F441850

General Info

Members Datasets Scaffolds Average Seq Length
429 205 858 241

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10085665|Ga0070701_100856652
Length 282
Sequence VRPLPSNCHVSLHDADLEPRTSNSGSRIPGPGLDPPVSRILVVEDEQHIADGLCFNLEEEGHDVIVATDGEQALALILDDRQVFDVVVLDVMLPGRDGFFVAGALRSAGQFLPILMLTARNRPEDVLKGFEAGADDYLPKPFELAILMARVNGLLRRRRWNETPLDSARGKPPDTSAAPPRDVYTFGERTLDFTAMEVRARGKSYRLTQMECDLLRYLVAHAGQPVSRGALLEDVWGLHEETDTRAIDNFIVRLRKYLEDRPDAPRIVQTVRGVGYKFVPDA

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
135 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
136 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
137 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
189 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
202 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.8
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10085665 3300005438 Bacteria 1716
2 SwRhRL2b_contig_2701188 2162886007 Bacteria 1201
3 JGI25406J46586_10000457 3300003203 Bacteria 19025
4 JGI25406J46586_10003588 3300003203 Bacteria 7279
5 Ga0065714_10080888 3300005288 Bacteria 2410
6 Ga0065704_10103130 3300005289 Bacteria 2182
7 Ga0065712_10068838 3300005290 Bacteria 8836
8 Ga0065712_10124894 3300005290 Bacteria 1605
9 Ga0065715_10006939 3300005293 Bacteria 6147
10 Ga0065715_10041621 3300005293 Bacteria 1128
11 Ga0065715_10089404 3300005293 Bacteria 10495
12 Ga0065715_10178086 3300005293 Bacteria 1496
13 Ga0065707_10090484 3300005295 Bacteria 4131
14 Ga0065707_10216546 3300005295 Bacteria 1242
15 Ga0070676_10398450 3300005328 Bacteria 957
16 Ga0070683_100085190 3300005329 Bacteria 2962
17 Ga0070690_100053207 3300005330 Bacteria 2589
18 Ga0070690_100124935 3300005330 Bacteria 1731
19 Ga0070670_100040019 3300005331 Bacteria 4032
20 Ga0070670_100305371 3300005331 Bacteria 1392
21 Ga0070670_100493110 3300005331 Bacteria 1089
22 Ga0070680_100018096 3300005336 Bacteria 5566
23 Ga0070680_100152261 3300005336 Bacteria 1942
24 Ga0070680_100278987 3300005336 Unclassified 1416
25 Ga0070691_10037941 3300005341 Bacteria 2274
26 Ga0070691_10048972 3300005341 Bacteria 2012
27 Ga0070692_10045894 3300005345 Bacteria 2255
28 Ga0070669_100050584 3300005353 Bacteria 3036
29 Ga0070675_100004074 3300005354 Bacteria 11096
30 Ga0070675_100018524 3300005354 Bacteria 5543
31 Ga0070675_100155585 3300005354 Bacteria 1963
32 Ga0070675_100197186 3300005354 Bacteria 1746
33 Ga0070675_100302601 3300005354 Bacteria 1409
34 Ga0070671_100024618 3300005355 Bacteria 4931
35 Ga0070671_100067904 3300005355 Bacteria 2973
36 Ga0070674_100000057 3300005356 Bacteria 49618
37 Ga0070673_100015555 3300005364 Bacteria 5349
38 Ga0070673_100082070 3300005364 Bacteria 2616
39 Ga0070673_100101904 3300005364 Bacteria 2366
40 Ga0070688_100033563 3300005365 Bacteria 3103
41 Ga0070667_100030383 3300005367 Bacteria 4506
42 Ga0070667_100102018 3300005367 Bacteria 2479
43 Ga0070713_100017297 3300005436 Bacteria 5449
44 Ga0070701_10228247 3300005438 Bacteria 1114
45 Ga0070705_100000092 3300005440 Bacteria 50020
46 Ga0070705_100028167 3300005440 Bacteria 3074
