F441808

General Info

Members Datasets Scaffolds Average Seq Length
428 245 362 450

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056829672|8056835021
Length 500
Sequence TRSSACRTRLAERLGARWDRRWYAPNPGQANGVESDRLEPQKGMNTVTRPRILVVGAGFAGVGCVRRLERKLAPAEADVTLVTPQSYQLYLPLLPQVASGVLTPQSIALSLRRSKRYRTRIIPGGAIGVDLRSKVCVVRTITDKIVNEPYDYIVLAPGSVTRTFDIPGLTEHAFGLKTLAEAAYIRDHVISQLDLADASDNPAERAARLQFVVVGGGYAGTEAAACLQRLTHAAVQRYPRLDPGLIKWHLIDIAPKLMPELGEKLGRSAQEILKRRGIDVSLGVSIDKAGPEEVTFTDGRVVPTHTLIWTAGVVASPLIGTLGAETVRGRLAVTPEMCLPGHDGVFALGDSAAVPDLAKGDGAVCPPTAQHAMRQGKSVADNVIATLRGAPMQPYVHRDLGLVVDLGGRDAVSKPLGVELRGVPAQVVARGYHWSALRTNVAKARVMTNWLLNAVAGDDFVRTGFQARKPARLKDFEFTDAYLTPEQVRARVQGEAAENP

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221578 Streptomyces sp. Root63 Isolate Unclassified
9 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
10 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
11 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
12 2643221647 Streptomyces sp. Root369 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
22 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
23 2808606448 Streptomyces sp. 193411 Isolate Unclassified
24 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
25 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
26 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
27 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
28 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
29 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
30 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
31 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
32 2867428634 Streptomyces sp. RP5T Isolate Unclassified
33 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
34 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
35 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
36 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
37 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
38 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
39 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
40 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
41 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
42 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
43 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
44 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
45 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
46 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
47 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
48 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
49 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
50 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
51 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
52 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
53 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
54 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
55 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
56 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
57 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
58 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
59 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
60 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
61 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
62 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
63 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
64 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
103 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
225 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
226 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
227 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
228 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
235 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
236 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
242 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
243 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
244 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
245 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.58
Metatranscriptomes 0
Isolates 15.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0
Rhizoplane 0.23
Rhizosphere 82.94
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004829 3300001989 Bacteria 5136
2 JGI24739J22299_10004862 3300001989 Bacteria 5120
3 JGI24737J22298_10004219 3300001990 Bacteria 5025
4 JGI24738J21930_10006151 3300002075 Bacteria 2837
5 rootH1_10016445 3300003316 Bacteria 19551
6 rootH2_10014908 3300003320 Bacteria 3005
7 rootH2_10049149 3300003320 Bacteria 9924
8 rootH1_10019812 3300003323 Bacteria 7629
9 rootH1_10106390 3300003323 Bacteria 5233
10 Ga0070685_10117481 3300005466 Bacteria 1647
11 Ga0068853_100076423 3300005539 Bacteria 2924
12 Ga0068855_100147844 3300005563 Bacteria 2673
13 Ga0068858_100000182 3300005842 Bacteria 66190
14 Ga0075363_100073022 3300006048 Bacteria 1866
15 Ga0075367_10003807 3300006178 Bacteria 7272
16 Ga0105247_10006517 3300009101 Bacteria 7228
17 Ga0105246_10123388 3300011119 Bacteria 1923
18 Ga0182008_10001671 3300014497 Bacteria 14592
19 Ga0157379_10000358 3300014968 Bacteria 36623
20 Ga0157376_10115099 3300014969 Bacteria 2374
21 Ga0182007_10001119 3300015262 Bacteria 14546
22 Ga0183367_1003 3300015688 Bacteria 814276
23 Ga0207710_10000037 3300025900 Bacteria 243545
24 Ga0207703_10000010 3300026035 Bacteria 343466
25 Ga0207639_10144844 3300026041 Bacteria 1983
26 Ga0307517_10001013 3300028786 Bacteria 47758
27 Ga0307517_10012816 3300028786 Bacteria 11459
28 Ga0307515_10000106 3300028794 Bacteria 197218
29 Ga0307511_10005155 3300030521 Bacteria 13316
30 Ga0307511_10035256 3300030521 Bacteria 4372
31 Ga0307512_10007111 3300030522 Bacteria 11145
32 Ga0307509_10123770 3300031507 Bacteria 2557
33 Ga0307508_10041589 3300031616 Bacteria 4124
34 Ga0307508_10043612 3300031616 Bacteria 4018
35 Ga0307508_10077246 3300031616 Bacteria 2908
36 Ga0307514_10013499 3300031649 Bacteria 6773
37 Ga0307516_10002172 3300031730 Bacteria 26588
38 Ga0307516_10030107 3300031730 Bacteria 5481
39 Ga0307516_10051663 3300031730 Bacteria 4027
