F441832

General Info

Members Datasets Scaffolds Average Seq Length
429 305 296 187

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100000201|Ga0070670_10000020153
Length 206
Sequence LQKDPENYKGSLGNDGYKMKIERLPLAGLAKITPTKLGDHRGYFSETFKEGWFRENVADVAFVQENESLSASVGTVRGLHFQLEPFAQGKLVRCIAGRIFDVAVDIRVGSPTYGQWYGLELSKENGEQLWIPAGFAHGFATLVPDCVISYKVTAPYSAENDRGLLWSDPDIGIEWPLPLEDAILSNKDKVQPTLADLPPYFHLINE

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
13 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
14 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
15 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
16 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
17 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
18 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
19 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
20 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
21 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
22 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
23 2643221733 Bosea sp. Root381 Isolate Unclassified
24 2643221734 Bosea sp. Root670 Isolate Unclassified
25 2718217927 Rhizobium sp. N324 Isolate Nodule
26 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
27 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
28 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
29 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
30 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
31 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
32 2718218423 Rhizobium sp. N941 Isolate Nodule
33 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
34 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
35 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
36 2721755809 Rhizobium sp. N541 Isolate Nodule
37 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
38 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
39 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
40 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
41 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
42 2738541293 Rhizobium sp. GV031 Isolate Unclassified
43 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
44 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
45 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
46 2791355256 Rhizobium sp. M10 Isolate Nodule
47 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
48 2791355260 Rhizobium sp. L9 Isolate Nodule
49 2791355262 Rhizobium sp. M1 Isolate Nodule
50 2791355263 Rhizobium chutanense C5 Isolate Nodule
51 2791355265 Rhizobium sp. H4 Isolate Nodule
52 2791355267 Rhizobium sp. L18 Isolate Nodule
53 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
54 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
55 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
56 2818991467 Bosea vestrisii 3192 Isolate Unclassified
57 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
58 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
59 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
60 2838048938 Rhizobium pisi 27/80 Isolate Nodule
61 2838061910 Rhizobium phaseoli L15 Isolate Nodule
62 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
63 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
64 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
65 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
66 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
67 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
68 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
69 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
70 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
71 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
72 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
73 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
74 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
75 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
76 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
77 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
78 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
79 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
80 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
81 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
82 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
83 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
84 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
85 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
86 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
87 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
88 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
89 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
90 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
91 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
92 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
93 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
94 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
95 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
96 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
97 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
98 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
99 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
100 2933599457 Rhizobium phaseoli M3 Isolate Nodule
101 2936381700 Rhizobium chutanense C16 Isolate Unclassified
102 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
103 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
104 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
105 2996887358 Rhizobium sp. R711 Isolate Nodule
106 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
107 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
108 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
109 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
110 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
111 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
112 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
113 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
114 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