47 Ga0070705_100222869 3300005440 Bacteria 1307
48 Ga0070694_100002879 3300005444 Bacteria 10226
49 Ga0070694_100008039 3300005444 Bacteria 6444
50 Ga0070694_100108887 3300005444 Bacteria 1971
51 Ga0070694_100169509 3300005444 Bacteria 1607
52 Ga0070694_100273330 3300005444 Bacteria 1286
53 Ga0070694_100288330 3300005444 Bacteria 1254
54 Ga0070694_100746308 3300005444 Bacteria 799
55 Ga0070708_100198664 3300005445 Bacteria 1877
56 Ga0070708_100362053 3300005445 Bacteria 1367
57 Ga0070678_100106704 3300005456 Bacteria 2183
58 Ga0070678_100124777 3300005456 Bacteria 2036
59 Ga0070681_10007444 3300005458 Bacteria 10702
60 Ga0070681_10069400 3300005458 Bacteria 3490
61 Ga0070706_100497766 3300005467 Bacteria 1134
62 Ga0070707_100061166 3300005468 Bacteria 3611
63 Ga0070707_100180459 3300005468 Bacteria 2058
64 Ga0070707_100325696 3300005468 Bacteria 1493
65 Ga0070698_100004874 3300005471 Bacteria 14726
66 Ga0070698_100033788 3300005471 Bacteria 5297
67 Ga0070698_100110842 3300005471 Bacteria 2709
68 Ga0070698_100304635 3300005471 Bacteria 1524
69 Ga0070699_100000612 3300005518 Bacteria 33684
70 Ga0070699_100019139 3300005518 Bacteria 5890
71 Ga0070699_100031102 3300005518 Bacteria 4610
72 Ga0070699_100062498 3300005518 Bacteria 3227
73 Ga0070699_100155152 3300005518 Bacteria 2026
74 Ga0070679_100033560 3300005530 Bacteria 5082
75 Ga0070679_100195603 3300005530 Unclassified 1990
76 Ga0070679_100446431 3300005530 Bacteria 1238
77 Ga0070684_100066219 3300005535 Bacteria 3172
78 Ga0070697_100211410 3300005536 Bacteria 1651
79 Ga0068853_100150182 3300005539 Bacteria 2097
80 Ga0070672_100027140 3300005543 Bacteria 4269
81 Ga0070672_100352817 3300005543 Bacteria 1254
82 Ga0070686_100062842 3300005544 Bacteria 2404
83 Ga0070686_100217808 3300005544 Bacteria 1378
84 Ga0070695_100000002 3300005545 Bacteria 128335
85 Ga0070695_100025539 3300005545 Bacteria 3649
86 Ga0070695_100137989 3300005545 Bacteria 1687
87 Ga0070696_100009055 3300005546 Bacteria 6666
88 Ga0070696_100011100 3300005546 Bacteria 6028
89 Ga0070696_100021554 3300005546 Bacteria 4369
90 Ga0070696_100041958 3300005546 Bacteria 3163
91 Ga0070696_100069132 3300005546 Bacteria 2481
92 Ga0070696_100082956 3300005546 Bacteria 2273
93 Ga0070696_100121272 3300005546 Bacteria 1893
94 Ga0070696_100159519 3300005546 Bacteria 1661
95 Ga0070696_100212108 3300005546 Bacteria 1450
96 Ga0070665_100013699 3300005548 Bacteria 8159
97 Ga0070704_100000478 3300005549 Bacteria 18927
98 Ga0070704_100041184 3300005549 Bacteria 3186
99 Ga0070704_100059711 3300005549 Bacteria 2722
100 Ga0070704_100085379 3300005549 Bacteria 2336
101 Ga0070704_100191289 3300005549 Bacteria 1645
102 Ga0070704_100464920 3300005549 Bacteria 1092
103 Ga0070704_100664936 3300005549 Bacteria 921
104 Ga0070664_100044070 3300005564 Bacteria 3767
105 Ga0070664_100297115 3300005564 Bacteria 1459
106 Ga0070664_100372227 3300005564 Bacteria 1303
107 Ga0070702_100414871 3300005615 Bacteria 967
108 Ga0068859_100112489 3300005617 Bacteria 2786
109 Ga0068864_100012771 3300005618 Bacteria 6942
110 Ga0068864_100367624 3300005618 Bacteria 1360