40 Ga0307518_10073973 3300031838 Bacteria 2465
41 Ga0307416_100087337 3300032002 Bacteria 2662
42 Ga0307507_10009003 3300033179 Bacteria 13493
43 Ga0307507_10022198 3300033179 Bacteria 7025
44 Ga0307510_10013916 3300033180 Bacteria 9531
45 Ga0395898_0019823 3300037466 Bacteria 6839
46 Ga0395898_0035819 3300037466 Bacteria 4932
47 Ga0439436_0002541 3300041404 Bacteria 5482
48 Ga0451837_0706891 3300041494 Bacteria 5037
49 Ga0451853_0638197 3300041512 Bacteria 3703
50 Ga0439433_0000248 3300041999 Bacteria 9054
51 Ga0439449_0000336 3300042007 Bacteria 17060
52 Ga0439449_0011559 3300042007 Bacteria 3320
53 Ga0439457_003234 3300042014 Bacteria 4476
54 Ga0439462_0014684 3300042015 Bacteria 2014
55 Ga0450903_000092 3300042138 Bacteria 18774
56 Ga0439458_0000382 3300042157 Bacteria 11143
57 Ga0466969_0000555 3300044656 Bacteria 20517
58 Ga0466969_0005014 3300044656 Bacteria 7048
59 Ga0466969_0028587 3300044656 Bacteria 2849
60 Ga0466972_0009960 3300044658 Bacteria 4771
61 Ga0466972_0013798 3300044658 Bacteria 4056
62 Ga0466965_0003971 3300044683 Bacteria 6552
63 Ga0466966_0003338 3300044684 Bacteria 10579
64 Ga0466961_0001106 3300044693 Bacteria 16587
65 Ga0466961_0015876 3300044693 Bacteria 4832
66 Ga0466961_0024742 3300044693 Bacteria 3862
67 Ga0466963_0000020 3300044694 Bacteria 55146
68 Ga0466963_0007855 3300044694 Bacteria 6385
69 Ga0466971_0002487 3300044719 Bacteria 7789
70 Ga0466971_0009726 3300044719 Bacteria 4197
71 Ga0466971_0043726 3300044719 Bacteria 2012
72 Ga0466970_0001174 3300044765 Bacteria 12714
73 Ga0466970_0009547 3300044765 Bacteria 4907
74 Ga0466957_0000434 3300044842 Bacteria 20610
75 Ga0466960_0007157 3300044901 Bacteria 4514
76 Ga0466959_0000316 3300045049 Bacteria 28722
77 Ga0466959_0004123 3300045049 Bacteria 9684
78 Ga0466959_0008138 3300045049 Bacteria 7398
79 Ga0466959_0041246 3300045049 Bacteria 3407
80 Ga0466958_0000614 3300045836 Bacteria 15248
81 Ga0466958_0042272 3300045836 Bacteria 2744
82 Ga0466967_0000636 3300045976 Bacteria 17621
83 Ga0466967_0030864 3300045976 Bacteria 4503
84 Ga0495617_002344 3300046452 Bacteria 7585
85 Ga0495617_043067 3300046452 Bacteria 1507
86 Ga0495592_0017252 3300046454 Bacteria 5483
87 Ga0495592_0026352 3300046454 Bacteria 4408
88 Ga0495592_0034391 3300046454 Bacteria 3820
89 Ga0495592_0073684 3300046454 Bacteria 2482
90 Ga0495603_0000335 3300046455 Bacteria 25251
91 Ga0495603_0000503 3300046455 Bacteria 21673
92 Ga0495603_0006821 3300046455 Bacteria 6849
93 Ga0495603_0009455 3300046455 Bacteria 5889
94 Ga0495603_0013374 3300046455 Bacteria 4965
95 Ga0495603_0013409 3300046455 Bacteria 4958
96 Ga0495603_0023952 3300046455 Bacteria 3692
97 Ga0495629_0012705 3300046459 Bacteria 6096
98 Ga0495629_0014916 3300046459 Bacteria 5586
99 Ga0495629_0055291 3300046459 Bacteria 2775
100 Ga0495629_0065583 3300046459 Bacteria 2534
101 Ga0495638_0039151 3300046460 Bacteria 3011
102 Ga0495651_0002054 3300046462 Bacteria 15554
103 Ga0495651_0004454 3300046462 Bacteria 10725
104 Ga0495651_0006203 3300046462 Bacteria 9137
105 Ga0495651_0062689 3300046462 Bacteria 2844
106 Ga0495651_0065526 3300046462 Bacteria 2774
107 Ga0495580_0029369 3300046472 Bacteria 3991
108 Ga0495580_0030318 3300046472 Bacteria 3917
109 Ga0495582_0009590 3300046473 Bacteria 5331
110 Ga0495605_0002190 3300046474 Bacteria 12211
111 Ga0495662_0001456 3300046476 Bacteria 11703
112 Ga0495662_0003578 3300046476 Bacteria 7848
113 Ga0495662_0004145 3300046476 Bacteria 7305
114 Ga0495662_0006347 3300046476 Bacteria 5910
115 Ga0495664_0000080 3300046477 Bacteria 47313
116 Ga0495664_0022982 3300046477 Bacteria 3615
117 Ga0495664_0048483 3300046477 Bacteria 2522
118 Ga0495585_0002081 3300046492 Bacteria 14664
119 Ga0495585_0013847 3300046492 Bacteria 4713
120 Ga0495585_0130010 3300046492 Bacteria 1326
121 Ga0495594_0000522 3300046499 Bacteria 19703
122 Ga0495594_0008517 3300046499 Bacteria 5287
123 Ga0495594_0009463 3300046499 Bacteria 5034
124 Ga0495594_0040853 3300046499 Bacteria 2540
125 Ga0495594_0043001 3300046499 Bacteria 2475
126 Ga0495594_0128418 3300046499 Bacteria 1435
127 Ga0495607_0051509 3300046501 Bacteria 2390
128 Ga0495583_0001271 3300046506 Bacteria 26415
129 Ga0495606_0006160 3300046507 Bacteria 11165
130 Ga0495606_0064616 3300046507 Bacteria 2328
131 Ga0495608_0017316 3300046511 Bacteria 4985
132 Ga0495608_0095878 3300046511 Bacteria 1916
133 Ga0495616_0047085 3300046513 Bacteria 2173
134 Ga0495618_0041063 3300046514 Bacteria 2912
135 Ga0495618_0069803 3300046514 Bacteria 2234
136 Ga0495618_0083023 3300046514 Bacteria 2047
137 Ga0495618_0085130 3300046514 Bacteria 2020
138 Ga0495620_0002405 3300046515 Bacteria 10840
139 Ga0495620_0018928 3300046515 Bacteria 3401
140 Ga0495628_0032719 3300046516 Bacteria 4196
141 Ga0495628_0039785 3300046516 Bacteria 3759
142 Ga0495628_0098361 3300046516 Bacteria 2260
143 Ga0495630_0009568 3300046517 Bacteria 6968
144 Ga0495630_0085711 3300046517 Bacteria 2378
145 Ga0495631_0014172 3300046518 Bacteria 3852
146 Ga0495632_0077516 3300046519 Bacteria 1589
147 Ga0495643_0001605 3300046522 Bacteria 20013
148 Ga0495643_0037890 3300046522 Bacteria 2642
149 Ga0495648_0007649 3300046524 Bacteria 8616
150 Ga0495648_0007756 3300046524 Bacteria 8540
151 Ga0495666_0001175 3300046526 Bacteria 12584
152 Ga0495652_0018504 3300046529 Bacteria 6210
153 Ga0495652_0029636 3300046529 Bacteria 4807
154 Ga0495665_0024297 3300046531 Bacteria 3256
155 Ga0495640_0002527 3300046533 Bacteria 14702
156 Ga0495640_0018942 3300046533 Bacteria 5091
157 Ga0495586_0015395 3300046535 Bacteria 4069
158 Ga0495586_0036595 3300046535 Bacteria 2635
159 Ga0495587_0000196 3300046536 Bacteria 44727
160 Ga0495597_0005805 3300046542 Bacteria 6470
161 Ga0495645_0002534 3300046543 Bacteria 12408
162 Ga0495645_0064795 3300046543 Bacteria 2644
163 Ga0495645_0093154 3300046543 Bacteria 2150
164 Ga0495622_0000750 3300046557 Bacteria 18163
165 Ga0495622_0001139 3300046557 Bacteria 13849
166 Ga0495633_0008957 3300046558 Bacteria 5575
167 Ga0495667_0041298 3300046559 Bacteria 3059
168 Ga0495656_0048858 3300046615 Bacteria 1800
169 Ga0495668_0001766 3300046616 Bacteria 19788
170 Ga0495668_0003058 3300046616 Bacteria 12984
