 Ga0501037_0006978 3300049573 Bacteria 8249
75 Ga0501037_0139805 3300049573 Bacteria 1733
76 Ga0501037_0140063 3300049573 Bacteria 1732
77 Ga0501038_0000012 3300049574 Bacteria 174688
78 Ga0501038_0000033 3300049574 Bacteria 129840
79 Ga0501038_0065524 3300049574 Bacteria 3094
80 Ga0501038_0073588 3300049574 Bacteria 2893
81 Ga0501038_0186570 3300049574 Bacteria 1671
82 Ga0501039_0000019 3300049575 Bacteria 174688
83 Ga0501039_0000031 3300049575 Bacteria 129814
84 Ga0501039_0143802 3300049575 Bacteria 1874
85 Ga0501040_0073454 3300049576 Bacteria 2363
86 Ga0501042_0060548 3300049578 Bacteria 2704
87 Ga0501042_0225668 3300049578 Bacteria 1351
88 Ga0501043_0000044 3300049579 Bacteria 114304
89 Ga0501043_0000055 3300049579 Bacteria 105522
90 Ga0501043_0000209 3300049579 Bacteria 53858
91 Ga0501043_0100584 3300049579 Bacteria 2272
92 Ga0501043_0162266 3300049579 Bacteria 1746
93 Ga0501046_0102521 3300049580 Bacteria 2194
94 Ga0501047_0003738 3300049581 Bacteria 14331
95 Ga0501047_0005318 3300049581 Bacteria 12095
96 Ga0501047_0172620 3300049581 Bacteria 2030
97 Ga0501047_0187636 3300049581 Bacteria 1932
98 Ga0501047_0323844 3300049581 Bacteria 1380
99 Ga0501048_0087363 3300049582 Bacteria 2200
100 Ga0501067_0074036 3300049583 Bacteria 1887
101 Ga0501067_0166867 3300049583 Bacteria 1226
102 Ga0501068_0007109 3300049584 Bacteria 6194
103 Ga0501068_0135822 3300049584 Bacteria 1540
104 Ga0501069_0000007 3300049585 Bacteria 182820
105 Ga0501069_0002137 3300049585 Bacteria 9953
106 Ga0501070_0000758 3300049586 Bacteria 29461
107 Ga0501070_0005272 3300049586 Bacteria 11026
108 Ga0501070_0023815 3300049586 Bacteria 5132
109 Ga0501070_0028060 3300049586 Bacteria 4720
110 Ga0501070_0029463 3300049586 Bacteria 4602
111 Ga0501070_0052772 3300049586 Bacteria 3374
112 Ga0501070_0190287 3300049586 Bacteria 1687
113 Ga0501073_0009535 3300049589 Bacteria 7164
114 Ga0501073_0018929 3300049589 Bacteria 4976
115 Ga0501074_0000047 3300049590 Bacteria 57039
116 Ga0501074_0007185 3300049590 Bacteria 8042
117 Ga0501080_0005487 3300049742 Bacteria 11319
118 Ga0501080_0017422 3300049742 Bacteria 6643
119 Ga0501080_0045543 3300049742 Bacteria 4083
120 Ga0501080_0171575 3300049742 Bacteria 2000
121 Ga0501080_0247415 3300049742 Bacteria 1626
122 Ga0501083_0002704 3300049744 Bacteria 12233
123 Ga0501083_0027434 3300049744 Bacteria 3929
124 Ga0501083_0085456 3300049744 Bacteria 2087
125 Ga0501035_0000060 3300049822 Bacteria 132293
126 Ga0501035_0000081 3300049822 Bacteria 117453
127 Ga0501035_0000467 3300049822 Bacteria 45324
128 Ga0501035_0000707 3300049822 Bacteria 36103
129 Ga0501035_0001528 3300049822 Bacteria 23579
130 Ga0501035_0084993 3300049822 Bacteria 2790
131 Ga0501044_0000009 3300049823 Bacteria 270072
132 Ga0501044_0000029 3300049823 Bacteria 176024
133 Ga0501044_0008818 3300049823 Bacteria 11030
134 Ga0501044_0019308 3300049823 Bacteria 7293
135 Ga0501044_0083795 3300049823 Bacteria 3223
136 Ga0501044_0108293 3300049823 Bacteria 2789
137 Ga0501044_0118444 3300049823 Bacteria 2651
138 Ga0501044_0211823 3300049823 Bacteria 1892
139 Ga0501044_0224486 3300049823 Bacteria 1828