111 Ga0068861_100529243 3300005719 Bacteria 1070
112 Ga0068870_10137143 3300005840 Bacteria 1428
113 Ga0068870_10229251 3300005840 Bacteria 1141
114 Ga0068863_100077652 3300005841 Bacteria 3143
115 Ga0068863_100619766 3300005841 Bacteria 1072
116 Ga0068858_100171948 3300005842 Bacteria 2043
117 Ga0068860_100608482 3300005843 Bacteria 1099
118 Ga0068862_100562515 3300005844 Bacteria 1090
119 Ga0068862_100827707 3300005844 Bacteria 906
120 Ga0068862_100844393 3300005844 Bacteria 897
121 Ga0081539_10000012 3300005985 Bacteria 440369
122 Ga0081539_10000211 3300005985 Bacteria 136221
123 Ga0081539_10001733 3300005985 Bacteria 34847
124 Ga0081539_10015835 3300005985 Bacteria 5441
125 Ga0081539_10068907 3300005985 Bacteria 1906
126 Ga0075432_10017555 3300006058 Bacteria 2440
127 Ga0097621_100568848 3300006237 Bacteria 1033
128 Ga0068871_100043339 3300006358 Bacteria 3614
129 Ga0075428_100030281 3300006844 Bacteria 5987
130 Ga0075428_100042056 3300006844 Bacteria 5026
131 Ga0075428_100048331 3300006844 Bacteria 4669
132 Ga0075428_100048574 3300006844 Bacteria 4657
133 Ga0075428_100153032 3300006844 Bacteria 2505
134 Ga0075428_101098291 3300006844 Bacteria 840
135 Ga0075430_100037958 3300006846 Bacteria 4083
136 Ga0075430_100051437 3300006846 Bacteria 3471
137 Ga0075430_100053574 3300006846 Bacteria 3396
138 Ga0075430_100143849 3300006846 Bacteria 1986
139 Ga0075431_100009311 3300006847 Bacteria 9853
140 Ga0075431_100010353 3300006847 Bacteria 9369
141 Ga0075431_100071076 3300006847 Bacteria 3590
142 Ga0075431_100133294 3300006847 Bacteria 2562
143 Ga0075431_100231077 3300006847 Bacteria 1884
144 Ga0075431_100316896 3300006847 Bacteria 1573
145 Ga0075431_100917489 3300006847 Bacteria 845
146 Ga0075433_10001828 3300006852 Bacteria 15968
147 Ga0075433_10005343 3300006852 Bacteria 10080
148 Ga0075433_10100707 3300006852 Bacteria 2558
149 Ga0075433_10497500 3300006852 Bacteria 1073
150 Ga0075434_100005506 3300006871 Bacteria 11531
151 Ga0075434_100016453 3300006871 Bacteria 7109
152 Ga0075434_100017722 3300006871 Bacteria 6865
153 Ga0075434_100043693 3300006871 Bacteria 4444
154 Ga0075434_100088551 3300006871 Bacteria 3097
155 Ga0075429_100005543 3300006880 Bacteria 10877
156 Ga0075429_100056646 3300006880 Bacteria 3412
157 Ga0075429_100172906 3300006880 Bacteria 1892
158 Ga0097620_100112487 3300006931 Bacteria 2786
159 Ga0075435_100043436 3300007076 Bacteria 3598
160 Ga0075435_100057244 3300007076 Bacteria 3153
161 Ga0075435_100126528 3300007076 Bacteria 2136
162 Ga0111539_10003780 3300009094 Bacteria 19922
163 Ga0111539_10006406 3300009094 Bacteria 15182
164 Ga0111539_10131130 3300009094 Bacteria 2935
165 Ga0111539_10179530 3300009094 Bacteria 2473
166 Ga0111539_10415968 3300009094 Bacteria 1566
167 Ga0111539_10786783 3300009094 Bacteria 1107
168 Ga0105245_10846216 3300009098 Bacteria 955
169 Ga0105247_10046195 3300009101 Bacteria 2673
170 Ga0114129_10012297 3300009147 Bacteria 12179
171 Ga0114129_10019881 3300009147 Bacteria 9557
172 Ga0114129_10030066 3300009147 Bacteria 7692