171 Ga0495668_0006285 3300046616 Bacteria 7826
172 Ga0495634_0002132 3300046642 Bacteria 16664
173 Ga0495634_0017969 3300046642 Bacteria 5040
174 Ga0495634_0032800 3300046642 Bacteria 3569
175 Ga0495634_0054916 3300046642 Bacteria 2664
176 Ga0495634_0100935 3300046642 Bacteria 1864
177 Ga0495611_0000718 3300046648 Bacteria 18707
178 Ga0495611_0015262 3300046648 Bacteria 3283
179 Ga0495625_0057202 3300046660 Bacteria 2774
180 Ga0495625_0083146 3300046660 Bacteria 2225
181 Ga0495635_0003553 3300046663 Bacteria 10788
182 Ga0495635_0105280 3300046663 Bacteria 1927
183 Ga0495635_0115864 3300046663 Bacteria 1829
184 Ga0495661_0093159 3300046665 Bacteria 1710
185 Ga0495588_0003140 3300046674 Bacteria 7146
186 Ga0495588_0012209 3300046674 Bacteria 4052
187 Ga0495588_0022634 3300046674 Bacteria 3107
188 Ga0495657_0000646 3300046675 Bacteria 31644
189 Ga0495657_0015610 3300046675 Bacteria 5551
190 Ga0495599_0081396 3300046678 Bacteria 2022
191 Ga0495599_0085902 3300046678 Bacteria 1965
192 Ga0495623_0023754 3300046679 Bacteria 3955
193 Ga0495623_0051879 3300046679 Bacteria 2593
194 Ga0495646_0002755 3300046680 Bacteria 10863
195 Ga0495646_0004051 3300046680 Bacteria 9190
196 Ga0495646_0027178 3300046680 Bacteria 3590
197 Ga0495658_0054818 3300046683 Bacteria 2269
198 Ga0495613_0001691 3300046689 Bacteria 16812
199 Ga0495613_0003675 3300046689 Bacteria 11503
200 Ga0495613_0009091 3300046689 Bacteria 7369
201 Ga0495613_0018321 3300046689 Bacteria 5221
202 Ga0495613_0051415 3300046689 Bacteria 3036
203 Ga0495613_0051652 3300046689 Bacteria 3029
204 Ga0495613_0067615 3300046689 Bacteria 2608
205 Ga0495670_0008564 3300046691 Bacteria 5036
206 Ga0495649_0003528 3300046694 Bacteria 10514
207 Ga0495649_0023097 3300046694 Bacteria 3474
208 Ga0495649_0071526 3300046694 Bacteria 1859
209 Ga0495589_0012934 3300046794 Bacteria 4313
210 Ga0495589_0032383 3300046794 Bacteria 2628
211 Ga0495600_0004333 3300046809 Bacteria 8488
212 Ga0495600_0041515 3300046809 Bacteria 2998
213 Ga0495600_0070598 3300046809 Bacteria 2282
214 Ga0495660_0014488 3300046810 Bacteria 4560
215 Ga0495581_0068164 3300047315 Bacteria 2057
216 Ga0495604_0001190 3300047317 Bacteria 21463
217 Ga0495604_0003403 3300047317 Bacteria 12684
218 Ga0495604_0023750 3300047317 Bacteria 4893
219 Ga0495604_0044281 3300047317 Bacteria 3478
220 Ga0495636_0000474 3300047318 Bacteria 14788
221 Ga0495636_0002219 3300047318 Bacteria 7455
222 Ga0495676_0001401 3300047321 Bacteria 20745
223 Ga0495676_0001954 3300047321 Bacteria 18105
224 Ga0495676_0007592 3300047321 Bacteria 9941
225 Ga0495676_0008618 3300047321 Bacteria 9339
226 Ga0495676_0012865 3300047321 Bacteria 7525
227 Ga0495676_0013777 3300047321 Bacteria 7249
228 Ga0495676_0019368 3300047321 Bacteria 5986
229 Ga0495676_0074806 3300047321 Bacteria 2592
230 Ga0495680_0010771 3300047322 Bacteria 8145
231 Ga0495683_0008081 3300047323 Bacteria 5647
232 Ga0495687_000798 3300047443 Bacteria 33919
233 Ga0495687_001363 3300047443 Bacteria 22588
234 Ga0495687_009068 3300047443 Bacteria 5603
235 Ga0495687_021223 3300047443 Bacteria 3147
236 Ga0495675_0005701 3300047444 Bacteria 7612
237 Ga0495675_0092096 3300047444 Bacteria 1902
238 Ga0495685_000241 3300047447 Bacteria 18884
239 Ga0495685_000334 3300047447 Bacteria 15144
240 Ga0495685_004559 3300047447 Bacteria 4487
241 Ga0495685_005486 3300047447 Bacteria 4142
242 Ga0495685_007081 3300047447 Bacteria 3695
243 Ga0495685_008710 3300047447 Bacteria 3377
244 Ga0495681_0005538 3300047470 Bacteria 8439
245 Ga0495681_0008753 3300047470 Bacteria 6313
246 Ga0495686_0065084 3300047472 Bacteria 2255
247 Ga0495593_0001977 3300047673 Bacteria 12206
248 Ga0495593_0011717 3300047673 Bacteria 5031
249 Ga0495593_0013635 3300047673 Bacteria 4632
250 Ga0495602_0103736 3300048088 Bacteria 2327
251 Ga0495602_0147895 3300048088 Bacteria 1850
252 Ga0495614_0001806 3300048089 Bacteria 9369
253 Ga0495614_0001925 3300048089 Bacteria 9106
254 Ga0495614_0016038 3300048089 Bacteria 3262
255 Ga0495626_0020993 3300048091 Bacteria 3248
256 Ga0495626_0036854 3300048091 Bacteria 2328
257 Ga0496109_0263172 3300048912 Bacteria 1624
258 Ga0496121_0162211 3300048924 Bacteria 1633
259 Ga0495678_050973 3300049459 Bacteria 1602
260 Ga0501031_0006528 3300049568 Bacteria 7603
261 Ga0501031_0017373 3300049568 Bacteria 4675
262 Ga0501031_0101617 3300049568 Bacteria 1876
263 Ga0501032_0001785 3300049569 Bacteria 16976
264 Ga0501032_0079427 3300049569 Bacteria 2184
265 Ga0501033_0002990 3300049570 Bacteria 14116
266 Ga0501033_0005732 3300049570 Bacteria 9790
267 Ga0501033_0019443 3300049570 Bacteria 5136
268 Ga0501033_0026718 3300049570 Bacteria 4342
269 Ga0501033_0030396 3300049570 Bacteria 4059
270 Ga0501033_0061860 3300049570 Bacteria 2758
271 Ga0501034_0003210 3300049571 Bacteria 18756
272 Ga0501034_0003943 3300049571 Bacteria 16674
273 Ga0501034_0028931 3300049571 Bacteria 5636
274 Ga0501034_0049100 3300049571 Bacteria 4259
275 Ga0501034_0053720 3300049571 Bacteria 4056
276 Ga0501034_0071713 3300049571 Bacteria 3473
277 Ga0501036_0000666 3300049572 Bacteria 25235
278 Ga0501036_0012079 3300049572 Bacteria 7157
279 Ga0501036_0025081 3300049572 Bacteria 5028
280 Ga0501036_0029317 3300049572 Bacteria 4651
281 Ga0501036_0062298 3300049572 Bacteria 3159
282 Ga0501036_0109124 3300049572 Bacteria 2338
283 Ga0501037_0014416 3300049573 Bacteria 5818
284 Ga0501037_0138501 3300049573 Bacteria 1742
285 Ga0501038_0013205 3300049574 Bacteria 7532
286 Ga0501038_0017519 3300049574 Bacteria 6475
287 Ga0501038_0027007 3300049574 Bacteria 5109
288 Ga0501038_0044289 3300049574 Bacteria 3868
289 Ga0501038_0057899 3300049574 Bacteria 3325
290 Ga0501038_0165138 3300049574 Bacteria 1796
291 Ga0501039_0002139 3300049575 Bacteria 14626
292 Ga0501039_0065120 3300049575 Bacteria 2826
293 Ga0501040_0006330 3300049576 Bacteria 7686
294 Ga0501041_0015284 3300049577 Bacteria 4557
295 Ga0501042_0021609 3300049578 Bacteria 4488
296 Ga0501043_0001658 3300049579 Bacteria 19316
297 Ga0501043_0002962 3300049579 Bacteria 14150
298 Ga0501043_0019439 3300049579 Bacteria 5331
299 Ga0501043_0099696 3300049579 Bacteria 2283
300 Ga0501043_0111042 3300049579 Bacteria 2152