140 Ga0501044_0261008 3300049823 Bacteria 1671
141 Ga0501044_0349565 3300049823 Bacteria 1398
142 nmdc:mga00v17_63289_c1 3300050491 Bacteria 2278
143 nmdc:mga0yw44_15192_c1 3300050492 Bacteria 4115
144 nmdc:mga0yw44_59489_c1 3300050492 Bacteria 2338
145 nmdc:mga06z11_133116_c1 3300050494 Bacteria 1398
146 nmdc:mga06z11_5590_c1 3300050494 Bacteria 5054
147 nmdc:mga07m45_24553_c1 3300050496 Bacteria 3304
148 nmdc:mga0sz30_8212_c2 3300050516 Bacteria 3303
149 Ga0500614_026228 3300053123 Bacteria 1392
150 Ga0500568_0000035 3300053139 Bacteria 137912
151 Ga0501084_0182120 3300054114 Bacteria 1773
152 Ga0501082_0154555 3300060353 Bacteria 1993
153 2889919184 2889914905 Bacteria 5702301
154 2503198341 2503198000 Bacteria 6884444
155 2509140040 2508501127 Bacteria 7037543
156 2509368406 2509276018 Bacteria 6910194
157 2509393252 2509276022 Bacteria 6200534
158 2510314689 2510065059 Bacteria 6847884
159 2512934183 2512875016 Bacteria 6529530
160 2512962484 2512875024 Bacteria 7195110
161 2513613401 2513237090 Bacteria 7096802
162 2514037879 2513237164 Bacteria 7563725
163 2514419264 2513237305 Bacteria 7293571
164 2514587352 2513237351 Bacteria 6968952
165 2588520332 2588253730 Bacteria 6881675
166 2597810523 2597489875 Bacteria 7010078
167 2599935453 2599185301 Bacteria 6161860
168 2603860651 2602042107 Bacteria 6226103
169 2643772422 2643221550 Bacteria 4619371
170 2643774511 2643221551 Bacteria 3750538
171 2643792956 2643221555 Bacteria 3749717
172 2643838336 2643221564 Bacteria 4193379
173 2643983909 2643221595 Bacteria 6565519
174 2644133360 2643221623 Bacteria 5239945
175 2644156039 2643221627 Bacteria 6761570
176 2688595662 2687453392 Bacteria 6880454
177 2694628174 2693429783 Bacteria 7019804
178 2694640969 2693429784 Bacteria 7241525
179 2723572924 2721755686 Bacteria 7343952
180 2739309529 2738543024 Bacteria 5603683
181 2756674251 2756170246 Bacteria 7451806
182 2792746851 2791355123 Bacteria 8049106
183 2793281605 2791355253 Bacteria 5171699
184 2837679344 2837678835 Bacteria 5252418
185 2837682822 2837678835 Bacteria 5252418
186 2841736086 2841734538 Bacteria 6784580
187 2844003805 2844002411 Bacteria 7168230
188 2844010463 2844009547 Bacteria 6728125
189 2847673192 2847670302 Bacteria 6165597
190 2847689705 2847686936 Bacteria 6278406
191 2856319775 2856314179 Bacteria 6477897
192 2856320905 2856320880 Bacteria 7263508
193 2856332855 2856328259 Bacteria 6528202
194 2856340236 2856334872 Bacteria 7037011
195 2856342161 2856342000 Bacteria 7176905
196 2856350938 2856349417 Bacteria 6230045
197 2857352634 2857349434 Bacteria 7926032
198 2857371104 2857367948 Bacteria 6965560
199 2857525610 2857524615 Bacteria 6615449
200 2869165856 2869162929 Bacteria 6399702
201 2869174564 2869169390 Bacteria 6659796
202 2869237704 2869234852 Bacteria 6654993
203 2869242660 2869242130 Bacteria 6609239
204 2869254929 2869249662 Bacteria 6868783
205 2869260704 2869256925 Bacteria 6981691
206 2869267215 2869264136 Bacteria 6880765
207 2869273762 2869271264 Bacteria 6908218
208 2869280151 2869278585 Bacteria 7077053
209 2871435960 2871435913 Bacteria 6880295