115 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
116 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
117 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
118 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
121 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
133 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
134 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
140 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
141 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
142 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
147 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
148 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
149 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
150 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
153 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
154 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
198 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
202 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
203 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
204 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
205 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
206 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
276 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
277 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
278 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
279 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
280 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
281 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
282 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
283 8005275841 Rhizobium sp. N4311 Isolate Nodule
284 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
285 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
286 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
287 8005321885 Rhizobium sp. R72 Isolate Nodule
288 8005382845 Rhizobium sp. R634 Isolate Nodule
289 8005395548 Rhizobium sp. R339 Isolate Nodule
290 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
291 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
292 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
293 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
294 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
295 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
296 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
297 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
298 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
299 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
300 8018176218 Rhizobium sp. N122 Isolate Nodule
301 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
302 8024501048 Rhizobium sp. H4 Isolate Nodule
303 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
304 8056382006 Rhizobium croatiense 13T Isolate Nodule
305 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69
Metatranscriptomes 0
Isolates 31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.48
Nodule 25.17
Rhizoplane 5.13
Rhizosphere 27.04
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11215141 2162886012 Bacteria 3868
2 JGI25162J39368_1000729 3300002737 Bacteria 22630
3 JGI25152J39213_1004710 3300002773 Bacteria 4220
4 JGI25151J46595_10000090 3300003187 Bacteria 123141
5 JGI25151J46595_10000168 3300003187 Bacteria 85167
6 JGI25151J46595_10001656 3300003187 Bacteria 14617
7 JGI25151J46595_10042036 3300003187 Bacteria 1652
8 JGI25151J46595_10102261 3300003187 Bacteria 769
9 JGI25165J46597_1000499 3300003214 Bacteria 37816
10 Ga0055526_1000062 3300003771 Bacteria 104151
11 Ga0055526_1011642 3300003771 Bacteria 3937
12 Ga0055524_1000011 3300003775 Bacteria 261442
13 Ga0055524_1035398 3300003775 Bacteria 1362
14 Ga0055524_1066916 3300003775 Bacteria 711
15 Ga0055528_1001812 3300003790 Bacteria 12218
16 Ga0055528_1004074 3300003790 Bacteria 7134
17 Ga0055528_1022686 3300003790 Bacteria 1946
18 Ga0055540_1000220 3300003792 Bacteria 53660
19 Ga0058692_1003510 3300003856 Bacteria 4834
20 Ga0058692_1010950 3300003856 Bacteria 2217
21 Ga0065165_1073709 3300005262 Bacteria 901
22 Ga0065715_10113700 3300005293 Unclassified 2478
23 Ga0070670_100000201 3300005331 Bacteria 55479
24 Ga0070669_100512644 3300005353 Bacteria 996
25 Ga0070675_100124749 3300005354 Bacteria 2190
26 Ga0070699_100024837 3300005518 Bacteria 5165
27 Ga0068855_100931777 3300005563 Bacteria 916
28 Ga0075365_10000314 3300006038 Bacteria 17047
29 Ga0075365_10212267 3300006038 Bacteria 1357
30 Ga0075365_10315706 3300006038 Bacteria 1100
31 Ga0075368_10303948 3300006042 Bacteria 689
32 Ga0075363_100000047 3300006048 Bacteria 23631
33 Ga0075363_100228160 3300006048 Bacteria 1069
34 Ga0075364_10008036 3300006051 Bacteria 6292
35 Ga0075364_10010455 3300006051 Bacteria 5607
36 Ga0075364_10033821 3300006051 Bacteria 3294
37 Ga0075364_10217253 3300006051 Bacteria 1297
38 Ga0075362_10010860 3300006177 Bacteria 3571
39 Ga0075362_10198397 3300006177 Bacteria 976
40 Ga0075362_10413493 3300006177 Bacteria 681
41 Ga0075367_10268552 3300006178 Bacteria 1071
42 Ga0075369_10004277 3300006186 Bacteria 5260
43 Ga0075369_10114524 3300006186 Bacteria 1217
44 Ga0075369_10146155 3300006186 Bacteria 1079
45 Ga0075369_10178609 3300006186 Bacteria 976
46 Ga0075369_10178610 3300006186 Bacteria 976
47 Ga0075366_10002027 3300006195 Bacteria 10280
48 Ga0075366_10051643 3300006195 Bacteria 2443
49 Ga0075370_10023974 3300006353 Bacteria 3366
50 Ga0075370_10041725 3300006353 Bacteria 2591
51 Ga0075370_10311038 3300006353 Bacteria 938
52 Ga0099826_10000047 3300006948 Bacteria 74994
53 Ga0099826_10002408 3300006948 Bacteria 12041
54 Ga0105244_10107643 3300009036 Bacteria 1359
55 Ga0105250_10169452 3300009092 Bacteria 914
56 Ga0105240_10042389 3300009093 Bacteria 5800
57 Ga0105240_10079853 3300009093 Bacteria 4025
58 Ga0111539_10244328 3300009094 Bacteria 2090
59 Ga0105237_10211544 3300009545 Bacteria 1939
60 Ga0105237_10940953 3300009545 Bacteria 871
61 Ga0105249_11305272 3300009553 Unclassified 797
62 Ga0123341_1000023 3300009765 Bacteria 75951
63 Ga0123342_1017549 3300009766 Bacteria 5923