301 Ga0501046_0004028 3300049580 Bacteria 13408
302 Ga0501047_0000260 3300049581 Bacteria 61851
303 Ga0501047_0000628 3300049581 Bacteria 37206
304 Ga0501047_0007734 3300049581 Bacteria 10120
305 Ga0501047_0009425 3300049581 Bacteria 9225
306 Ga0501047_0019451 3300049581 Bacteria 6514
307 Ga0501047_0024539 3300049581 Bacteria 5787
308 Ga0501047_0031722 3300049581 Bacteria 5097
309 Ga0501047_0086273 3300049581 Bacteria 3016
310 Ga0501047_0090529 3300049581 Bacteria 2936
311 Ga0501048_0021345 3300049582 Bacteria 4740
312 Ga0501067_0015246 3300049583 Bacteria 4255
313 Ga0501068_0000963 3300049584 Bacteria 15110
314 Ga0501069_0007110 3300049585 Bacteria 5864
315 Ga0501070_0001803 3300049586 Bacteria 18887
316 Ga0501070_0021111 3300049586 Bacteria 5464
317 Ga0501071_0006674 3300049587 Bacteria 7498
318 Ga0501072_0001572 3300049588 Bacteria 17049
319 Ga0501073_0018020 3300049589 Bacteria 5105
320 Ga0501074_0000556 3300049590 Bacteria 23033
321 Ga0501074_0130272 3300049590 Bacteria 1799
322 Ga0501079_0057299 3300049741 Bacteria 3006
323 Ga0501080_0038175 3300049742 Bacteria 4484
324 Ga0501083_0001965 3300049744 Bacteria 14124
325 Ga0501035_0000285 3300049822 Bacteria 60115
326 Ga0501035_0003031 3300049822 Bacteria 16102
327 Ga0501035_0013464 3300049822 Bacteria 7552
328 Ga0501035_0015406 3300049822 Bacteria 7054
329 Ga0501035_0021536 3300049822 Bacteria 5926
330 Ga0501035_0085439 3300049822 Bacteria 2781
331 Ga0501044_0001295 3300049823 Bacteria 29563
332 Ga0501044_0002094 3300049823 Bacteria 22959
333 Ga0501044_0002984 3300049823 Bacteria 19179
334 Ga0501044_0006930 3300049823 Bacteria 12475
335 Ga0501044_0029449 3300049823 Bacteria 5789
336 Ga0501044_0034109 3300049823 Bacteria 5342
337 Ga0501044_0046222 3300049823 Bacteria 4508
338 Ga0501044_0059251 3300049823 Bacteria 3923
339 Ga0501045_0045434 3300049824 Bacteria 3197
340 nmdc:mga03n38_35093_c1 3300050490 Bacteria 2146
341 nmdc:mga06z11_4704_c1 3300050494 Bacteria 5393
342 Ga0495601_0054312 3300053077 Bacteria 2534
343 Ga0495612_0004885 3300053078 Bacteria 5551
344 Ga0500640_001195 3300053095 Bacteria 7612
345 Ga0500654_030705 3300053099 Bacteria 3238
346 Ga0500553_032783 3300053101 Bacteria 2587
347 Ga0500558_054160 3300053106 Bacteria 1687
348 Ga0500560_005273 3300053107 Bacteria 2845
349 Ga0500560_016943 3300053107 Bacteria 2000
350 Ga0500569_007151 3300053109 Bacteria 2492
351 Ga0500652_005410 3300053131 Bacteria 4017
352 Ga0500658_0008512 3300053134 Bacteria 3788
353 Ga0500579_029804 3300053143 Bacteria 3507
354 Ga0500616_0032742 3300053153 Bacteria 2840
355 Ga0500624_001542 3300053157 Bacteria 3593
356 Ga0500634_0018685 3300053161 Bacteria 3726
357 Ga0500587_003651 3300053739 Bacteria 2138
358 Ga0501084_0000786 3300054114 Bacteria 24197
359 Ga0501082_0003294 3300060353 Bacteria 14104
360 Ga0466962_0003470 3300061719 Bacteria 7517
361 Ga0466962_0026509 3300061719 Bacteria 2782
362 Ga0530510_0014494 3300061734 Bacteria 5560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0002534 Ga0495645_0002534_9172_10329 359
2 3300046492 Ga0495585_0130010 Ga0495585_0130010_121_1242 366
3 3300046476 Ga0495662_0006347 Ga0495662_0006347_2883_4235 408
4 3300046663 Ga0495635_0115864 Ga0495635_0115864_266_1618 408
5 3300046689 Ga0495613_0003675 Ga0495613_0003675_3125_4477 408
6 3300046524 Ga0495648_0007649 Ga0495648_0007649_4450_5748 417
7 3300046516 Ga0495628_0098361 Ga0495628_0098361_965_2227 419
8 3300046462 Ga0495651_0004454 Ga0495651_0004454_1080_2438 426
9 3300046472 Ga0495580_0030318 Ga0495580_0030318_1685_3043 426
10 3300046476 Ga0495662_0003578 Ga0495662_0003578_5283_6641 426
11 3300046477 Ga0495664_0022982 Ga0495664_0022982_1710_3068 426
12 3300046511 Ga0495608_0017316 Ga0495608_0017316_422_1780 426
13 3300046514 Ga0495618_0069803 Ga0495618_0069803_525_1883 426
14 3300046516 Ga0495628_0039785 Ga0495628_0039785_1854_3212 426
15 3300046517 Ga0495630_0009568 Ga0495630_0009568_377_1735 426
16 3300046526 Ga0495666_0001175 Ga0495666_0001175_4615_5973 426
17 3300046531 Ga0495665_0024297 Ga0495665_0024297_1760_3118 426
18 3300046533 Ga0495640_0018942 Ga0495640_0018942_505_1863 426
19 3300046535 Ga0495586_0036595 Ga0495586_0036595_291_1649 426
20 3300046543 Ga0495645_0093154 Ga0495645_0093154_117_1475 426
21 3300046559 Ga0495667_0041298 Ga0495667_0041298_1059_2417 426
22 3300046642 Ga0495634_0054916 Ga0495634_0054916_631_1989 426
23 3300046678 Ga0495599_0081396 Ga0495599_0081396_548_1906 426
24 3300046679 Ga0495623_0051879 Ga0495623_0051879_467_1825 426
25 3300046680 Ga0495646_0004051 Ga0495646_0004051_6527_7885 426
26 3300047317 Ga0495604_0001190 Ga0495604_0001190_15175_16533 426
27 3300047673 Ga0495593_0013635 Ga0495593_0013635_287_1645 426
28 3300048088 Ga0495602_0147895 Ga0495602_0147895_376_1734 426
29 3300053077 Ga0495601_0054312 Ga0495601_0054312_895_2253 426
30 3300044656 Ga0466969_0000555 Ga0466969_0000555_1001_2443 428
31 3300044693 Ga0466961_0024742 Ga0466961_0024742_1748_3190 428
32 3300044719 Ga0466971_0009726 Ga0466971_0009726_164_1606 428
33 3300045049 Ga0466959_0000316 Ga0466959_0000316_18649_20091 428
34 3300045836 Ga0466958_0042272 Ga0466958_0042272_195_1637 428
35 3300046452 Ga0495617_002344 Ga0495617_002344_5107_6471 428
36 3300046455 Ga0495603_0000335 Ga0495603_0000335_4952_6316 428
37 3300046474 Ga0495605_0002190 Ga0495605_0002190_8965_10329 428
38 3300046492 Ga0495585_0002081 Ga0495585_0002081_2693_4057 428
39 3300046499 Ga0495594_0009463 Ga0495594_0009463_2750_4114 428
40 3300046506 Ga0495583_0001271 Ga0495583_0001271_18938_20302 428
41 3300046518 Ga0495631_0014172 Ga0495631_0014172_536_1900 428
42 3300046542 Ga0495597_0005805 Ga0495597_0005805_40_1404 428
43 3300046557 Ga0495622_0000750 Ga0495622_0000750_11713_13077 428
44 3300046616 Ga0495668_0001766 Ga0495668_0001766_5041_6405 428
45 3300046648 Ga0495611_0000718 Ga0495611_0000718_5067_6431 428
46 3300046694 Ga0495649_0023097 Ga0495649_0023097_545_1909 428
47 3300046810 Ga0495660_0014488 Ga0495660_0014488_2741_4105 428
48 3300047321 Ga0495676_0001401 Ga0495676_0001401_13825_15189 428
49 3300047323 Ga0495683_0008081 Ga0495683_0008081_3700_5064 428
50 3300047447 Ga0495685_000334 Ga0495685_000334_8829_10193 428