210 2871444152 2871444079 Bacteria 6423508
211 2871453331 2871451962 Bacteria 7336357
212 2871466861 2871459585 Bacteria 6866887
213 2871467309 2871466892 Bacteria 6923287
214 2871475051 2871474448 Bacteria 6806570
215 2871486113 2871481445 Bacteria 6700002
216 2871491158 2871488783 Bacteria 6929816
217 2871498926 2871495908 Bacteria 6935695
218 2874105447 2874102143 Bacteria 6342645
219 2874114646 2874109183 Bacteria 6517025
220 2874119320 2874116593 Bacteria 6674494
221 2874131438 2874123672 Bacteria 7238285
222 2874132970 2874131515 Bacteria 6820270
223 2874143297 2874139085 Bacteria 7021506
224 2874164772 2874162495 Bacteria 6174670
225 2874172077 2874168670 Bacteria 8062617
226 2876363556 2876363079 Bacteria 6544991
227 2876383434 2876377896 Bacteria 6565995
228 2876391366 2876386047 Bacteria 6698674
229 2876397329 2876392853 Bacteria 6660880
230 2876403937 2876399893 Bacteria 6927900
231 2876407576 2876406927 Bacteria 6191900
232 2876426060 2876420981 Bacteria 6687741
233 2878039728 2878035449 Bacteria 6555736
234 2878733503 2878730984 Bacteria 6380721
235 2878740637 2878738818 Bacteria 7136951
236 2878755567 2878753008 Bacteria 6922523
237 2878763139 2878760144 Bacteria 6823465
238 2878770114 2878767105 Bacteria 6898628
239 2878780061 2878774303 Bacteria 6108671
240 2878788604 2878781027 Bacteria 6834456
241 2878796076 2878788777 Bacteria 6567085
242 2881147908 2881147464 Bacteria 7779814
243 2881159059 2881155292 Bacteria 6461656
244 2881164688 2881161766 Bacteria 7127907
245 2881847582 2881845957 Bacteria 6611900
246 2881859588 2881853255 Bacteria 6698367
247 2881867249 2881861095 Bacteria 7128710
248 2882634705 2882632389 Bacteria 8154593
249 2882918186 2882912400 Bacteria 6801539
250 2885306530 2885305155 Bacteria 7348390
251 2885314458 2885312484 Bacteria 6415165
252 2885321429 2885318864 Bacteria 6729568
253 2885329976 2885326080 Bacteria 7134805
254 2885337194 2885334103 Bacteria 7216818
255 2885343787 2885342637 Bacteria 7011821
256 2885352212 2885350715 Bacteria 6787678
257 2888343006 2888337043 Bacteria 6629336
258 2888344057 2888343758 Bacteria 6611049
259 2888352816 2888350351 Bacteria 7372807
260 2889014593 2889010040 Bacteria 6749192
261 2889020427 2889016732 Bacteria 6700763
262 2889795624 2889790730 Bacteria 5689708
263 2891377496 2891373044 Bacteria 5202277
264 2903454359 2903448605 Bacteria 7357801
265 2903498958 2903492973 Bacteria 13473544
266 2903517991 2903513507 Bacteria 6344008
267 2903525506 2903521522 Bacteria 6525694
268 2903531749 2903528002 Bacteria 6586099
269 2903543725 2903540706 Bacteria 7062119
270 2904664083 2904659560 Bacteria 6685615
271 2906334899 2906328253 Bacteria 6585166
272 2906356508 2906354277 Bacteria 6991324
273 2906366586 2906363423 Bacteria 6856682
274 2906375579 2906370794 Bacteria 6881062
275 2906385372 2906378014 Bacteria 6911440
276 2906398202 2906393657 Bacteria 6790866
277 2906404014 2906401398 Bacteria 6693206
278 2906411284 2906408224 Bacteria 6162342
279 2906420551 2906414383 Bacteria 6580790
280 2919074582 2919073203 Bacteria 6531949
281 2922132471 2922130491 Bacteria 7173936
282 2922155075 2922151315 Bacteria 6902399