173 Ga0114129_10032842 3300009147 Bacteria 7333
174 Ga0114129_10034834 3300009147 Bacteria 7114
175 Ga0114129_10064533 3300009147 Bacteria 5111
176 Ga0114129_10071855 3300009147 Bacteria 4825
177 Ga0114129_10839258 3300009147 Bacteria 1169
178 Ga0105243_10483803 3300009148 Bacteria 1169
179 Ga0105242_10011159 3300009176 Bacteria 6904
180 Ga0105242_10077563 3300009176 Bacteria 2772
181 Ga0105242_10103391 3300009176 Bacteria 2417
182 Ga0105248_10041281 3300009177 Bacteria 5172
183 Ga0105248_10078549 3300009177 Bacteria 3710
184 Ga0105248_10096828 3300009177 Bacteria 3324
185 Ga0105248_10118851 3300009177 Bacteria 2981
186 Ga0105248_10272233 3300009177 Bacteria 1907
187 Ga0105248_10468691 3300009177 Bacteria 1420
188 Ga0105249_10254695 3300009553 Bacteria 1742
189 Ga0105249_10389497 3300009553 Bacteria 1421
190 Ga0105249_10520804 3300009553 Bacteria 1236
191 Ga0157370_10044193 3300013104 Bacteria 4283
192 Ga0157378_10055512 3300013297 Bacteria 3529
193 Ga0157378_10309923 3300013297 Bacteria 1530
194 Ga0163162_10489176 3300013306 Bacteria 1361
195 Ga0157372_10073556 3300013307 Bacteria 3853
196 Ga0157372_10140336 3300013307 Bacteria 2783
197 Ga0157375_10104751 3300013308 Bacteria 2918
198 Ga0157375_10118325 3300013308 Bacteria 2756
199 Ga0157375_10285125 3300013308 Bacteria 1815
200 Ga0157375_10479276 3300013308 Bacteria 1409
201 Ga0163163_10087366 3300014325 Bacteria 3128
202 Ga0163163_10984109 3300014325 Bacteria 907
203 Ga0157377_10015932 3300014745 Bacteria 3856
204 Ga0157379_10032513 3300014968 Bacteria 4652
205 Ga0157379_10473191 3300014968 Bacteria 1159
206 Ga0157376_10118517 3300014969 Bacteria 2342
207 Ga0157376_10392508 3300014969 Bacteria 1340
208 Ga0207682_10023405 3300025893 Bacteria 2440
209 Ga0207680_10143989 3300025903 Bacteria 1583
210 Ga0207645_10228316 3300025907 Bacteria 1228
211 Ga0207643_10142417 3300025908 Bacteria 1433
212 Ga0207684_10293660 3300025910 Bacteria 1401
213 Ga0207684_10523315 3300025910 Bacteria 1016
214 Ga0207707_10003825 3300025912 Bacteria 13336
215 Ga0207660_10000684 3300025917 Bacteria 22664
216 Ga0207660_10286189 3300025917 Unclassified 1309
217 Ga0207660_10602538 3300025917 Unclassified 895
218 Ga0207662_10202637 3300025918 Bacteria 1285
219 Ga0207662_10291080 3300025918 Bacteria 1083
220 Ga0207649_10047022 3300025920 Bacteria 2654
221 Ga0207652_10003431 3300025921 Bacteria 13079
222 Ga0207652_10199844 3300025921 Unclassified 1799
223 Ga0207652_10696805 3300025921 Unclassified 906
224 Ga0207646_10126620 3300025922 Bacteria 2297
225 Ga0207646_10221668 3300025922 Bacteria 1709
226 Ga0207646_10254704 3300025922 Bacteria 1586
227 Ga0207646_10330951 3300025922 Bacteria 1376
228 Ga0207681_10241912 3300025923 Bacteria 1405
229 Ga0207650_10039612 3300025925 Bacteria 3444
230 Ga0207650_10050878 3300025925 Bacteria 3065
231 Ga0207650_10128989 3300025925 Bacteria 1977
232 Ga0207650_10131158 3300025925 Bacteria 1961
233 Ga0207659_10010558 3300025926 Bacteria 5807
234 Ga0207659_10014643 3300025926 Bacteria 5064
235 Ga0207659_10080446 3300025926 Bacteria 2407
236 Ga0207659_10106804 3300025926 Bacteria 2120