51 3300047444 Ga0495675_0005701 Ga0495675_0005701_5601_6968 429
52 3300046452 Ga0495617_043067 Ga0495617_043067_71_1417 430
53 3300046454 Ga0495592_0073684 Ga0495592_0073684_142_1488 430
54 3300046455 Ga0495603_0023952 Ga0495603_0023952_967_2313 430
55 3300046462 Ga0495651_0065526 Ga0495651_0065526_261_1607 430
56 3300046472 Ga0495580_0029369 Ga0495580_0029369_2017_3363 430
57 3300046501 Ga0495607_0051509 Ga0495607_0051509_678_2024 430
58 3300046507 Ga0495606_0006160 Ga0495606_0006160_4705_6051 430
59 3300046507 Ga0495606_0064616 Ga0495606_0064616_546_1892 430
60 3300046511 Ga0495608_0095878 Ga0495608_0095878_378_1724 430
61 3300046513 Ga0495616_0047085 Ga0495616_0047085_356_1702 430
62 3300046514 Ga0495618_0041063 Ga0495618_0041063_1025_2371 430
63 3300046515 Ga0495620_0002405 Ga0495620_0002405_3863_5209 430
64 3300046519 Ga0495632_0077516 Ga0495632_0077516_222_1568 430
65 3300046529 Ga0495652_0029636 Ga0495652_0029636_2041_3387 430
66 3300046616 Ga0495668_0006285 Ga0495668_0006285_4409_5755 430
67 3300046642 Ga0495634_0100935 Ga0495634_0100935_270_1616 430
68 3300046660 Ga0495625_0083146 Ga0495625_0083146_139_1485 430
69 3300046665 Ga0495661_0093159 Ga0495661_0093159_127_1473 430
70 3300046689 Ga0495613_0018321 Ga0495613_0018321_2523_3869 430
71 3300046694 Ga0495649_0071526 Ga0495649_0071526_199_1545 430
72 3300046794 Ga0495589_0032383 Ga0495589_0032383_497_1843 430
73 3300047317 Ga0495604_0044281 Ga0495604_0044281_105_1451 430
74 3300047321 Ga0495676_0013777 Ga0495676_0013777_5240_6586 430
75 3300047321 Ga0495676_0074806 Ga0495676_0074806_634_1980 430
76 3300047322 Ga0495680_0010771 Ga0495680_0010771_277_1623 430
77 3300047447 Ga0495685_004559 Ga0495685_004559_2267_3613 430
78 3300047447 Ga0495685_005486 Ga0495685_005486_369_1715 430
79 3300048091 Ga0495626_0020993 Ga0495626_0020993_1879_3225 430
80 3300048091 Ga0495626_0036854 Ga0495626_0036854_948_2294 430
81 3300049459 Ga0495678_050973 Ga0495678_050973_61_1407 430
82 3300009101 Ga0105247_10006517 Ga0105247_100065177 432
83 3300014968 Ga0157379_10000358 Ga0157379_100003587 432
84 3300025900 Ga0207710_10000037 Ga0207710_1000003742 432
85 3300048924 Ga0496121_0162211 Ga0496121_0162211_213_1511 432
86 3300030521 Ga0307511_10035256 Ga0307511_100352562 433
87 iso_pu_bacteria 2912757875 2912764887 433
88 3300031616 Ga0307508_10043612 Ga0307508_100436122 434
89 3300046454 Ga0495592_0026352 Ga0495592_0026352_1097_2491 434
90 3300046462 Ga0495651_0006203 Ga0495651_0006203_1406_2800 434
91 3300046663 Ga0495635_0105280 Ga0495635_0105280_28_1422 434
92 3300046679 Ga0495623_0023754 Ga0495623_0023754_183_1577 434
93 3300046680 Ga0495646_0027178 Ga0495646_0027178_1271_2665 434
94 3300046809 Ga0495600_0041515 Ga0495600_0041515_205_1599 434
95 3300053078 Ga0495612_0004885 Ga0495612_0004885_1906_3300 434
96 3300046454 Ga0495592_0034391 Ga0495592_0034391_2222_3535 436
97 3300046459 Ga0495629_0014916 Ga0495629_0014916_2291_3604 436
98 3300046462 Ga0495651_0062689 Ga0495651_0062689_967_2280 436
99 3300046477 Ga0495664_0048483 Ga0495664_0048483_517_1830 436
100 3300046514 Ga0495618_0085130 Ga0495618_0085130_634_1947 436
101 3300046516 Ga0495628_0032719 Ga0495628_0032719_2158_3471 436
102 3300046529 Ga0495652_0018504 Ga0495652_0018504_2417_3730 436
103 3300046533 Ga0495640_0002527 Ga0495640_0002527_9910_11223 436
104 3300046642 Ga0495634_0032800 Ga0495634_0032800_1501_2814 436
105 3300046675 Ga0495657_0015610 Ga0495657_0015610_2215_3528 436
106 3300046689 Ga0495613_0051652 Ga0495613_0051652_1296_2609 436
107 3300046809 Ga0495600_0070598 Ga0495600_0070598_938_2251 436
108 3300047321 Ga0495676_0008618 Ga0495676_0008618_2290_3603 436
109 3300047444 Ga0495675_0092096 Ga0495675_0092096_357_1670 436
110 3300030521 Ga0307511_10005155 Ga0307511_100051558 439
111 3300031507 Ga0307509_10123770 Ga0307509_101237702 439
112 3300046454 Ga0495592_0017252 Ga0495592_0017252_3149_4471 439
113 3300046460 Ga0495638_0039151 Ga0495638_0039151_107_1429 439
114 3300046462 Ga0495651_0002054 Ga0495651_0002054_4084_5406 439
115 3300046473 Ga0495582_0009590 Ga0495582_0009590_3698_5020 439
116 3300046476 Ga0495662_0001456 Ga0495662_0001456_6927_8249 439
117 3300046477 Ga0495664_0000080 Ga0495664_0000080_39173_40495 439
118 3300046517 Ga0495630_0085711 Ga0495630_0085711_22_1344 439
119 3300046535 Ga0495586_0015395 Ga0495586_0015395_739_2061 439
120 3300046536 Ga0495587_0000196 Ga0495587_0000196_39192_40514 439
121 3300046543 Ga0495645_0064795 Ga0495645_0064795_742_2064 439
122 3300046642 Ga0495634_0002132 Ga0495634_0002132_4075_5397 439
123 3300046663 Ga0495635_0003553 Ga0495635_0003553_6385_7707 439
124 3300046675 Ga0495657_0000646 Ga0495657_0000646_23485_24807 439
125 3300046678 Ga0495599_0085902 Ga0495599_0085902_598_1920 439
126 3300046680 Ga0495646_0002755 Ga0495646_0002755_1077_2399 439
127 3300046683 Ga0495658_0054818 Ga0495658_0054818_390_1712 439
128 3300046689 Ga0495613_0001691 Ga0495613_0001691_6969_8291 439
129 3300046809 Ga0495600_0004333 Ga0495600_0004333_2954_4276 439
130 3300047315 Ga0495581_0068164 Ga0495581_0068164_115_1437 439
131 3300047317 Ga0495604_0003403 Ga0495604_0003403_606_1928 439
132 3300047321 Ga0495676_0012865 Ga0495676_0012865_5465_6787 439
133 3300047673 Ga0495593_0001977 Ga0495593_0001977_4085_5407 439
134 3300048088 Ga0495602_0103736 Ga0495602_0103736_742_2064 439
135 3300048089 Ga0495614_0001925 Ga0495614_0001925_4213_5535 439
136 3300049581 Ga0501047_0090529 Ga0501047_0090529_43_1365 439
137 3300053095 Ga0500640_001195 Ga0500640_001195_390_1712 439
138 3300053101 Ga0500553_032783 Ga0500553_032783_370_1692 439
139 3300053157 Ga0500624_001542 Ga0500624_001542_1212_2534 439
140 3300003320 rootH2_10014908 rootH2_100149082 440
141 iso_pu_bacteria 8025530807 8025538490 440
142 3300005466 Ga0070685_10117481 Ga0070685_101174811 441
143 3300005842 Ga0068858_100000182 Ga0068858_10000018220 441
144 3300026035 Ga0207703_10000010 Ga0207703_10000010178 441
145 3300044656 Ga0466969_0028587 Ga0466969_0028587_164_1525 442
146 3300044693 Ga0466961_0015876 Ga0466961_0015876_935_2296 442
147 3300045049 Ga0466959_0041246 Ga0466959_0041246_1095_2456 442
148 3300061719 Ga0466962_0003470 Ga0466962_0003470_966_2327 442