283 2922162959 2922158528 Bacteria 6573167
284 2922177900 2922172374 Bacteria 6167644
285 2922180884 2922178524 Bacteria 6025201
286 2922193213 2922185730 Bacteria 7113964
287 2924715774 2924710171 Bacteria 6752351
288 2924730219 2924726620 Bacteria 6271473
289 2924736651 2924733363 Bacteria 7574837
290 2924743822 2924741084 Bacteria 6661321
291 2924751748 2924748358 Bacteria 6154725
292 2924764001 2924762789 Bacteria 6561353
293 2924778238 2924776078 Bacteria 7492003
294 2924785557 2924784321 Bacteria 7416538
295 2936382298 2936381700 Bacteria 7006523
296 2937826388 2937822353 Bacteria 7290551
297 2937836678 2937836603 Bacteria 6811263
298 2937847802 2937843397 Bacteria 5256375
299 2937854667 2937848649 Bacteria 6983481
300 2937863924 2937861824 Bacteria 6660327
301 2937876601 2937868953 Bacteria 6639878
302 2937878333 2937877337 Bacteria 7246526
303 2937892203 2937891427 Bacteria 6357007
304 2937980245 2937972304 Bacteria 7532020
305 2937980723 2937980651 Bacteria 6517427
306 2937997574 2937994558 Bacteria 7036190
307 2938018146 2938014810 Bacteria 6700592
308 2939672385 2939669807 Bacteria 5028511
309 2958036017 2958034702 Bacteria 6989922
310 2958045323 2958041894 Bacteria 13082850
311 2958068004 2958064165 Bacteria 7158582
312 2958076047 2958071322 Bacteria 6815895
313 2958085449 2958084443 Bacteria 7312792
314 2958097248 2958092219 Bacteria 6861151
315 2958101747 2958100919 Bacteria 6800575
316 2958108699 2958108152 Bacteria 6681128
317 2958119408 2958115193 Bacteria 6923548
318 2958127168 2958122699 Bacteria 7280457
319 2958139593 2958137437 Bacteria 6050276
320 2958145250 2958144490 Bacteria 6677056
321 2958161422 2958158011 Bacteria 6058449
322 2958168047 2958165035 Bacteria 6906348
323 2958177768 2958172287 Bacteria 6716688
324 2961118777 2961114664 Bacteria 6680456
325 2961130899 2961127735 Bacteria 7196641
326 2961142936 2961136820 Bacteria 6775228
327 2961166513 2961163497 Bacteria 6901077
328 2961176489 2961170736 Bacteria 7072258
329 2961190405 2961183825 Bacteria 6688536
330 2963645016 2963644680 Bacteria 6530403
331 2965021333 2965018300 Bacteria 6883036
332 2965030302 2965025482 Bacteria 6532201
333 2965034337 2965032056 Bacteria 6887443
334 2965041661 2965040258 Bacteria 6855979
335 2965054057 2965047637 Bacteria 6623551
336 2965064005 2965062239 Bacteria 7412989
337 2965095636 2965089291 Bacteria 6866420
338 2965104876 2965102966 Bacteria 6800987
339 2965112800 2965110997 Bacteria 6693150
340 2965123666 2965119406 Bacteria 6956431
341 2968001494 2967996073 Bacteria 6787468
342 2968007547 2968003550 Bacteria 6929263
343 2968017270 2968016561 Bacteria 7022047
344 2968088700 2968083720 Bacteria 7351627
345 2968093840 2968091066 Bacteria 6052692
346 2968097735 2968097103 Bacteria 6107094
347 2968115222 2968110612 Bacteria 6814636
348 2968121980 2968117919 Bacteria 6536078
349 2968134119 2968128360 Bacteria 6270294
350 2968146311 2968138860 Bacteria 6605449
351 2968174917 2968171901 Bacteria 6894245
352 2970470627 2970469710 Bacteria 6969209
353 2970490155 2970489779 Bacteria 6517260
354 2970509160 2970503327 Bacteria 7099517