237 Ga0207659_10152995 3300025926 Bacteria 1803
238 Ga0207687_10056584 3300025927 Bacteria 2752
239 Ga0207687_10119852 3300025927 Bacteria 1966
240 Ga0207700_10015817 3300025928 Bacteria 4991
241 Ga0207644_10013020 3300025931 Bacteria 5535
242 Ga0207644_10029226 3300025931 Bacteria 3823
243 Ga0207644_10527516 3300025931 Bacteria 976
244 Ga0207706_10295877 3300025933 Bacteria 1411
245 Ga0207686_10018902 3300025934 Bacteria 3909
246 Ga0207686_10057125 3300025934 Bacteria 2456
247 Ga0207686_10069835 3300025934 Bacteria 2255
248 Ga0207704_10410181 3300025938 Bacteria 1071
249 Ga0207691_10040988 3300025940 Bacteria 4278
250 Ga0207691_10132040 3300025940 Bacteria 2205
251 Ga0207691_10158996 3300025940 Bacteria 1983
252 Ga0207691_10336881 3300025940 Bacteria 1292
253 Ga0207711_10041973 3300025941 Bacteria 3897
254 Ga0207711_10180896 3300025941 Bacteria 1917
255 Ga0207689_10224256 3300025942 Bacteria 1553
256 Ga0207661_10295040 3300025944 Bacteria 1452
257 Ga0207651_10001056 3300025960 Bacteria 12206
258 Ga0207651_10186609 3300025960 Bacteria 1650
259 Ga0207712_10290120 3300025961 Bacteria 1338
260 Ga0207712_10610019 3300025961 Bacteria 945
261 Ga0207668_10079786 3300025972 Bacteria 2369
262 Ga0207658_10041542 3300025986 Bacteria 3331
263 Ga0207703_10098414 3300026035 Bacteria 2474
264 Ga0207639_10542751 3300026041 Bacteria 1067
265 Ga0207641_10042979 3300026088 Bacteria 3793
266 Ga0207641_10233910 3300026088 Bacteria 1709
267 Ga0207641_10353972 3300026088 Bacteria 1400
268 Ga0207648_10206555 3300026089 Bacteria 1743
269 Ga0207676_10017168 3300026095 Bacteria 5244
270 Ga0207676_10121954 3300026095 Bacteria 2200
271 Ga0207674_10194719 3300026116 Bacteria 1977
272 Ga0207674_10664495 3300026116 Bacteria 1006
273 Ga0207675_100086685 3300026118 Bacteria 2940
274 Ga0207675_100572632 3300026118 Bacteria 1130
275 Ga0207683_10127015 3300026121 Bacteria 2292
276 Ga0207683_10229146 3300026121 Bacteria 1694
277 Ga0207683_10468612 3300026121 Bacteria 1162
278 Ga0209998_10056371 3300027717 Bacteria 918
279 Ga0207428_10000359 3300027907 Bacteria 58826
280 Ga0207428_10007923 3300027907 Bacteria 9654
281 Ga0207428_10440970 3300027907 Bacteria 950
282 Ga0268266_10009270 3300028379 Bacteria 8683
283 Ga0268266_10219316 3300028379 Bacteria 1748
284 Ga0268266_10468723 3300028379 Bacteria 1199
285 Ga0307408_100065359 3300031548 Bacteria 2668
286 Ga0307408_100099378 3300031548 Bacteria 2214
287 Ga0307408_100182545 3300031548 Bacteria 1684
288 Ga0307405_10314686 3300031731 Bacteria 1193
289 Ga0307413_10082075 3300031824 Bacteria 2069
290 Ga0307413_10195722 3300031824 Bacteria 1455
291 Ga0307410_10011406 3300031852 Bacteria 5081
292 Ga0307410_10075184 3300031852 Bacteria 2355
293 Ga0307410_10576812 3300031852 Bacteria 935
294 Ga0307406_10075182 3300031901 Bacteria 2228
295 Ga0307412_10086571 3300031911 Bacteria 2181
296 Ga0307412_10116697 3300031911 Bacteria 1915
297 Ga0307409_100293819 3300031995 Unclassified 1508
298 Ga0307416_100761171 3300032002 Bacteria 1062
299 Ga0307411_10067810 3300032005 Bacteria 2402
300 Ga0307411_10239506 3300032005 Bacteria 1419