64 Ga0105239_11466505 3300010375 Bacteria 788
65 Ga0105246_10090598 3300011119 Bacteria 2202
66 Ga0157370_10362468 3300013104 Bacteria 1336
67 Ga0171462_1013 3300013250 Bacteria 202864
68 Ga0157380_10370263 3300014326 Bacteria 1348
69 Ga0214544_1002538 3300021320 Bacteria 38352
70 Ga0214542_1007676 3300021321 Bacteria 18535
71 Ga0214543_1005252 3300021327 Bacteria 24005
72 Ga0213873_10008299 3300021358 Bacteria 2116
73 Ga0213872_10120944 3300021361 Bacteria 1158
74 Ga0213876_10027773 3300021384 Bacteria 2984
75 Ga0213876_10083946 3300021384 Bacteria 1685
76 Ga0213875_10181540 3300021388 Bacteria 989
77 Ga0213871_10039389 3300021441 Bacteria 1265
78 Ga0213871_10039766 3300021441 Bacteria 1259
79 Ga0213871_10062868 3300021441 Bacteria 1036
80 Ga0209437_100182 3300025233 Bacteria 130514
81 Ga0209129_1000329 3300025258 Bacteria 41319
82 Ga0209129_1005605 3300025258 Bacteria 4368
83 Ga0209233_1000231 3300025261 Bacteria 97534
84 Ga0209673_1000068 3300025273 Bacteria 245891
85 Ga0209673_1001599 3300025273 Bacteria 19964
86 Ga0209673_1001609 3300025273 Bacteria 19762
87 Ga0209673_1002964 3300025273 Bacteria 10616
88 Ga0209673_1048319 3300025273 Bacteria 1146
89 Ga0209675_1000274 3300025291 Bacteria 49492
90 Ga0209676_1021204 3300025292 Bacteria 2187
91 Ga0209676_1042612 3300025292 Bacteria 1258
92 Ga0209025_1000010 3300025294 Bacteria 986612
93 Ga0209025_1001164 3300025294 Bacteria 37261
94 Ga0209025_1001489 3300025294 Bacteria 30364
95 Ga0209025_1004041 3300025294 Bacteria 13137
96 Ga0209025_1074459 3300025294 Bacteria 1186
97 Ga0209564_1000143 3300025295 Bacteria 177136
98 Ga0209564_1010769 3300025295 Bacteria 4170
99 Ga0209564_1012637 3300025295 Bacteria 3661
100 Ga0209758_1014491 3300025297 Bacteria 4186
101 Ga0209758_1089355 3300025297 Bacteria 907
102 Ga0209050_1006006 3300025298 Bacteria 7363
103 Ga0209256_1000111 3300025299 Bacteria 178442
104 Ga0209256_1000330 3300025299 Bacteria 79958
105 Ga0209256_1005660 3300025299 Bacteria 7038
106 Ga0209256_1021314 3300025299 Bacteria 1994
107 Ga0207426_1002235 3300025302 Bacteria 12907
108 Ga0209051_1000198 3300025303 Bacteria 106688
109 Ga0209051_1024311 3300025303 Bacteria 2493
110 Ga0209051_1069242 3300025303 Bacteria 1070
111 Ga0209257_1004225 3300025304 Bacteria 11373
112 Ga0207695_10166359 3300025913 Unclassified 2133
113 Ga0207695_10224226 3300025913 Bacteria 1786
114 Ga0207695_10829404 3300025913 Bacteria 805
115 Ga0207671_10132480 3300025914 Bacteria 1914
116 Ga0207663_11030408 3300025916 Unclassified 661
117 Ga0207650_10003557 3300025925 Bacteria 10691
118 Ga0207650_10026116 3300025925 Bacteria 4163
119 Ga0207659_10346971 3300025926 Bacteria 1231
120 Ga0207700_10294854 3300025928 Bacteria 1399
121 Ga0207664_11298997 3300025929 Unclassified 647
122 Ga0207702_10948755 3300026078 Bacteria 853
123 Ga0209371_1000905 3300027312 Bacteria 23540
124 Ga0209371_1002763 3300027312 Bacteria 9399
125 Ga0209282_1000071 3300027666 Bacteria 81290
126 Ga0209282_1009808 3300027666 Bacteria 6049
127 Ga0307515_10004032 3300028794 Bacteria 30655
128 Ga0307515_10029196 3300028794 Bacteria 9335
129 Ga0307515_10170685 3300028794 Bacteria 2170
130 Ga0268256_1000772 3300030500 Bacteria 23301
131 Ga0268256_1002467 3300030500 Bacteria 9399
132 Ga0316181_1275590 3300030744 Bacteria 1336
133 Ga0265328_10004411 3300031239 Bacteria 6109
134 Ga0265328_10028342 3300031239 Bacteria 2095
135 Ga0265328_10057821 3300031239 Bacteria 1424
136 Ga0265331_10039504 3300031250 Bacteria 2301
137 Ga0307513_10021266 3300031456 Bacteria 7661
138 Ga0307513_10691677 3300031456 Bacteria 726
139 Ga0307409_100630763 3300031995 Bacteria 1063
140 Ga0373927_0001302 3300035695 Bacteria 18864
141 Ga0395905_0000403 3300037471 Bacteria 61346
142 Ga0436364_0330665 3300037853 Bacteria 1124
143 Ga0436364_1447293 3300037853 Bacteria 684
144 Ga0436365_0137067 3300039437 Bacteria 2092
145 Ga0436365_0713455 3300039437 Bacteria 6576
146 Ga0436360_0390246 3300039438 Bacteria 3300
147 Ga0436360_0701613 3300039438 Bacteria 1212
148 Ga0436360_0785424 3300039438 Bacteria 985
149 Ga0436360_0815719 3300039438 Bacteria 1034
150 Ga0436360_0927022 3300039438 Bacteria 1208
151 Ga0436360_1160387 3300039438 Bacteria 1682
152 Ga0436360_1304407 3300039438 Bacteria 5541
153 Ga0436361_0137196 3300039447 Bacteria 2356
154 Ga0436361_0485982 3300039447 Bacteria 1918
155 Ga0436361_1036661 3300039447 Bacteria 1110
156 Ga0436363_1345887 3300039450 Bacteria 2831
157 Ga0436362_0027063 3300039453 Bacteria 2424
158 Ga0436362_0226697 3300039453 Bacteria 1484
159 Ga0436362_0687164 3300039453 Bacteria 826
160 Ga0439436_0056742 3300041404 Bacteria 1099
161 Ga0439465_0003666 3300041413 Bacteria 5008
162 Ga0439465_0006807 3300041413 Bacteria 3634
163 Ga0451787_491886 3300041441 Bacteria 4780
164 Ga0451791_0424310 3300041451 Bacteria 731
165 Ga0451833_0083042 3300041491 Bacteria 4696
166 Ga0451835_0581216 3300041492 Bacteria 1675
167 Ga0451837_0270963 3300041494 Bacteria 1462
168 Ga0451839_0118925 3300041496 Bacteria 4549
169 Ga0451841_0307837 3300041498 Bacteria 11472
170 Ga0451845_0134993 3300041501 Bacteria 3234
171 Ga0451849_0849060 3300041505 Bacteria 2111
172 Ga0451851_0038384 3300041507 Bacteria 4262
173 Ga0451851_0967754 3300041507 Bacteria 612
174 Ga0451843_0281821 3300041509 Bacteria 1390
175 Ga0451855_0185400 3300041511 Bacteria 2684
176 Ga0451853_3571999 3300041512 Bacteria 2144
177 Ga0439433_0062588 3300041999 Bacteria 889
178 Ga0439449_0028141 3300042007 Bacteria 2095
179 Ga0439446_0027641 3300042156 Unclassified 1629
180 Ga0466972_0050206 3300044658 Bacteria 2014
181 Ga0495629_0110603 3300046459 Bacteria 1916
182 Ga0495585_0011708 3300046492 Bacteria 5187
183 Ga0495606_0253250 3300046507 Bacteria 976
184 Ga0495618_0216505 3300046514 Unclassified 1209
185 Ga0495628_0842184 3300046516 Unclassified 639
186 Ga0495631_0011937 3300046518 Bacteria 4259
187 Ga0495648_0013082 3300046524 Bacteria 6154
188 Ga0495648_0092382 3300046524 Bacteria 1690
189 Ga0495609_0033231 3300046538 Bacteria 2342
190 Ga0495633_0041409 3300046558 Bacteria 2190
191 Ga0495656_0016691 3300046615 Bacteria 2789
192 Ga0495611_0029418 3300046648 Bacteria 2409
193 Ga0495661_0050694 3300046665 Bacteria 2511