149 iso_pu_bacteria 2643221587 2643947096 442
150 iso_pu_bacteria 2643221677 2644433433 442
151 iso_pu_bacteria 2616644814 2616696450 443
152 3300046455 Ga0495603_0000503 Ga0495603_0000503_8605_10005 444
153 3300046499 Ga0495594_0000522 Ga0495594_0000522_15206_16606 444
154 3300046514 Ga0495618_0083023 Ga0495618_0083023_40_1431 444
155 3300046557 Ga0495622_0001139 Ga0495622_0001139_8043_9443 444
156 3300046642 Ga0495634_0017969 Ga0495634_0017969_3086_4477 444
157 3300046689 Ga0495613_0009091 Ga0495613_0009091_3683_5074 444
158 3300047321 Ga0495676_0001954 Ga0495676_0001954_3049_4440 444
159 3300047673 Ga0495593_0011717 Ga0495593_0011717_2609_4000 444
160 3300014969 Ga0157376_10115099 Ga0157376_101150992 445
161 3300044656 Ga0466969_0005014 Ga0466969_0005014_3015_4358 446
162 3300044658 Ga0466972_0013798 Ga0466972_0013798_1338_2681 446
163 3300044683 Ga0466965_0003971 Ga0466965_0003971_3861_5204 446
164 3300044684 Ga0466966_0003338 Ga0466966_0003338_1349_2692 446
165 3300044693 Ga0466961_0001106 Ga0466961_0001106_7888_9231 446
166 3300044694 Ga0466963_0000020 Ga0466963_0000020_32267_33610 446
167 3300044719 Ga0466971_0002487 Ga0466971_0002487_2571_3914 446
168 3300044765 Ga0466970_0001174 Ga0466970_0001174_3888_5231 446
169 3300044842 Ga0466957_0000434 Ga0466957_0000434_5444_6787 446
170 3300045049 Ga0466959_0004123 Ga0466959_0004123_3869_5212 446
171 3300045836 Ga0466958_0000614 Ga0466958_0000614_13762_15105 446
172 3300045976 Ga0466967_0000636 Ga0466967_0000636_2550_3893 446
173 3300061719 Ga0466962_0026509 Ga0466962_0026509_1349_2692 446
174 3300003323 rootH1_10106390 rootH1_101063902 447
175 3300005539 Ga0068853_100076423 Ga0068853_1000764232 447
176 3300006048 Ga0075363_100073022 Ga0075363_1000730222 447
177 3300015688 Ga0183367_1003 Ga0183367_1003738 447
178 3300026041 Ga0207639_10144844 Ga0207639_101448442 447
179 3300046558 Ga0495633_0008957 Ga0495633_0008957_1869_3233 447
180 3300046648 Ga0495611_0015262 Ga0495611_0015262_1101_2465 447
181 3300047447 Ga0495685_008710 Ga0495685_008710_1629_2975 447
182 3300050490 nmdc:mga03n38_35093_c1 nmdc:mga03n38_35093_c1_306_1649 447
183 iso_pu_bacteria 2643221601 2644015540 447
184 iso_pu_bacteria 2643221631 2644178062 447
185 iso_pu_bacteria 2818991472 2819744044 447
186 iso_pu_bacteria 2918501144 2918508871 447
187 iso_pu_bacteria 2995463766 2995470163 447
188 3300046455 Ga0495603_0006821 Ga0495603_0006821_271_1623 448
189 3300046455 Ga0495603_0013409 Ga0495603_0013409_2239_3591 448
190 3300046476 Ga0495662_0004145 Ga0495662_0004145_2896_4248 448
191 3300046499 Ga0495594_0040853 Ga0495594_0040853_267_1619 448
192 3300046615 Ga0495656_0048858 Ga0495656_0048858_44_1396 448
193 3300046674 Ga0495588_0012209 Ga0495588_0012209_1682_3034 448
194 3300046689 Ga0495613_0067615 Ga0495613_0067615_859_2211 448
195 3300046794 Ga0495589_0012934 Ga0495589_0012934_2874_4226 448
196 3300047318 Ga0495636_0000474 Ga0495636_0000474_778_2130 448
197 3300047318 Ga0495636_0002219 Ga0495636_0002219_3258_4610 448
198 3300047443 Ga0495687_001363 Ga0495687_001363_14367_15719 448
199 3300048912 Ga0496109_0263172 Ga0496109_0263172_231_1583 448
200 iso_pu_bacteria 2616644941 2616901000 448
201 iso_pu_bacteria 2643221578 2643905067 448
202 iso_pu_bacteria 2643221673 2644403125 448
203 iso_pu_bacteria 2643221682 2644458562 448
204 iso_pu_bacteria 2818991463 2819699278 448
205 iso_pu_bacteria 2852635781 2852641664 448
206 iso_pu_bacteria 2862178590 2862179704 448
207 iso_pu_bacteria 2875391855 2875392448 448
208 iso_pu_bacteria 2946045630 2946052303 448
209 iso_pu_bacteria 2966598605 2966604712 448
210 iso_pu_bacteria 2808606375 2808917386 449
211 iso_pu_bacteria 2862507626 2862512865 449
212 3300028786 Ga0307517_10012816 Ga0307517_100128168 450
213 3300031616 Ga0307508_10041589 Ga0307508_100415892 450
214 3300031730 Ga0307516_10051663 Ga0307516_100516633 450
215 3300046459 Ga0495629_0055291 Ga0495629_0055291_352_1707 450
216 3300046499 Ga0495594_0043001 Ga0495594_0043001_306_1661 450
217 3300046522 Ga0495643_0037890 Ga0495643_0037890_853_2208 450
218 3300046691 Ga0495670_0008564 Ga0495670_0008564_619_1974 450
219 3300047447 Ga0495685_000241 Ga0495685_000241_12757_14112 450
220 3300047470 Ga0495681_0005538 Ga0495681_0005538_3963_5318 450
221 3300047472 Ga0495686_0065084 Ga0495686_0065084_612_1967 450
222 3300053099 Ga0500654_030705 Ga0500654_030705_498_1853 450
223 3300053109 Ga0500569_007151 Ga0500569_007151_515_1870 450
224 3300053131 Ga0500652_005410 Ga0500652_005410_1349_2704 450
225 3300053134 Ga0500658_0008512 Ga0500658_0008512_1247_2602 450
226 3300053143 Ga0500579_029804 Ga0500579_029804_770_2125 450
227 3300053153 Ga0500616_0032742 Ga0500616_0032742_633_1988 450
228 3300053161 Ga0500634_0018685 Ga0500634_0018685_809_2164 450
229 3300053739 Ga0500587_003651 Ga0500587_003651_467_1822 450
230 iso_pu_bacteria 2862281513 2862282300 450
231 iso_pu_bacteria 2867428634 2867429830 450
232 iso_pu_bacteria 2877676314 2877684360 450
233 iso_pu_bacteria 2912715099 2912723742 450
234 iso_pu_bacteria 2912723979 2912726846 450
235 iso_pu_bacteria 2918501144 2918501723 450
236 iso_pu_bacteria 2919468124 2919473783 450
237 iso_pu_bacteria 3006321560 3006325409 450
238 iso_pu_bacteria 3006393351 3006397582 450
239 iso_pu_bacteria 3006493962 3006498663 450
240 3300003316 rootH1_10016445 rootH1_1001644510 451
241 3300003320 rootH2_10049149 rootH2_100491495 451
242 3300044765 Ga0466970_0009547 Ga0466970_0009547_2654_4021 451
243 3300053106 Ga0500558_054160 Ga0500558_054160_76_1434 451
244 3300053107 Ga0500560_016943 Ga0500560_016943_410_1768 451
245 iso_pu_bacteria 3006393351 3006397006 451
246 3300011119 Ga0105246_10123388 Ga0105246_101233881 452
247 3300032002 Ga0307416_100087337 Ga0307416_1000873372 452
248 3300041494 Ga0451837_0706891 Ga0451837_0706891_1531_2892 452
249 3300046455 Ga0495603_0009455 Ga0495603_0009455_934_2295 452
250 3300046455 Ga0495603_0013374 Ga0495603_0013374_2695_4056 452
251 3300046459 Ga0495629_0012705 Ga0495629_0012705_3582_4943 452
252 3300046459 Ga0495629_0065583 Ga0495629_0065583_939_2300 452
253 3300046499 Ga0495594_0008517 Ga0495594_0008517_3807_5168 452
254 3300046499 Ga0495594_0128418 Ga0495594_0128418_48_1409 452