355 2970516815 2970510686 Bacteria 7006402
356 2970525759 2970524798 Bacteria 6840927
357 2970536582 2970532167 Bacteria 6553173
358 2970546775 2970540015 Bacteria 6977556
359 2970550479 2970547951 Bacteria 6931819
360 2970557987 2970554993 Bacteria 6814252
361 2970594748 2970593180 Bacteria 7073582
362 2970622363 2970619444 Bacteria 6986144
363 2970632783 2970627176 Bacteria 6680862
364 2977824707 2977821940 Bacteria 6906439
365 2977833644 2977828996 Bacteria 7007971
366 2977857268 2977851361 Bacteria 6694324
367 2977864357 2977858184 Bacteria 6215359
368 2977866498 2977864932 Bacteria 7534097
369 2977873705 2977872689 Bacteria 7270173
370 2977898858 2977898635 Bacteria 6675551
371 2977908964 2977907340 Bacteria 6577984
372 2977915606 2977915119 Bacteria 6829656
373 2977925855 2977922695 Bacteria 6956781
374 2977939526 2977935797 Bacteria 6252826
375 2977944157 2977942078 Bacteria 7570577
376 2977951507 2977950692 Bacteria 6893264
377 2977963431 2977957713 Bacteria 6877875
378 2977971620 2977971508 Bacteria 7472917
379 2977991614 2977986579 Bacteria 6581278
380 2979713957 2979710463 Bacteria 6785254
381 2979748891 2979742915 Bacteria 7301278
382 2979765517 2979764755 Bacteria 6610066
383 2979775321 2979772303 Bacteria 6618277
384 2979783153 2979779861 Bacteria 6219781
385 2979800160 2979793036 Bacteria 6808957
386 2979813839 2979808191 Bacteria 7179355
387 2987641227 2987636660 Bacteria 8088555
388 2987649512 2987645492 Bacteria 6117018
389 2987654178 2987652177 Bacteria 6969023
390 2987662523 2987659509 Bacteria 6966464
391 2987667537 2987666974 Bacteria 6509233
392 2987677274 2987673487 Bacteria 6884027
393 2989354632 2989349275 Bacteria 6349068
394 2989773555 2989771324 Bacteria 5605128
395 2996311818 2996310559 Bacteria 6357320
396 2996338537 2996336353 Bacteria 5511628
397 2996346810 2996341866 Bacteria 6643098
398 2996349933 2996348954 Bacteria 7239054
399 2996391643 2996386984 Bacteria 6978667
400 3000142571 3000135777 Bacteria 6891109
401 3004172877 3004167301 Bacteria 8330599
402 3004191573 3004188549 Bacteria 6952365
403 3004198183 3004195979 Bacteria 6776956
404 3004210034 3004203850 Bacteria 7307914
405 3004216409 3004211236 Bacteria 7417683
406 3004218620 3004218560 Bacteria 7421728
407 3004239433 3004232784 Bacteria 6662140
408 3004243426 3004239961 Bacteria 6892290
409 3004251100 3004248173 Bacteria 6563236
410 3004272542 3004268573 Bacteria 7043476
411 3004276635 3004275668 Bacteria 7114440
412 3004337738 3004334049 Bacteria 8449246
413 637077335 637000159 Bacteria 7596297
414 649870229 649633066 Bacteria 6690028
415 8002287110 8002285264 Bacteria 6717907
416 8004302641 8004300914 Bacteria 6132239
417 8004316422 8004312739 Bacteria 7444653
418 8004363858 8004361976 Bacteria 6858373
419 8004377146 8004374579 Bacteria 6898112
420 8004402472 8004395343 Bacteria 6620908
421 8004451496 8004445564 Bacteria 6322258
422 8004637729 8004633249 Bacteria 6723080
423 8004644230 8004640170 Bacteria 6723001
424 8004701893 8004695233 Bacteria 6731676
425 8004706992 8004703790 Bacteria 8006957
426 8004729030 8004727605 Bacteria 6643904