194 Ga0495670_0018786 3300046691 Bacteria 3405
195 Ga0495670_0113342 3300046691 Bacteria 1405
196 Ga0495600_0154468 3300046809 Bacteria 1485
197 Ga0495604_0726811 3300047317 Bacteria 629
198 Ga0495680_0135241 3300047322 Bacteria 1808
199 Ga0495679_107044 3300047446 Bacteria 772
200 Ga0495681_0058533 3300047470 Bacteria 1785
201 Ga0495686_0106118 3300047472 Bacteria 1689
202 Ga0495686_0242333 3300047472 Bacteria 1016
203 Ga0495615_0004490 3300048090 Bacteria 2440
204 Ga0496101_0132861 3300048904 Bacteria 1891
205 Ga0496104_0000339 3300048907 Bacteria 41808
206 Ga0496104_0015190 3300048907 Bacteria 6970
207 Ga0496105_0000153 3300048908 Bacteria 45370
208 Ga0496105_0000736 3300048908 Bacteria 22200
209 Ga0496105_0304875 3300048908 Bacteria 1279
210 Ga0496106_0756447 3300048909 Bacteria 772
211 Ga0496110_0031388 3300048913 Bacteria 4584
212 Ga0496110_0233056 3300048913 Bacteria 1675
213 Ga0496112_0011074 3300048915 Bacteria 8218
214 Ga0496113_0045804 3300048916 Bacteria 3245
215 Ga0496113_0589331 3300048916 Bacteria 891
216 Ga0496114_0180290 3300048917 Bacteria 1844
217 Ga0496114_0191219 3300048917 Bacteria 1791
218 Ga0496115_0016157 3300048918 Bacteria 5677
219 Ga0496115_0075253 3300048918 Bacteria 2742
220 Ga0496115_0433730 3300048918 Bacteria 1063
221 Ga0496117_0000083 3300048920 Bacteria 218945
222 Ga0496117_0000489 3300048920 Bacteria 65533
223 Ga0496117_0029843 3300048920 Bacteria 4196
224 Ga0496118_0009365 3300048921 Bacteria 9916
225 Ga0496118_0022439 3300048921 Bacteria 5517
226 Ga0496119_0000891 3300048922 Bacteria 39078
227 Ga0496119_0002362 3300048922 Bacteria 20781
228 Ga0496120_0000030 3300048923 Bacteria 226066
229 Ga0496121_0001015 3300048924 Bacteria 50131
230 Ga0496121_0013911 3300048924 Bacteria 8601
231 Ga0496122_0000050 3300048925 Bacteria 267874
232 Ga0496122_0003050 3300048925 Bacteria 22646
233 Ga0496122_0015134 3300048925 Bacteria 7394
234 Ga0496122_0050290 3300048925 Bacteria 3180
235 Ga0496122_0097841 3300048925 Bacteria 1973
236 Ga0496123_0000052 3300048926 Bacteria 236409
237 Ga0496123_0033125 3300048926 Bacteria 3725
238 Ga0496123_0043175 3300048926 Bacteria 3101
239 Ga0496123_0060679 3300048926 Bacteria 2436
240 Ga0496124_0001127 3300048927 Bacteria 42030
241 Ga0496124_0157855 3300048927 Bacteria 1772
242 Ga0496124_0660608 3300048927 Bacteria 669
243 Ga0496125_0003514 3300048928 Bacteria 18911
244 Ga0496125_0032354 3300048928 Bacteria 4647
245 Ga0496125_0059146 3300048928 Bacteria 3090
246 Ga0496125_0196048 3300048928 Bacteria 1328
247 Ga0496126_0003823 3300048929 Bacteria 18651
248 Ga0496126_0095790 3300048929 Bacteria 2603
249 Ga0496126_0137936 3300048929 Bacteria 2102
250 Ga0496126_0199715 3300048929 Bacteria 1689
251 Ga0496126_0441147 3300048929 Bacteria 1049
252 Ga0496126_0510358 3300048929 Bacteria 959
253 Ga0501034_0272487 3300049571 Bacteria 1633
254 Ga0501034_0282258 3300049571 Bacteria 1600
255 Ga0501034_0913204 3300049571 Bacteria 765
256 Ga0501036_0099304 3300049572 Bacteria 2462
257 Ga0501037_0044318 3300049573 Bacteria 3267
258 Ga0501038_0377710 3300049574 Bacteria 1100
259 Ga0501047_0425095 3300049581 Bacteria 1160
260 Ga0501072_0213504 3300049588 Bacteria 1538
261 Ga0501075_0410850 3300049591 Bacteria 1032
262 nmdc:mga03683_132565_c1 3300050489 Bacteria 1116
263 nmdc:mga03683_38520_c1 3300050489 Bacteria 1953
264 nmdc:mga03683_6318_c1 3300050489 Bacteria 4050
265 nmdc:mga03n38_63_c1 3300050490 Bacteria 22403
266 nmdc:mga00v17_273374_c1 3300050491 Bacteria 1096
267 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
268 nmdc:mga00v17_588_c1 3300050491 Bacteria 20251
269 nmdc:mga00v17_6325_c1 3300050491 Bacteria 6278
270 nmdc:mga0yw44_176770_c1 3300050492 Bacteria 1404
271 nmdc:mga0yw44_236910_c1 3300050492 Bacteria 1212
272 nmdc:mga0yw44_378510_c1 3300050492 Bacteria 956
273 nmdc:mga0yw44_46862_c1 3300050492 Bacteria 2599
274 nmdc:mga0yw44_5706_c1 3300050492 Bacteria 5928
275 nmdc:mga0k408_2294_c2 3300050493 Bacteria 2838
276 nmdc:mga0k408_50547_c1 3300050493 Bacteria 2407
277 nmdc:mga04h51_148393_c1 3300050495 Bacteria 894
278 nmdc:mga07m45_19651_c2 3300050496 Bacteria 1635
279 nmdc:mga07m45_353471_c1 3300050496 Bacteria 854
280 nmdc:mga07m45_40450_c1 3300050496 Bacteria 2608
281 nmdc:mga0sz30_116744_c1 3300050516 Bacteria 1172
282 nmdc:mga0sz30_23339_c1 3300050516 Bacteria 2516
283 Ga0495601_0006086 3300053077 Bacteria 7038
284 Ga0495595_0038970 3300053084 Bacteria 2167
285 Ga0495619_0004813 3300053085 Bacteria 8568
286 Ga0495619_0224077 3300053085 Bacteria 1303
287 Ga0500560_000307 3300053107 Bacteria 6249
288 Ga0500608_258048 3300053122 Bacteria 675
289 Ga0500658_0070200 3300053134 Bacteria 1476
290 Ga0500559_0027239 3300053136 Bacteria 2438
291 Ga0500561_0005529 3300053137 Bacteria 2355
292 Ga0500568_0039303 3300053139 Bacteria 1911
293 Ga0500573_0001149 3300053140 Bacteria 12350
294 Ga0500577_0300314 3300053142 Bacteria 701
295 Ga0500624_000363 3300053157 Bacteria 14583
296 Ga0500636_0035040 3300053177 Bacteria 2971

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0000339 Ga0496104_0000339_27494_28057 170
2 3300048908 Ga0496105_0000153 Ga0496105_0000153_22735_23298 170
3 3300048917 Ga0496114_0191219 Ga0496114_0191219_336_899 170
4 3300048918 Ga0496115_0433730 Ga0496115_0433730_485_1048 170
5 3300021441 Ga0213871_10062868 Ga0213871_100628681 171
6 3300039438 Ga0436360_1304407 Ga0436360_1304407_1705_2259 171
7 iso_pu_bacteria 2919114240 2919117877 172
8 iso_pu_bacteria 2926754445 2926757675 172
9 3300048913 Ga0496110_0031388 Ga0496110_0031388_17_580 173
10 3300021384 Ga0213876_10027773 Ga0213876_100277732 175
11 3300039437 Ga0436365_0713455 Ga0436365_0713455_2604_3158 175
12 iso_pu_bacteria 2896384573 2896388908 175
13 3300003856 Ga0058692_1010950 Ga0058692_10109502 176
14 3300048904 Ga0496101_0132861 Ga0496101_0132861_527_1102 176
15 3300048907 Ga0496104_0015190 Ga0496104_0015190_499_1074 176
16 3300048908 Ga0496105_0000736 Ga0496105_0000736_14468_15043 176
17 3300048908 Ga0496105_0304875 Ga0496105_0304875_233_808 176
18 3300048915 Ga0496112_0011074 Ga0496112_0011074_5137_5712 176
19 3300048916 Ga0496113_0045804 Ga0496113_0045804_2174_2749 176
20 3300048917 Ga0496114_0180290 Ga0496114_0180290_411_986 176