301 Ga0307415_100090201 3300032126 Bacteria 2216
302 Ga0307415_100208241 3300032126 Bacteria 1558
303 Ga0373937_0036683 3300036401 Bacteria 4468
304 Ga0373937_0230541 3300036401 Bacteria 1744
305 Ga0373937_0308800 3300036401 Bacteria 1496
306 Ga0395900_0050473 3300037418 Bacteria 4285
307 Ga0395905_0005416 3300037471 Bacteria 13042
308 Ga0450921_000237 3300042123 Bacteria 2301
309 Ga0450923_023840 3300042125 Bacteria 1210
310 Ga0450894_001355 3300042131 Bacteria 3541
311 Ga0450896_003315 3300042133 Bacteria 2132
312 Ga0450906_026325 3300042145 Bacteria 1033
313 Ga0439446_0067249 3300042156 Bacteria 1092
314 Ga0439434_0015703 3300042435 Bacteria 2258
315 Ga0439435_0009188 3300042436 Bacteria 2314
316 Ga0451577_0140873 3300042876 Bacteria 2167
317 Ga0466963_0251740 3300044694 Bacteria 1240
318 Ga0451576_0005338 3300045051 Bacteria 16152
319 Ga0451576_0021273 3300045051 Bacteria 7052
320 Ga0451576_0270747 3300045051 Bacteria 1775
321 Ga0495603_0012736 3300046455 Bacteria 5088
322 Ga0495603_0020811 3300046455 Bacteria 3972
323 Ga0495629_0001607 3300046459 Bacteria 17758
324 Ga0495639_0031997 3300046475 Bacteria 2345
325 Ga0495584_0077528 3300046491 Bacteria 1671
326 Ga0495584_0112583 3300046491 Bacteria 1377
327 Ga0495594_0038994 3300046499 Bacteria 2596
328 Ga0495594_0039842 3300046499 Bacteria 2570
329 Ga0495628_0165204 3300046516 Bacteria 1681
330 Ga0495643_0004267 3300046522 Bacteria 10083
331 Ga0495642_0004341 3300046528 Bacteria 5506
332 Ga0495598_0016414 3300046537 Bacteria 1889
333 Ga0495598_0132662 3300046537 Bacteria 855
334 Ga0495609_0025496 3300046538 Bacteria 2710
335 Ga0495621_0007014 3300046539 Bacteria 3319
336 Ga0495621_0025241 3300046539 Bacteria 1995
337 Ga0495621_0065495 3300046539 Bacteria 1328
338 Ga0495659_0016469 3300046664 Bacteria 2439
339 Ga0495659_0017173 3300046664 Bacteria 2394
340 Ga0495659_0200976 3300046664 Bacteria 817
341 Ga0495588_0006395 3300046674 Bacteria 5304
342 Ga0495646_0116401 3300046680 Bacteria 1517
343 Ga0495636_0012284 3300047318 Bacteria 3391
344 Ga0495685_008133 3300047447 Bacteria 3475
345 Ga0495684_0372082 3300047471 Bacteria 1010
346 Ga0495614_0073351 3300048089 Bacteria 1477
347 Ga0495614_0123536 3300048089 Bacteria 1143
348 Ga0496100_0413016 3300048903 Bacteria 1030
349 Ga0496102_0748849 3300048905 Bacteria 900
350 Ga0496104_0017187 3300048907 Bacteria 6580
351 Ga0496104_0484020 3300048907 Bacteria 1149
352 Ga0496105_0296052 3300048908 Bacteria 1302
353 Ga0496106_0092163 3300048909 Bacteria 2340
354 Ga0496108_0006533 3300048911 Bacteria 9455
355 Ga0496109_0000433 3300048912 Bacteria 36449
356 Ga0496109_0104683 3300048912 Bacteria 2628
357 Ga0496110_0021818 3300048913 Bacteria 5429
358 Ga0496112_0000294 3300048915 Bacteria 32431
359 Ga0496113_0005611 3300048916 Bacteria 7851
360 Ga0496126_0020566 3300048929 Bacteria 6464
361 Ga0501290_011920 3300049513 Bacteria 1124
362 Ga0501036_0161011 3300049572 Bacteria 1892
363 Ga0501038_0131044 3300049574 Bacteria 2059
364 Ga0501040_0142884 3300049576 Bacteria 1686
365 Ga0501041_0075794 3300049577 Bacteria 2069