427 8054563065 8054558443 Bacteria 5204801
428 8055617572 8055617313 Bacteria 7548464
429 JGI25151J46595_10007364
430 JGI25165J46597_1000147
431 JGI25160J50197_1001518
432 Ga0070659_100050908
433 Ga0070663_100041361
434 Ga0070663_100095456
435 Ga0070681_10039433
436 Ga0070665_100186034
437 Ga0081455_10001738
438 Ga0081538_10009993
439 Ga0075365_10013154
440 Ga0075365_10015248
441 Ga0075367_10008411
442 Ga0075367_10027829
443 Ga0182005_1008171
444 Ga0209233_1000034
445 Ga0209025_1000052
446 Ga0209564_1000503
447 Ga0209564_1008843
448 Ga0207650_10000203
449 Ga0207690_10179635
450 Ga0268266_10053560
451 Ga0265330_10057106
452 Ga0265340_10001277
453 Ga0265331_10025120
454 Ga0265316_10010284
455 Ga0265313_10000448
456 Ga0265314_10105583
457 Ga0316593_10011674
458 Ga0495648_0002080
459 Ga0495668_0118460
460 Ga0495661_0004641
461 Ga0495660_0080574
462 Ga0495686_0210554
463 Ga0496116_0005695
464 Ga0496117_0010892
465 Ga0496117_0012118
466 Ga0496117_0071447
467 Ga0496118_0033560
468 Ga0496118_0073986
469 Ga0496122_0000024
470 Ga0496122_0011607
471 Ga0496123_0000086
472 Ga0496123_0025052
473 Ga0496124_0001738
474 Ga0496125_0000099
475 Ga0496125_0003103
476 Ga0496125_0008703
477 Ga0496126_0001430
478 Ga0501031_0000006
479 Ga0501031_0049257
480 Ga0501031_0095994
481 Ga0501032_0000016
482 Ga0501032_0000324
483 Ga0501032_0044642
484 Ga0501033_0000101
485 Ga0501033_0001367
486 Ga0501033_0004328
487 Ga0501033_0015133
488 Ga0501033_0019191
489 Ga0501033_0049759
490 Ga0501033_0069853
491 Ga0501034_0000153
492 Ga0501034_0000168
493 Ga0501034_0011175
494 Ga0501034_0122598
495 Ga0501034_0174659
496 Ga0501034_0384201
497 Ga0501036_0000019
498 Ga0501036_0038168
499 Ga0501036_0063256
500 Ga0501037_0000013
501 Ga0501037_0000895
502 Ga0501037_0006978
503 Ga0501037_0139805
504 Ga0501037_0140063
505 Ga0501038_0000012
506 Ga0501038_0000033
507 Ga0501038_0065524
508 Ga0501038_0073588
509 Ga0501038_0186570
510 Ga0501039_0000019
511 Ga0501039_0000031
512 Ga0501039_0143802
513 Ga0501040_0073454
514 Ga0501042_0060548
515 Ga0501042_0225668
516 Ga0501043_0000044
517 Ga0501043_0000055
518 Ga0501043_0000209
519 Ga0501043_0100584
520 Ga0501043_0162266
521 Ga0501046_0102521
522 Ga0501047_0003738
523 Ga0501047_0005318
524 Ga0501047_0172620
525 Ga0501047_0187636
526 Ga0501047_0323844
527 Ga0501048_0087363
528 Ga0501067_0074036
529 Ga0501067_0166867
530 Ga0501068_0007109
531 Ga0501068_0135822
532 Ga0501069_0000007
533 Ga0501069_0002137
534 Ga0501070_0000758
535 Ga0501070_0005272
536 Ga0501070_0023815
537 Ga0501070_0028060
538 Ga0501070_0029463
539 Ga0501070_0052772
540 Ga0501070_0190287
541 Ga0501073_0009535
542 Ga0501073_0018929
543 Ga0501074_0000047
544 Ga0501074_0007185
545 Ga0501080_0005487
546 Ga0501080_0017422
547 Ga0501080_0045543
548 Ga0501080_0171575
549 Ga0501080_0247415
550 Ga0501083_0002704
551 Ga0501083_0027434
552 Ga0501083_0085456
553 Ga0501035_0000060
554 Ga0501035_0000081
555 Ga0501035_0000467
556 Ga0501035_0000707
557 Ga0501035_0001528
558 Ga0501035_0084993
559 Ga0501044_0000009
560 Ga0501044_0000029
561 Ga0501044_0008818
562 Ga0501044_0019308
563 Ga0501044_0083795
564 Ga0501044_0108293