21 3300048918 Ga0496115_0075253 Ga0496115_0075253_232_807 176
22 3300048922 Ga0496119_0000891 Ga0496119_0000891_14985_15560 176
23 3300048928 Ga0496125_0196048 Ga0496125_0196048_678_1253 176
24 iso_pu_bacteria 2738541293 2738802839 176
25 iso_pu_bacteria 2891088606 2891092649 177
26 iso_pu_bacteria 8002060224 8002060639 177
27 iso_pu_bacteria 8002060224 8002062241 177
28 iso_pu_bacteria 2508501050 2508733655 178
29 iso_pu_bacteria 2510461069 2510843298 178
30 iso_pu_bacteria 2643221643 2644237262 178
31 iso_pu_bacteria 2643221733 2644731464 178
32 iso_pu_bacteria 2643221734 2644736135 178
33 iso_pu_bacteria 2757320392 2757571590 178
34 iso_pu_bacteria 2818991467 2819718849 178
35 iso_pu_bacteria 2842357229 2842363083 178
36 iso_pu_bacteria 2917699015 2917702334 178
37 iso_pu_bacteria 2996887358 2996889535 178
38 iso_pu_bacteria 8005321885 8005324062 178
39 3300037853 Ga0436364_1447293 Ga0436364_1447293_78_626 179
40 3300049571 Ga0501034_0913204 Ga0501034_0913204_60_608 179
41 3300049588 Ga0501072_0213504 Ga0501072_0213504_135_674 179
42 3300049591 Ga0501075_0410850 Ga0501075_0410850_285_824 179
43 iso_pu_bacteria 2978969890 2978969959 179
44 3300005354 Ga0070675_100124749 Ga0070675_1001247492 180
45 3300025925 Ga0207650_10026116 Ga0207650_100261161 180
46 3300025926 Ga0207659_10346971 Ga0207659_103469712 180
47 3300031239 Ga0265328_10028342 Ga0265328_100283423 180
48 3300039450 Ga0436363_1345887 Ga0436363_1345887_631_1182 180
49 iso_pu_bacteria 2791355253 2793283824 180
50 3300009093 Ga0105240_10079853 Ga0105240_100798534 181
51 3300009545 Ga0105237_10211544 Ga0105237_102115442 181
52 3300010375 Ga0105239_11466505 Ga0105239_114665052 181
53 3300021358 Ga0213873_10008299 Ga0213873_100082993 181
54 3300021361 Ga0213872_10120944 Ga0213872_101209442 181
55 3300021441 Ga0213871_10039389 Ga0213871_100393891 181
56 3300021441 Ga0213871_10039766 Ga0213871_100397661 181
57 3300025913 Ga0207695_10224226 Ga0207695_102242262 181
58 3300025914 Ga0207671_10132480 Ga0207671_101324803 181
59 3300025928 Ga0207700_10294854 Ga0207700_102948542 181
60 3300025929 Ga0207664_11298997 Ga0207664_112989971 181
61 3300026078 Ga0207702_10948755 Ga0207702_109487552 181
62 3300031239 Ga0265328_10004411 Ga0265328_100044112 181
63 3300031239 Ga0265328_10057821 Ga0265328_100578212 181
64 3300031250 Ga0265331_10039504 Ga0265331_100395042 181
65 3300039438 Ga0436360_0390246 Ga0436360_0390246_2416_2970 181
66 3300039438 Ga0436360_0701613 Ga0436360_0701613_82_636 181
67 3300039438 Ga0436360_0785424 Ga0436360_0785424_420_974 181
68 3300039438 Ga0436360_0815719 Ga0436360_0815719_243_797 181
69 3300039438 Ga0436360_0927022 Ga0436360_0927022_257_811 181
70 3300039438 Ga0436360_1160387 Ga0436360_1160387_1100_1654 181
71 3300039447 Ga0436361_0137196 Ga0436361_0137196_771_1325 181
72 3300039447 Ga0436361_0485982 Ga0436361_0485982_1282_1836 181
73 3300039447 Ga0436361_1036661 Ga0436361_1036661_283_837 181
74 3300039453 Ga0436362_0027063 Ga0436362_0027063_1823_2377 181
75 3300039453 Ga0436362_0687164 Ga0436362_0687164_109_663 181
76 3300048913 Ga0496110_0233056 Ga0496110_0233056_116_670 181
77 3300048918 Ga0496115_0016157 Ga0496115_0016157_4896_5450 181
78 3300048929 Ga0496126_0095790 Ga0496126_0095790_1068_1622 181
79 3300048929 Ga0496126_0137936 Ga0496126_0137936_1499_2053 181
80 iso_pu_bacteria 2724679232 2725946742 181
81 iso_pu_bacteria 2765235942 2766067529 181
82 iso_pu_bacteria 2842110456 2842115050 181
83 iso_pu_bacteria 2857516855 2857520218 181
84 iso_pu_bacteria 2933586486 2933591449 181
85 3300003187 JGI25151J46595_10000090 JGI25151J46595_1000009025 182
86 3300003187 JGI25151J46595_10000168 JGI25151J46595_1000016852 182
87 3300003771 Ga0055526_1000062 Ga0055526_100006228 182
88 3300003775 Ga0055524_1000011 Ga0055524_100001162 182
89 3300003775 Ga0055524_1035398 Ga0055524_10353982 182
90 3300003775 Ga0055524_1066916 Ga0055524_10669161 182
91 3300003790 Ga0055528_1004074 Ga0055528_10040743 182
92 3300005563 Ga0068855_100931777 Ga0068855_1009317772 182
93 3300006051 Ga0075364_10008036 Ga0075364_100080369 182
94 3300006051 Ga0075364_10010455 Ga0075364_100104552 182
95 3300013250 Ga0171462_1013 Ga0171462_101349 182
96 3300025258 Ga0209129_1005605 Ga0209129_10056053 182
97 3300025273 Ga0209673_1001609 Ga0209673_10016093 182
98 3300025273 Ga0209673_1002964 Ga0209673_10029645 182
99 3300025273 Ga0209673_1048319 Ga0209673_10483192 182
100 3300025291 Ga0209675_1000274 Ga0209675_100027431 182
101 3300025294 Ga0209025_1000010 Ga0209025_1000010585 182
102 3300025294 Ga0209025_1074459 Ga0209025_10744591 182
103 3300025295 Ga0209564_1000143 Ga0209564_100014361 182
104 3300025295 Ga0209564_1012637 Ga0209564_10126372 182
105 3300025297 Ga0209758_1089355 Ga0209758_10893551 182
106 3300025299 Ga0209256_1000111 Ga0209256_100011195 182
107 3300025299 Ga0209256_1000330 Ga0209256_100033048 182
108 3300025299 Ga0209256_1021314 Ga0209256_10213142 182
109 3300025302 Ga0207426_1002235 Ga0207426_10022356 182
110 3300025916 Ga0207663_11030408 Ga0207663_110304081 182
111 3300025925 Ga0207650_10003557 Ga0207650_1000355714 182
112 3300046524 Ga0495648_0092382 Ga0495648_0092382_484_1041 182
113 3300046691 Ga0495670_0113342 Ga0495670_0113342_283_840 182
114 3300047472 Ga0495686_0242333 Ga0495686_0242333_403_960 182
115 3300048916 Ga0496113_0589331 Ga0496113_0589331_125_682 182
116 3300048924 Ga0496121_0001015 Ga0496121_0001015_1110_1667 182
117 3300048925 Ga0496122_0050290 Ga0496122_0050290_1381_1938 182
118 3300048925 Ga0496122_0097841 Ga0496122_0097841_666_1223 182
119 3300048926 Ga0496123_0033125 Ga0496123_0033125_1816_2373 182
120 3300048927 Ga0496124_0157855 Ga0496124_0157855_533_1090 182
121 3300049571 Ga0501034_0272487 Ga0501034_0272487_268_825 182
122 3300049572 Ga0501036_0099304 Ga0501036_0099304_1544_2101 182
123 3300049573 Ga0501037_0044318 Ga0501037_0044318_877_1434 182
124 3300050491 nmdc:mga00v17_588_c1 nmdc:mga00v17_588_c1_16447_17004 182
125 3300050491 nmdc:mga00v17_6325_c1 nmdc:mga00v17_6325_c1_5108_5665 182
126 3300053137 Ga0500561_0005529 Ga0500561_0005529_1250_1807 182
127 3300053142 Ga0500577_0300314 Ga0500577_0300314_82_639 182
128 3300053177 Ga0500636_0035040 Ga0500636_0035040_1970_2527 182