366 Ga0501042_0089299 3300049578 Bacteria 2211
367 Ga0501046_0092455 3300049580 Bacteria 2326
368 Ga0501072_0002809 3300049588 Bacteria 13066
369 Ga0501072_0059051 3300049588 Bacteria 3024
370 Ga0501072_0439824 3300049588 Bacteria 1033
371 Ga0501074_0213559 3300049590 Bacteria 1374
372 Ga0501075_0084671 3300049591 Bacteria 2402
373 Ga0501075_0125332 3300049591 Bacteria 1955
374 Ga0501076_0004160 3300049592 Bacteria 10239
375 Ga0501076_0054644 3300049592 Bacteria 3165
376 Ga0501236_034947 3300049670 Bacteria 811
377 Ga0501079_0047349 3300049741 Bacteria 3317
378 Ga0501079_0106223 3300049741 Bacteria 2178
379 Ga0501081_0024031 3300049743 Bacteria 4090
380 Ga0501268_009999 3300049765 Bacteria 1468
381 Ga0501283_012574 3300049779 Bacteria 1274
382 Ga0501045_0028117 3300049824 Bacteria 4055
383 nmdc:mga05p37_101850_c2 3300050507 Bacteria 2583
384 nmdc:mga05p37_10739_c2 3300050507 Bacteria 7626
385 nmdc:mga05p37_124517_c1 3300050507 Bacteria 3166
386 nmdc:mga05p37_30666_c1 3300050507 Bacteria 6561
387 nmdc:mga05p37_42859_c1 3300050507 Bacteria 5563
388 nmdc:mga05p37_579176_c1 3300050507 Bacteria 1271
389 nmdc:mga05p37_58596_c1 3300050507 Bacteria 4743
390 nmdc:mga09592_298467_c1 3300050508 Bacteria 1397
391 nmdc:mga0qj67_302688_c1 3300050509 Bacteria 1295
392 nmdc:mga0qj67_363645_c1 3300050509 Bacteria 1169
393 nmdc:mga0qj67_50841_c1 3300050509 Bacteria 3277
394 nmdc:mga0qj67_55728_c1 3300050509 Bacteria 3132
395 nmdc:mga0qj67_73555_c1 3300050509 Bacteria 2730
396 nmdc:mga06r32_18355_c2 3300050510 Bacteria 4282
397 nmdc:mga06r32_26772_c1 3300050510 Bacteria 5382
398 nmdc:mga06r32_310783_c1 3300050510 Bacteria 1562
399 nmdc:mga06r32_871624_c1 3300050510 Bacteria 858
400 nmdc:mga06r32_97411_c1 3300050510 Bacteria 2882
401 nmdc:mga08y16_1180_c1 3300050511 Bacteria 25807
402 nmdc:mga08y16_131249_c1 3300050511 Bacteria 2605
403 nmdc:mga08y16_17742_c1 3300050511 Bacteria 7495
404 nmdc:mga08y16_291295_c1 3300050511 Bacteria 1683
405 nmdc:mga08y16_8526_c1 3300050511 Bacteria 10739
406 nmdc:mga0n895_105422_c1 3300050512 Bacteria 2832
407 nmdc:mga0n895_16689_c1 3300050512 Bacteria 6746
408 nmdc:mga0n895_263531_c1 3300050512 Bacteria 1749
409 nmdc:mga0n895_401_c1 3300050512 Bacteria 29147
410 nmdc:mga0n895_493175_c1 3300050512 Bacteria 1235
411 nmdc:mga0n895_93452_c1 3300050512 Bacteria 3011
412 nmdc:mga0rr50_233058_c1 3300050513 Bacteria 1524
413 nmdc:mga0rr50_260832_c1 3300050513 Bacteria 1442
414 nmdc:mga0rr50_90365_c1 3300050513 Bacteria 2383
415 nmdc:mga0a205_2615_c1 3300050515 Bacteria 15911
416 nmdc:mga0a205_31164_c2 3300050515 Bacteria 4582
417 nmdc:mga0a205_7304_c1 3300050515 Bacteria 9995
418 nmdc:mga0a205_81471_c2 3300050515 Bacteria 2654
419 Ga0495619_0188136 3300053085 Bacteria 1429
420 Ga0590071_000828 3300059421 Bacteria 8619
421 Ga0590074_001607 3300059423 Bacteria 3668
422 Ga0590075_000571 3300059424 Bacteria 9953
423 Ga0590077_001036 3300059426 Bacteria 6931
424 Ga0501082_0027965 3300060353 Bacteria 4857
425 Ga0501082_0035743 3300060353 Bacteria 4282
426 Ga0501082_0290398 3300060353 Bacteria 1424