565 Ga0501044_0118444
566 Ga0501044_0211823
567 Ga0501044_0224486
568 Ga0501044_0261008
569 Ga0501044_0349565
570 nmdc:mga00v17_63289_c1
571 nmdc:mga0yw44_15192_c1
572 nmdc:mga0yw44_59489_c1
573 nmdc:mga06z11_133116_c1
574 nmdc:mga06z11_5590_c1
575 nmdc:mga07m45_24553_c1
576 nmdc:mga0sz30_8212_c2
577 Ga0500614_026228
578 Ga0500568_0000035
579 Ga0501084_0182120
580 Ga0501082_0154555
581 2889919184
582 2503198341
583 2509140040
584 2509368406
585 2509393252
586 2510314689
587 2512934183
588 2512962484
589 2513613401
590 2514037879
591 2514419264
592 2514587352
593 2588520332
594 2597810523
595 2599935453
596 2603860651
597 2643772422
598 2643774511
599 2643792956
600 2643838336
601 2643983909
602 2644133360
603 2644156039
604 2688595662
605 2694628174
606 2694640969
607 2723572924
608 2739309529
609 2756674251
610 2792746851
611 2793281605
612 2837679344
613 2837682822
614 2841736086
615 2844003805
616 2844010463
617 2847673192
618 2847689705
619 2856319775
620 2856320905
621 2856332855
622 2856340236
623 2856342161
624 2856350938
625 2857352634
626 2857371104
627 2857525610
628 2869165856
629 2869174564
630 2869237704
631 2869242660
632 2869254929
633 2869260704
634 2869267215
635 2869273762
636 2869280151
637 2871435960
638 2871444152
639 2871453331
640 2871466861
641 2871467309
642 2871475051
643 2871486113
644 2871491158
645 2871498926
646 2874105447
647 2874114646
648 2874119320
649 2874131438
650 2874132970
651 2874143297
652 2874164772
653 2874172077
654 2876363556
655 2876383434
656 2876391366
657 2876397329
658 2876403937
659 2876407576
660 2876426060
661 2878039728
662 2878733503
663 2878740637
664 2878755567
665 2878763139
666 2878770114
667 2878780061
668 2878788604
669 2878796076
670 2881147908
671 2881159059
672 2881164688
673 2881847582
674 2881859588
675 2881867249
676 2882634705
677 2882918186
678 2885306530
679 2885314458
680 2885321429
681 2885329976
682 2885337194
683 2885343787
684 2885352212
685 2888343006
686 2888344057
687 2888352816
688 2889014593
689 2889020427
690 2889795624
691 2891377496
692 2903454359
693 2903498958
694 2903517991
695 2903525506
696 2903531749
697 2903543725
698 2904664083
699 2906334899
700 2906356508
701 2906366586
702 2906375579
703 2906385372
704 2906398202
705 2906404014
706 2906411284
707 2906420551
708 2919074582
709 2922132471
710 2922155075
711 2922162959
712 2922177900
713 2922180884
714 2922193213
715 2924715774
716 2924730219
717 2924736651
718 2924743822
719 2924751748
720 2924764001
721 2924778238
722 2924785557
723 2936382298
724 2937826388
725 2937836678
726 2937847802
727 2937854667
728 2937863924
729 2937876601
730 2937878333
731 2937892203
732 2937980245
733 2937980723
734 2937997574
735 2938018146
736 2939672385
737 2958036017
738 2958045323
739 2958068004
740 2958076047
741 2958085449
742 2958097248
743 2958101747
744 2958108699
745 2958119408
746 2958127168
747 2958139593
748 2958145250
749 2958161422
750 2958168047
751 2958177768
752 2961118777
753 2961130899
754 2961142936
755 2961166513
756 2961176489
757 2961190405
758 2963645016
759 2965021333
760 2965030302
761 2965034337