129 iso_pu_bacteria 2558860242 2559297763 182
130 iso_pu_bacteria 2599185210 2599603812 182
131 iso_pu_bacteria 2600255279 2601612657 182
132 iso_pu_bacteria 2600255308 2601749751 182
133 iso_pu_bacteria 2808606387 2808989243 182
134 iso_pu_bacteria 2818991439 2819561855 182
135 iso_pu_bacteria 2838675328 2838679136 182
136 iso_pu_bacteria 2838714209 2838718981 182
137 iso_pu_bacteria 2838719591 2838723980 182
138 iso_pu_bacteria 2838724970 2838728814 182
139 iso_pu_bacteria 2841846520 2841850099 182
140 iso_pu_bacteria 2842124991 2842128571 182
141 iso_pu_bacteria 2842130223 2842134038 182
142 iso_pu_bacteria 2842152218 2842156034 182
143 iso_pu_bacteria 2842175837 2842179873 182
144 iso_pu_bacteria 2842187318 2842191886 182
145 iso_pu_bacteria 2842211629 2842216203 182
146 iso_pu_bacteria 2933006813 2933010273 182
147 iso_pu_bacteria 2933594066 2933597146 182
148 iso_pu_bacteria 2979089926 2979090182 182
149 iso_pu_bacteria 2979095461 2979095715 182
150 iso_pu_bacteria 650716007 650842509 182
151 3300009092 Ga0105250_10169452 Ga0105250_101694522 183
152 3300009545 Ga0105237_10940953 Ga0105237_109409531 183
153 3300039453 Ga0436362_0226697 Ga0436362_0226697_785_1375 183
154 3300044658 Ga0466972_0050206 Ga0466972_0050206_1177_1764 183
155 3300046459 Ga0495629_0110603 Ga0495629_0110603_284_847 183
156 3300046809 Ga0495600_0154468 Ga0495600_0154468_200_763 183
157 3300047317 Ga0495604_0726811 Ga0495604_0726811_13_576 183
158 3300048920 Ga0496117_0029843 Ga0496117_0029843_3440_4009 183
159 3300048925 Ga0496122_0003050 Ga0496122_0003050_20531_21100 183
160 3300053085 Ga0495619_0224077 Ga0495619_0224077_21_584 183
161 3300005331 Ga0070670_100000201 Ga0070670_10000020153 184
162 3300006195 Ga0075366_10051643 Ga0075366_100516433 184
163 3300009766 Ga0123342_1017549 Ga0123342_10175495 184
164 3300021320 Ga0214544_1002538 Ga0214544_10025385 184
165 3300021321 Ga0214542_1007676 Ga0214542_100767614 184
166 3300021327 Ga0214543_1005252 Ga0214543_100525218 184
167 3300050493 nmdc:mga0k408_50547_c1 nmdc:mga0k408_50547_c1_536_1099 184
168 3300053140 Ga0500573_0001149 Ga0500573_0001149_11100_11663 184
169 iso_pu_bacteria 2509276021 2509387637 184
170 iso_pu_bacteria 2509276033 2509443001 184
171 iso_pu_bacteria 2510065019 2510132374 184
172 iso_pu_bacteria 2510461076 2510898710 184
173 iso_pu_bacteria 2513237093 2513632682 184
174 iso_pu_bacteria 2513237103 2513709134 184
175 iso_pu_bacteria 2513237146 2513926452 184
176 iso_pu_bacteria 2513237162 2514020677 184
177 iso_pu_bacteria 2515154113 2515637097 184
178 iso_pu_bacteria 2515154114 2515644330 184
179 iso_pu_bacteria 2515154116 2515659119 184
180 iso_pu_bacteria 2517093000 2517094133 184
181 iso_pu_bacteria 2529292951 2530643811 184
182 iso_pu_bacteria 2599185170 2599418119 184
183 iso_pu_bacteria 2718217927 2719384942 184
184 iso_pu_bacteria 2718217997 2719664689 184
185 iso_pu_bacteria 2718218199 2720491109 184
186 iso_pu_bacteria 2718218232 2720612476 184
187 iso_pu_bacteria 2718218233 2720619319 184
188 iso_pu_bacteria 2718218235 2720630716 184
189 iso_pu_bacteria 2718218269 2720774409 184
190 iso_pu_bacteria 2718218423 2721398662 184
191 iso_pu_bacteria 2721755556 2723026135 184
192 iso_pu_bacteria 2721755684 2723559679 184
193 iso_pu_bacteria 2721755685 2723566297 184
194 iso_pu_bacteria 2721755809 2724037475 184
195 iso_pu_bacteria 2721755819 2724089016 184
196 iso_pu_bacteria 2721755822 2724103562 184
197 iso_pu_bacteria 2721755823 2724109399 184
198 iso_pu_bacteria 2728369352 2730107071 184
199 iso_pu_bacteria 2791355256 2793296271 184
200 iso_pu_bacteria 2791355259 2793316191 184
201 iso_pu_bacteria 2791355260 2793321027 184
202 iso_pu_bacteria 2791355262 2793333688 184
203 iso_pu_bacteria 2791355263 2793339712 184
204 iso_pu_bacteria 2791355265 2793355130 184
205 iso_pu_bacteria 2791355267 2793367921 184
206 iso_pu_bacteria 2802429605 2805926508 184
207 iso_pu_bacteria 2838016132 2838017358 184
208 iso_pu_bacteria 2838035591 2838041056 184
209 iso_pu_bacteria 2838042994 2838046002 184
210 iso_pu_bacteria 2838048938 2838049160 184
211 iso_pu_bacteria 2838061910 2838063394 184
212 iso_pu_bacteria 2838068647 2838072947 184
213 iso_pu_bacteria 2838661181 2838663226 184
214 iso_pu_bacteria 2841864319 2841865396 184
215 iso_pu_bacteria 2842192696 2842198019 184
216 iso_pu_bacteria 2842217011 2842221276 184
217 iso_pu_bacteria 2842264693 2842266852 184
218 iso_pu_bacteria 2842311132 2842314815 184
219 iso_pu_bacteria 2842395702 2842398183 184
220 iso_pu_bacteria 2842422224 2842426367 184
221 iso_pu_bacteria 2842428310 2842430983 184
222 iso_pu_bacteria 2842434925 2842437019 184
223 iso_pu_bacteria 2842441272 2842443097 184
224 iso_pu_bacteria 2842447887 2842452612 184
225 iso_pu_bacteria 2842462802 2842465108 184
226 iso_pu_bacteria 2842469257 2842471666 184
227 iso_pu_bacteria 2933599457 2933603862 184
228 iso_pu_bacteria 2936381700 2936384873 184
229 iso_pu_bacteria 639633055 639647503 184
230 iso_pu_bacteria 8005275841 8005279663 184
231 iso_pu_bacteria 8005282627 8005283566 184
232 iso_pu_bacteria 8005289223 8005292861 184
233 iso_pu_bacteria 8005301065 8005304667 184
234 iso_pu_bacteria 8005382845 8005385922 184
235 iso_pu_bacteria 8005395548 8005400295 184
236 iso_pu_bacteria 8005430974 8005437151 184
237 iso_pu_bacteria 8005497431 8005499423 184
238 iso_pu_bacteria 8005556819 8005558855 184
239 iso_pu_bacteria 8005563573 8005570508 184
240 iso_pu_bacteria 8005619151 8005620598 184
241 iso_pu_bacteria 8005626139 8005627035 184
242 iso_pu_bacteria 8005668836 8005670839 184
243 iso_pu_bacteria 8005688590 8005691092 184
244 iso_pu_bacteria 8005695170 8005698706 184
245 iso_pu_bacteria 8018163183 8018169437 184
246 iso_pu_bacteria 8018176218 8018182581 184
247 iso_pu_bacteria 8024479707 8024481178 184
248 iso_pu_bacteria 8024501048 8024503182 184
249 iso_pu_bacteria 8056375014 8056380801 184
250 iso_pu_bacteria 8056382006 8056384676 184
251 iso_pu_bacteria 8057874678 8057876374 184
252 3300002773 JGI25152J39213_1004710 JGI25152J39213_10047104 185
253 3300003187 JGI25151J46595_10001656 JGI25151J46595_100016565 185
254 3300003187 JGI25151J46595_10102261 JGI25151J46595_101022611 185