255 3300046674 Ga0495588_0022634 Ga0495588_0022634_1071_2432 452
256 3300046689 Ga0495613_0051415 Ga0495613_0051415_1028_2389 452
257 3300047321 Ga0495676_0007592 Ga0495676_0007592_5392_6753 452
258 3300047321 Ga0495676_0019368 Ga0495676_0019368_3574_4935 452
259 3300048089 Ga0495614_0001806 Ga0495614_0001806_6263_7624 452
260 3300049823 Ga0501044_0002094 Ga0501044_0002094_15286_16650 452
261 iso_pu_bacteria 2811994879 2812361628 452
262 iso_pu_bacteria 2811994917 2812477153 452
263 iso_pu_bacteria 2946064051 2946064537 452
264 iso_pu_bacteria 2947224130 2947224483 452
265 iso_pu_bacteria 2954691527 2954700541 452
266 iso_pu_bacteria 2954701450 2954701687 452
267 iso_pu_bacteria 8056447290 8056454494 452
268 3300049568 Ga0501031_0006528 Ga0501031_0006528_3583_4947 453
269 3300049569 Ga0501032_0001785 Ga0501032_0001785_11902_13266 453
270 3300049570 Ga0501033_0030396 Ga0501033_0030396_39_1403 453
271 3300049571 Ga0501034_0003943 Ga0501034_0003943_3342_4706 453
272 3300049572 Ga0501036_0029317 Ga0501036_0029317_1335_2699 453
273 3300049573 Ga0501037_0014416 Ga0501037_0014416_1296_2660 453
274 3300049574 Ga0501038_0027007 Ga0501038_0027007_1296_2660 453
275 3300049575 Ga0501039_0065120 Ga0501039_0065120_1296_2660 453
276 3300049576 Ga0501040_0006330 Ga0501040_0006330_3665_5029 453
277 3300049577 Ga0501041_0015284 Ga0501041_0015284_2554_3918 453
278 3300049578 Ga0501042_0021609 Ga0501042_0021609_1583_2947 453
279 3300049579 Ga0501043_0002962 Ga0501043_0002962_10337_11701 453
280 3300049580 Ga0501046_0004028 Ga0501046_0004028_2548_3912 453
281 3300049581 Ga0501047_0000628 Ga0501047_0000628_3628_4992 453
282 3300049582 Ga0501048_0021345 Ga0501048_0021345_1953_3317 453
283 3300049583 Ga0501067_0015246 Ga0501067_0015246_2853_4217 453
284 3300049584 Ga0501068_0000963 Ga0501068_0000963_11795_13159 453
285 3300049585 Ga0501069_0007110 Ga0501069_0007110_2548_3912 453
286 3300049587 Ga0501071_0006674 Ga0501071_0006674_5871_7235 453
287 3300049588 Ga0501072_0001572 Ga0501072_0001572_14104_15468 453
288 3300049589 Ga0501073_0018020 Ga0501073_0018020_583_1947 453
289 3300049590 Ga0501074_0130272 Ga0501074_0130272_300_1664 453
290 3300049741 Ga0501079_0057299 Ga0501079_0057299_1604_2968 453
291 3300049742 Ga0501080_0038175 Ga0501080_0038175_1825_3189 453
292 3300049744 Ga0501083_0001965 Ga0501083_0001965_3679_5043 453
293 3300049822 Ga0501035_0000285 Ga0501035_0000285_45395_46759 453
294 3300049823 Ga0501044_0001295 Ga0501044_0001295_14945_16309 453
295 3300049824 Ga0501045_0045434 Ga0501045_0045434_1795_3159 453
296 3300054114 Ga0501084_0000786 Ga0501084_0000786_19124_20488 453
297 3300060353 Ga0501082_0003294 Ga0501082_0003294_9046_10410 453
298 3300061734 Ga0530510_0014494 Ga0530510_0014494_1629_2993 453
299 iso_pu_bacteria 2547132111 2547408931 453
300 iso_pu_bacteria 2643221647 2644265056 453
301 iso_pu_bacteria 2643221678 2644441739 453
302 iso_pu_bacteria 2784132148 2784585969 453
303 iso_pu_bacteria 2784746768 2785366155 453
304 iso_pu_bacteria 2786546132 2786667127 453
305 iso_pu_bacteria 2808606359 2808846763 453
306 iso_pu_bacteria 2808606448 2809229471 453
307 iso_pu_bacteria 2946072368 2946072961 453
308 iso_pu_bacteria 2954380949 2954389698 453
309 iso_pu_bacteria 2954673503 2954682214 453
310 iso_pu_bacteria 2954682443 2954690710 453
311 iso_pu_bacteria 2954721474 2954729186 453
312 iso_pu_bacteria 2954731030 2954732625 453
313 iso_pu_bacteria 2954740390 2954748085 453
314 iso_pu_bacteria 8023623736 8023631888 453
315 3300044658 Ga0466972_0009960 Ga0466972_0009960_327_1766 454
316 3300044901 Ga0466960_0007157 Ga0466960_0007157_570_2009 454
317 3300046492 Ga0495585_0013847 Ga0495585_0013847_731_2098 454
318 3300047317 Ga0495604_0023750 Ga0495604_0023750_2656_4023 454
319 3300049568 Ga0501031_0017373 Ga0501031_0017373_1874_3244 454
320 3300049570 Ga0501033_0061860 Ga0501033_0061860_959_2329 454
321 3300049571 Ga0501034_0053720 Ga0501034_0053720_83_1453 454
322 3300049572 Ga0501036_0012079 Ga0501036_0012079_3290_4660 454
323 3300049573 Ga0501037_0138501 Ga0501037_0138501_280_1647 454
324 3300049574 Ga0501038_0017519 Ga0501038_0017519_1193_2563 454
325 3300049579 Ga0501043_0019439 Ga0501043_0019439_2435_3805 454
326 3300049581 Ga0501047_0000260 Ga0501047_0000260_22276_23643 454
327 3300049581 Ga0501047_0007734 Ga0501047_0007734_6160_7530 454
328 3300049581 Ga0501047_0031722 Ga0501047_0031722_730_2100 454
329 3300049822 Ga0501035_0021536 Ga0501035_0021536_528_1895 454
330 3300049823 Ga0501044_0029449 Ga0501044_0029449_3383_4753 454
331 3300045049 Ga0466959_0008138 Ga0466959_0008138_88_1458 455
332 3300046515 Ga0495620_0018928 Ga0495620_0018928_896_2287 455
333 3300046522 Ga0495643_0001605 Ga0495643_0001605_14339_15730 455
334 3300046524 Ga0495648_0007756 Ga0495648_0007756_6247_7638 455
335 3300046616 Ga0495668_0003058 Ga0495668_0003058_5342_6733 455
336 3300046694 Ga0495649_0003528 Ga0495649_0003528_5835_7226 455
337 3300047443 Ga0495687_009068 Ga0495687_009068_1651_3042 455
338 3300047443 Ga0495687_021223 Ga0495687_021223_1343_2743 455
339 3300047447 Ga0495685_007081 Ga0495685_007081_1304_2695 455
340 3300049569 Ga0501032_0079427 Ga0501032_0079427_91_1557 455
341 3300049570 Ga0501033_0019443 Ga0501033_0019443_130_1605 455
342 3300049571 Ga0501034_0028931 Ga0501034_0028931_3441_4916 455
343 3300049572 Ga0501036_0109124 Ga0501036_0109124_259_1734 455
344 3300049574 Ga0501038_0165138 Ga0501038_0165138_193_1668 455
345 3300049579 Ga0501043_0111042 Ga0501043_0111042_501_1967 455
346 3300049581 Ga0501047_0009425 Ga0501047_0009425_7042_8517 455
347 3300049586 Ga0501070_0021111 Ga0501070_0021111_3443_4918 455
348 3300049822 Ga0501035_0003031 Ga0501035_0003031_2706_4172 455
349 3300049823 Ga0501044_0002984 Ga0501044_0002984_11955_13421 455
350 iso_pu_bacteria 2582581312 2585298862 455
351 iso_pu_bacteria 2643221548 2643764379 455
352 3300041404 Ga0439436_0002541 Ga0439436_0002541_1904_3274 456
353 3300041999 Ga0439433_0000248 Ga0439433_0000248_5167_6537 456
354 3300042014 Ga0439457_003234 Ga0439457_003234_3008_4378 456
355 3300042015 Ga0439462_0014684 Ga0439462_0014684_530_1900 456
356 3300044719 Ga0466971_0043726 Ga0466971_0043726_374_1813 456