762 2965041661
763 2965054057
764 2965064005
765 2965095636
766 2965104876
767 2965112800
768 2965123666
769 2968001494
770 2968007547
771 2968017270
772 2968088700
773 2968093840
774 2968097735
775 2968115222
776 2968121980
777 2968134119
778 2968146311
779 2968174917
780 2970470627
781 2970490155
782 2970509160
783 2970516815
784 2970525759
785 2970536582
786 2970546775
787 2970550479
788 2970557987
789 2970594748
790 2970622363
791 2970632783
792 2977824707
793 2977833644
794 2977857268
795 2977864357
796 2977866498
797 2977873705
798 2977898858
799 2977908964
800 2977915606
801 2977925855
802 2977939526
803 2977944157
804 2977951507
805 2977963431
806 2977971620
807 2977991614
808 2979713957
809 2979748891
810 2979765517
811 2979775321
812 2979783153
813 2979800160
814 2979813839
815 2987641227
816 2987649512
817 2987654178
818 2987662523
819 2987667537
820 2987677274
821 2989354632
822 2989773555
823 2996311818
824 2996338537
825 2996346810
826 2996349933
827 2996391643
828 3000142571
829 3004172877
830 3004191573
831 3004198183
832 3004210034
833 3004216409
834 3004218620
835 3004239433
836 3004243426
837 3004251100
838 3004272542
839 3004276635
840 3004337738
841 637077335
842 649870229
843 8002287110
844 8004302641
845 8004316422
846 8004363858
847 8004377146
848 8004402472
849 8004451496
850 8004637729
851 8004644230
852 8004701893
853 8004706992
854 8004729030
855 8054563065
856 8055617572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12894

ANAPC4_WD40

Anaphase-promoting complex subunit 4 WD40 domain

270

346

0.9

PF00400

WD40

WD domain, G-beta repeat

59

92

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wjs-assembly1.cif.gz_A crystal structure of rsa4 from chaetomium thermophilum 0.8526 6 326
8bda-assembly1.cif.gz_I ifta complex in anterograde intraflagellar transport trains (chlamydomonas reinhardtii) 0.8395 1 326
8fl4-assembly1.cif.gz_NJ human nuclear pre-60s ribosomal subunit (state i3) 0.8334 5 326
5naf-assembly4.cif.gz_D co-crystal structure of an mecp2 peptide with tblr1 wd40 domain 0.8332 2 327
4wjs-assembly1.cif.gz_A crystal structure of rsa4 from chaetomium thermophilum 0.831 6 326
ID Description Score Start End Superfamily
af_Q9VU65_188_333_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8591 212 326 2.130.10.10
af_Q9BRP4_76_246_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8581 208 328 2.130.10.10
af_Q18965_259_603_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8554 168 326 3.40.50.300
af_Q4D008_270_419_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8547 170 326 2.120.10.30
af_Q8BHD1_95_217_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8537 205 329 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A3S1WAA8-F1-model_v4 deleted 0.9935 217 329
AF-K2LKG5-F1-model_v4 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein 0.9921 1 329
AF-A0A527GQZ9-F1-model_v4 WD40 repeat domain-containing protein 0.9894 139 280
AF-K2LKG5-F1-model_v4 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein 0.989 1 329
AF-A0A526ZFF8-F1-model_v4 WD40 repeat domain-containing protein 0.9886 225 329

Map