255 3300003771 Ga0055526_1011642 Ga0055526_10116422 185
256 3300003790 Ga0055528_1001812 Ga0055528_10018129 185
257 3300005262 Ga0065165_1073709 Ga0065165_10737091 185
258 3300005353 Ga0070669_100512644 Ga0070669_1005126442 185
259 3300006048 Ga0075363_100228160 Ga0075363_1002281602 185
260 3300021388 Ga0213875_10181540 Ga0213875_101815402 185
261 3300025258 Ga0209129_1000329 Ga0209129_10003297 185
262 3300025273 Ga0209673_1000068 Ga0209673_1000068111 185
263 3300025292 Ga0209676_1021204 Ga0209676_10212042 185
264 3300025294 Ga0209025_1001164 Ga0209025_10011647 185
265 3300025294 Ga0209025_1004041 Ga0209025_100404111 185
266 3300025295 Ga0209564_1010769 Ga0209564_10107695 185
267 3300025297 Ga0209758_1014491 Ga0209758_10144914 185
268 3300025299 Ga0209256_1005660 Ga0209256_10056602 185
269 3300025303 Ga0209051_1069242 Ga0209051_10692421 185
270 3300037853 Ga0436364_0330665 Ga0436364_0330665_194_760 185
271 3300041492 Ga0451835_0581216 Ga0451835_0581216_269_835 185
272 3300041511 Ga0451855_0185400 Ga0451855_0185400_1606_2172 185
273 3300046514 Ga0495618_0216505 Ga0495618_0216505_13_570 185
274 3300046516 Ga0495628_0842184 Ga0495628_0842184_20_577 185
275 3300047322 Ga0495680_0135241 Ga0495680_0135241_1211_1768 185
276 3300048909 Ga0496106_0756447 Ga0496106_0756447_128_694 185
277 3300048924 Ga0496121_0013911 Ga0496121_0013911_5029_5595 185
278 3300048929 Ga0496126_0441147 Ga0496126_0441147_66_632 185
279 3300049571 Ga0501034_0282258 Ga0501034_0282258_228_794 185
280 3300049574 Ga0501038_0377710 Ga0501038_0377710_290_856 185
281 3300049581 Ga0501047_0425095 Ga0501047_0425095_313_879 185
282 3300053077 Ga0495601_0006086 Ga0495601_0006086_4236_4793 185
283 3300053084 Ga0495595_0038970 Ga0495595_0038970_1543_2100 185
284 3300053085 Ga0495619_0004813 Ga0495619_0004813_6451_7008 185
285 3300003187 JGI25151J46595_10042036 JGI25151J46595_100420362 186
286 3300003856 Ga0058692_1003510 Ga0058692_10035101 186
287 3300006038 Ga0075365_10212267 Ga0075365_102122672 186
288 3300006038 Ga0075365_10315706 Ga0075365_103157062 186
289 3300006042 Ga0075368_10303948 Ga0075368_103039481 186
290 3300006048 Ga0075363_100000047 Ga0075363_10000004717 186
291 3300006051 Ga0075364_10033821 Ga0075364_100338212 186
292 3300006051 Ga0075364_10217253 Ga0075364_102172532 186
293 3300006177 Ga0075362_10010860 Ga0075362_100108606 186
294 3300006177 Ga0075362_10198397 Ga0075362_101983971 186
295 3300006177 Ga0075362_10413493 Ga0075362_104134931 186
296 3300006178 Ga0075367_10268552 Ga0075367_102685522 186
297 3300006186 Ga0075369_10004277 Ga0075369_100042772 186
298 3300006186 Ga0075369_10146155 Ga0075369_101461552 186
299 3300006186 Ga0075369_10178609 Ga0075369_101786091 186
300 3300006186 Ga0075369_10178610 Ga0075369_101786101 186
301 3300006195 Ga0075366_10002027 Ga0075366_100020272 186
302 3300006353 Ga0075370_10023974 Ga0075370_100239743 186
303 3300006353 Ga0075370_10311038 Ga0075370_103110382 186
304 3300006948 Ga0099826_10000047 Ga0099826_100000479 186
305 3300006948 Ga0099826_10002408 Ga0099826_1000240810 186
306 3300009036 Ga0105244_10107643 Ga0105244_101076432 186
307 3300009094 Ga0111539_10244328 Ga0111539_102443282 186
308 3300011119 Ga0105246_10090598 Ga0105246_100905983 186
309 3300025294 Ga0209025_1001489 Ga0209025_100148912 186
310 3300027312 Ga0209371_1000905 Ga0209371_10009059 186
311 3300027312 Ga0209371_1002763 Ga0209371_10027632 186
312 3300027666 Ga0209282_1000071 Ga0209282_100007161 186
313 3300027666 Ga0209282_1009808 Ga0209282_10098083 186
314 3300028794 Ga0307515_10004032 Ga0307515_1000403235 186
315 3300030500 Ga0268256_1000772 Ga0268256_100077223 186
316 3300030500 Ga0268256_1002467 Ga0268256_100246712 186
317 3300030744 Ga0316181_1275590 Ga0316181_12755902 186
318 3300031456 Ga0307513_10021266 Ga0307513_100212665 186
319 3300031995 Ga0307409_100630763 Ga0307409_1006307632 186
320 3300048920 Ga0496117_0000083 Ga0496117_0000083_6714_7283 186
321 3300048920 Ga0496117_0000489 Ga0496117_0000489_3077_3646 186
322 3300048921 Ga0496118_0009365 Ga0496118_0009365_3073_3642 186
323 3300048921 Ga0496118_0022439 Ga0496118_0022439_605_1174 186
324 3300048922 Ga0496119_0002362 Ga0496119_0002362_1351_1920 186
325 3300048923 Ga0496120_0000030 Ga0496120_0000030_22536_23105 186
326 3300048925 Ga0496122_0000050 Ga0496122_0000050_161544_162113 186
327 3300048925 Ga0496122_0015134 Ga0496122_0015134_4602_5171 186
328 3300048926 Ga0496123_0000052 Ga0496123_0000052_202501_203070 186
329 3300048926 Ga0496123_0043175 Ga0496123_0043175_840_1409 186
330 3300048926 Ga0496123_0060679 Ga0496123_0060679_1187_1756 186
331 3300048927 Ga0496124_0001127 Ga0496124_0001127_27500_28069 186
332 3300048927 Ga0496124_0660608 Ga0496124_0660608_22_591 186
333 3300048928 Ga0496125_0003514 Ga0496125_0003514_7757_8326 186
334 3300048928 Ga0496125_0032354 Ga0496125_0032354_3995_4564 186
335 3300048928 Ga0496125_0059146 Ga0496125_0059146_2501_3070 186
336 3300048929 Ga0496126_0003823 Ga0496126_0003823_726_1295 186
337 3300048929 Ga0496126_0199715 Ga0496126_0199715_1057_1626 186
338 3300048929 Ga0496126_0510358 Ga0496126_0510358_327_896 186
339 3300050489 nmdc:mga03683_132565_c1 nmdc:mga03683_132565_c1_64_633 186
340 3300050489 nmdc:mga03683_38520_c1 nmdc:mga03683_38520_c1_64_633 186
341 3300050489 nmdc:mga03683_6318_c1 nmdc:mga03683_6318_c1_764_1333 186
342 3300050490 nmdc:mga03n38_63_c1 nmdc:mga03n38_63_c1_21016_21585 186
343 3300050491 nmdc:mga00v17_34_c1 nmdc:mga00v17_34_c1_27153_27722 186
344 3300050492 nmdc:mga0yw44_176770_c1 nmdc:mga0yw44_176770_c1_358_927 186
345 3300050492 nmdc:mga0yw44_236910_c1 nmdc:mga0yw44_236910_c1_462_1031 186
346 3300050492 nmdc:mga0yw44_378510_c1 nmdc:mga0yw44_378510_c1_358_927 186
347 3300050492 nmdc:mga0yw44_46862_c1 nmdc:mga0yw44_46862_c1_1565_2134 186
348 3300050493 nmdc:mga0k408_2294_c2 nmdc:mga0k408_2294_c2_1422_1991 186
349 3300050495 nmdc:mga04h51_148393_c1 nmdc:mga04h51_148393_c1_231_800 186
350 3300050496 nmdc:mga07m45_19651_c2 nmdc:mga07m45_19651_c2_138_707 186
351 3300050496 nmdc:mga07m45_353471_c1 nmdc:mga07m45_353471_c1_21_590 186
352 3300050516 nmdc:mga0sz30_116744_c1 nmdc:mga0sz30_116744_c1_308_877 186
353 3300050516 nmdc:mga0sz30_23339_c1 nmdc:mga0sz30_23339_c1_1129_1698 186