357 3300049570 Ga0501033_0002990 Ga0501033_0002990_3552_4994 456
358 3300049570 Ga0501033_0005732 Ga0501033_0005732_8187_9626 456
359 3300049570 Ga0501033_0026718 Ga0501033_0026718_1673_3139 456
360 3300049571 Ga0501034_0003210 Ga0501034_0003210_8986_10428 456
361 3300049571 Ga0501034_0049100 Ga0501034_0049100_832_2298 456
362 3300049572 Ga0501036_0000666 Ga0501036_0000666_7542_8984 456
363 3300049572 Ga0501036_0025081 Ga0501036_0025081_1071_2558 456
364 3300049572 Ga0501036_0062298 Ga0501036_0062298_578_2044 456
365 3300049574 Ga0501038_0044289 Ga0501038_0044289_1585_3051 456
366 3300049574 Ga0501038_0057899 Ga0501038_0057899_1324_2766 456
367 3300049575 Ga0501039_0002139 Ga0501039_0002139_2190_3632 456
368 3300049579 Ga0501043_0001658 Ga0501043_0001658_10348_11790 456
369 3300049581 Ga0501047_0019451 Ga0501047_0019451_2858_4300 456
370 3300049581 Ga0501047_0024539 Ga0501047_0024539_953_2419 456
371 3300049586 Ga0501070_0001803 Ga0501070_0001803_9902_11344 456
372 3300049590 Ga0501074_0000556 Ga0501074_0000556_10938_12380 456
373 3300049822 Ga0501035_0013464 Ga0501035_0013464_3692_5134 456
374 3300049822 Ga0501035_0015406 Ga0501035_0015406_1914_3353 456
375 3300049822 Ga0501035_0085439 Ga0501035_0085439_365_1831 456
376 3300049823 Ga0501044_0006930 Ga0501044_0006930_10890_12263 456
377 3300049823 Ga0501044_0034109 Ga0501044_0034109_1537_2979 456
378 iso_pu_bacteria 8056829672 8056835021 456
379 3300001989 JGI24739J22299_10004829 JGI24739J22299_100048292 457
380 3300001989 JGI24739J22299_10004862 JGI24739J22299_100048623 457
381 3300001990 JGI24737J22298_10004219 JGI24737J22298_100042193 457
382 3300002075 JGI24738J21930_10006151 JGI24738J21930_100061512 457
383 3300003323 rootH1_10019812 rootH1_100198124 457
384 3300005563 Ga0068855_100147844 Ga0068855_1001478442 457
385 3300006178 Ga0075367_10003807 Ga0075367_100038074 457
386 3300014497 Ga0182008_10001671 Ga0182008_1000167110 457
387 3300015262 Ga0182007_10001119 Ga0182007_100011194 457
388 3300028786 Ga0307517_10001013 Ga0307517_1000101332 457
389 3300028794 Ga0307515_10000106 Ga0307515_100001066 457
390 3300030522 Ga0307512_10007111 Ga0307512_100071115 457
391 3300031616 Ga0307508_10077246 Ga0307508_100772463 457
392 3300031649 Ga0307514_10013499 Ga0307514_100134992 457
393 3300031730 Ga0307516_10002172 Ga0307516_1000217211 457
394 3300031730 Ga0307516_10030107 Ga0307516_100301073 457
395 3300031838 Ga0307518_10073973 Ga0307518_100739732 457
396 3300033179 Ga0307507_10009003 Ga0307507_100090039 457
397 3300033179 Ga0307507_10022198 Ga0307507_100221982 457
398 3300033180 Ga0307510_10013916 Ga0307510_100139163 457
399 3300037466 Ga0395898_0019823 Ga0395898_0019823_2428_3804 457
400 3300037466 Ga0395898_0035819 Ga0395898_0035819_1783_3156 457
401 3300041512 Ga0451853_0638197 Ga0451853_0638197_211_1587 457
402 3300042007 Ga0439449_0000336 Ga0439449_0000336_13684_15150 457
403 3300042007 Ga0439449_0011559 Ga0439449_0011559_1540_3012 457
404 3300042138 Ga0450903_000092 Ga0450903_000092_9818_11194 457
405 3300042157 Ga0439458_0000382 Ga0439458_0000382_7143_8519 457
406 3300044694 Ga0466963_0007855 Ga0466963_0007855_2192_3568 457
407 3300045976 Ga0466967_0030864 Ga0466967_0030864_1234_2610 457
408 3300046660 Ga0495625_0057202 Ga0495625_0057202_1031_2407 457
409 3300046674 Ga0495588_0003140 Ga0495588_0003140_536_1912 457
410 3300047443 Ga0495687_000798 Ga0495687_000798_21589_22965 457
411 3300047470 Ga0495681_0008753 Ga0495681_0008753_4097_5473 457
412 3300048089 Ga0495614_0016038 Ga0495614_0016038_1448_2824 457
413 3300049568 Ga0501031_0101617 Ga0501031_0101617_336_1712 457
414 3300049571 Ga0501034_0071713 Ga0501034_0071713_1352_2728 457
415 3300049574 Ga0501038_0013205 Ga0501038_0013205_1340_2716 457
416 3300049579 Ga0501043_0099696 Ga0501043_0099696_867_2243 457
417 3300049581 Ga0501047_0086273 Ga0501047_0086273_751_2127 457
418 3300049823 Ga0501044_0046222 Ga0501044_0046222_1992_3368 457
419 3300049823 Ga0501044_0059251 Ga0501044_0059251_1601_2977 457
420 3300050494 nmdc:mga06z11_4704_c1 nmdc:mga06z11_4704_c1_3017_4438 457
421 3300053107 Ga0500560_005273 Ga0500560_005273_927_2303 457
422 iso_pu_bacteria 2582581313 2585306083 457
423 iso_pu_bacteria 2582581314 2585316492 457
424 iso_pu_bacteria 2643221714 2644630856 457
425 iso_pu_bacteria 2954711539 2954719214 457
426 iso_pu_bacteria 2954749733 2954751504 457
427 iso_pu_bacteria 2954759201 2954767210 457
428 iso_pu_bacteria 8008574985 8008581470 457

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

210

299

0.91

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

50

376

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xfn-assembly1.cif.gz_A structure of the n-terminal domains of phf1 0.937 81 106
6wat-assembly14.cif.gz_NC complex structure of phf1 0.9358 81 106
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.9345 81 106
4nwz-assembly1.cif.gz_A structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution 0.9208 6 404
5kmp-assembly1.cif.gz_A the structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum 0.9188 6 406
ID Description Score Start End Superfamily
af_A0A0G2JU83_1_62_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.9463 81 106 2.30.30.140
4hczB00 Mainly Beta;Roll;SH3 type barrels.; 0.935 81 106 2.30.30.140
af_Q55CD9_31_450_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.9253 2 419 3.50.50.100
5kmpB00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.923 6 407 3.50.50.100
af_F4I460_11_55_2.30.30.360 Mainly Beta;Roll;SH3 type barrels.;Myosin S1 fragment, N-terminal 0.9229 81 106 2.30.30.360
ID Description Score Start End GO Terms
AF-A0A233S0J5-F1-model_v4 NADH dehydrogenase 0.9892 1 452 GO:0003954
GO:0006116
AF-A0A7G7BTI5-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9849 4 453 GO:0003954
GO:0006116
AF-A0A233S0J5-F1-model_v4 NADH dehydrogenase 0.9849 1 452 GO:0003954
GO:0006116
AF-A0A7Z6T4A1-F1-model_v4 NADH dehydrogenase (Ubiquinone) (EC 1.6.5.3, EC 1.6.99.3) 0.9839 4 453 GO:0003954
GO:0006116
AF-A0A561UPE7-F1-model_v4 NADH dehydrogenase 0.9839 4 453 GO:0003954
GO:0006116

Feature Viewer

pLDDT pTM Quality
87.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map