354 3300053107 Ga0500560_000307 Ga0500560_000307_1896_2465 186
355 3300053157 Ga0500624_000363 Ga0500624_000363_5718_6287 186
356 iso_pu_bacteria 2855872281 2855877602 186
357 iso_pu_bacteria 643692032 643692113 186
358 3300002737 JGI25162J39368_1000729 JGI25162J39368_10007292 187
359 3300003214 JGI25165J46597_1000499 JGI25165J46597_100049917 187
360 3300025233 Ga0209437_100182 Ga0209437_10018294 187
361 3300025261 Ga0209233_1000231 Ga0209233_100023121 187
362 3300053139 Ga0500568_0039303 Ga0500568_0039303_1087_1650 187
363 3300003790 Ga0055528_1022686 Ga0055528_10226861 188
364 3300003792 Ga0055540_1000220 Ga0055540_100022013 188
365 3300006186 Ga0075369_10114524 Ga0075369_101145242 188
366 3300006353 Ga0075370_10041725 Ga0075370_100417252 188
367 3300009093 Ga0105240_10042389 Ga0105240_100423895 188
368 3300009765 Ga0123341_1000023 Ga0123341_100002364 188
369 3300013104 Ga0157370_10362468 Ga0157370_103624682 188
370 3300025273 Ga0209673_1001599 Ga0209673_10015993 188
371 3300025292 Ga0209676_1042612 Ga0209676_10426122 188
372 3300025298 Ga0209050_1006006 Ga0209050_10060062 188
373 3300025303 Ga0209051_1000198 Ga0209051_100019866 188
374 3300025303 Ga0209051_1024311 Ga0209051_10243114 188
375 3300025304 Ga0209257_1004225 Ga0209257_10042255 188
376 3300025913 Ga0207695_10166359 Ga0207695_101663592 188
377 3300025913 Ga0207695_10829404 Ga0207695_108294041 188
378 3300028794 Ga0307515_10029196 Ga0307515_100291969 188
379 3300028794 Ga0307515_10170685 Ga0307515_101706852 188
380 3300031456 Ga0307513_10691677 Ga0307513_106916772 188
381 3300035695 Ga0373927_0001302 Ga0373927_0001302_12556_13134 188
382 3300041404 Ga0439436_0056742 Ga0439436_0056742_340_918 188
383 3300041413 Ga0439465_0003666 Ga0439465_0003666_2096_2674 188
384 3300041413 Ga0439465_0006807 Ga0439465_0006807_2581_3159 188
385 3300041441 Ga0451787_491886 Ga0451787_491886_3085_3663 188
386 3300041451 Ga0451791_0424310 Ga0451791_0424310_67_645 188
387 3300041491 Ga0451833_0083042 Ga0451833_0083042_3280_3858 188
388 3300041494 Ga0451837_0270963 Ga0451837_0270963_228_806 188
389 3300041496 Ga0451839_0118925 Ga0451839_0118925_642_1220 188
390 3300041498 Ga0451841_0307837 Ga0451841_0307837_3031_3609 188
391 3300041501 Ga0451845_0134993 Ga0451845_0134993_2533_3111 188
392 3300041505 Ga0451849_0849060 Ga0451849_0849060_1338_1916 188
393 3300041507 Ga0451851_0038384 Ga0451851_0038384_3662_4240 188
394 3300041507 Ga0451851_0967754 Ga0451851_0967754_12_590 188
395 3300041509 Ga0451843_0281821 Ga0451843_0281821_348_926 188
396 3300041512 Ga0451853_3571999 Ga0451853_3571999_328_906 188
397 3300041999 Ga0439433_0062588 Ga0439433_0062588_270_848 188
398 3300042007 Ga0439449_0028141 Ga0439449_0028141_1251_1829 188
399 3300046492 Ga0495585_0011708 Ga0495585_0011708_3829_4407 188
400 3300046507 Ga0495606_0253250 Ga0495606_0253250_364_942 188
401 3300046518 Ga0495631_0011937 Ga0495631_0011937_2051_2629 188
402 3300046524 Ga0495648_0013082 Ga0495648_0013082_2355_2933 188
403 3300046538 Ga0495609_0033231 Ga0495609_0033231_653_1231 188
404 3300046558 Ga0495633_0041409 Ga0495633_0041409_359_937 188
405 3300046615 Ga0495656_0016691 Ga0495656_0016691_1738_2316 188
406 3300046648 Ga0495611_0029418 Ga0495611_0029418_1695_2273 188
407 3300046665 Ga0495661_0050694 Ga0495661_0050694_406_984 188
408 3300046691 Ga0495670_0018786 Ga0495670_0018786_2097_2675 188
409 3300047446 Ga0495679_107044 Ga0495679_107044_178_756 188
410 3300047470 Ga0495681_0058533 Ga0495681_0058533_197_775 188
411 3300047472 Ga0495686_0106118 Ga0495686_0106118_669_1247 188
412 3300048090 Ga0495615_0004490 Ga0495615_0004490_167_745 188
413 3300050496 nmdc:mga07m45_40450_c1 nmdc:mga07m45_40450_c1_680_1258 188
414 3300053122 Ga0500608_258048 Ga0500608_258048_52_630 188
415 3300053134 Ga0500658_0070200 Ga0500658_0070200_835_1413 188
416 3300053136 Ga0500559_0027239 Ga0500559_0027239_1257_1835 188
417 3300042156 Ga0439446_0027641 Ga0439446_0027641_39_608 189
418 3300006038 Ga0075365_10000314 Ga0075365_100003142 190
419 3300037471 Ga0395905_0000403 Ga0395905_0000403_54439_55023 190
420 3300050491 nmdc:mga00v17_273374_c1 nmdc:mga00v17_273374_c1_14_586 190
421 3300050492 nmdc:mga0yw44_5706_c1 nmdc:mga0yw44_5706_c1_1326_1913 190
422 iso_pu_bacteria 3005409236 3005413245 190
423 3300009553 Ga0105249_11305272 Ga0105249_113052721 191
424 3300014326 Ga0157380_10370263 Ga0157380_103702633 191
425 3300021384 Ga0213876_10083946 Ga0213876_100839462 191
426 3300039437 Ga0436365_0137067 Ga0436365_0137067_1018_1596 191
427 2162886012 MBSR1b_contig_11215141 MBSR1b_0994.00004940 192
428 3300005293 Ga0065715_10113700 Ga0065715_101137003 192
429 3300005518 Ga0070699_100024837 Ga0070699_1000248373 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

23

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9778 3 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9648 1 177
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9607 3 181
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9559 3 174
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9557 1 174
ID Description Score Start End Superfamily
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.963 10 176 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9586 4 185 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9557 1 174 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9549 4 185 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.95 1 177 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A367Z2X2-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 1 15 184 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A7C6A3F8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9959 58 188 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1G1GLS1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9957 1 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1G1GLS1-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9904 1 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4R7LCA6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9893 4 174 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
95.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map