427 Ga0501082_0304619 3300060353 Bacteria 1388
428 Ga0530510_0003724 3300061734 Bacteria 10495
429 Ga0530510_0021481 3300061734 Bacteria 4593
430 Ga0070701_10085665
431 SwRhRL2b_contig_2701188
432 JGI25406J46586_10000457
433 JGI25406J46586_10003588
434 Ga0065714_10080888
435 Ga0065704_10103130
436 Ga0065712_10068838
437 Ga0065712_10124894
438 Ga0065715_10006939
439 Ga0065715_10041621
440 Ga0065715_10089404
441 Ga0065715_10178086
442 Ga0065707_10090484
443 Ga0065707_10216546
444 Ga0070676_10398450
445 Ga0070683_100085190
446 Ga0070690_100053207
447 Ga0070690_100124935
448 Ga0070670_100040019
449 Ga0070670_100305371
450 Ga0070670_100493110
451 Ga0070680_100018096
452 Ga0070680_100152261
453 Ga0070680_100278987
454 Ga0070691_10037941
455 Ga0070691_10048972
456 Ga0070692_10045894
457 Ga0070669_100050584
458 Ga0070675_100004074
459 Ga0070675_100018524
460 Ga0070675_100155585
461 Ga0070675_100197186
462 Ga0070675_100302601
463 Ga0070671_100024618
464 Ga0070671_100067904
465 Ga0070674_100000057
466 Ga0070673_100015555
467 Ga0070673_100082070
468 Ga0070673_100101904
469 Ga0070688_100033563
470 Ga0070667_100030383
471 Ga0070667_100102018
472 Ga0070713_100017297
473 Ga0070701_10228247
474 Ga0070705_100000092
475 Ga0070705_100028167
476 Ga0070705_100222869
477 Ga0070694_100002879
478 Ga0070694_100008039
479 Ga0070694_100108887
480 Ga0070694_100169509
481 Ga0070694_100273330
482 Ga0070694_100288330
483 Ga0070694_100746308
484 Ga0070708_100198664
485 Ga0070708_100362053
486 Ga0070678_100106704
487 Ga0070678_100124777
488 Ga0070681_10007444
489 Ga0070681_10069400
490 Ga0070706_100497766
491 Ga0070707_100061166
492 Ga0070707_100180459
493 Ga0070707_100325696
494 Ga0070698_100004874
495 Ga0070698_100033788
496 Ga0070698_100110842
497 Ga0070698_100304635
498 Ga0070699_100000612
499 Ga0070699_100019139
500 Ga0070699_100031102
501 Ga0070699_100062498
502 Ga0070699_100155152
503 Ga0070679_100033560
504 Ga0070679_100195603
505 Ga0070679_100446431
506 Ga0070684_100066219
507 Ga0070697_100211410
508 Ga0068853_100150182
509 Ga0070672_100027140
510 Ga0070672_100352817
511 Ga0070686_100062842
512 Ga0070686_100217808
513 Ga0070695_100000002
514 Ga0070695_100025539
515 Ga0070695_100137989
516 Ga0070696_100009055
517 Ga0070696_100011100
518 Ga0070696_100021554
519 Ga0070696_100041958
520 Ga0070696_100069132
521 Ga0070696_100082956
522 Ga0070696_100121272
523 Ga0070696_100159519
524 Ga0070696_100212108
525 Ga0070665_100013699
526 Ga0070704_100000478
527 Ga0070704_100041184
528 Ga0070704_100059711
529 Ga0070704_100085379
530 Ga0070704_100191289
531 Ga0070704_100464920
532 Ga0070704_100664936
533 Ga0070664_100044070
534 Ga0070664_100297115
535 Ga0070664_100372227
536 Ga0070702_100414871
537 Ga0068859_100112489
538 Ga0068864_100012771
539 Ga0068864_100367624
540 Ga0068861_100529243
541 Ga0068870_10137143
542 Ga0068870_10229251
543 Ga0068863_100077652
544 Ga0068863_100619766
545 Ga0068858_100171948
546 Ga0068860_100608482
547 Ga0068862_100562515
548 Ga0068862_100827707
549 Ga0068862_100844393
550 Ga0081539_10000012
551 Ga0081539_10000211
552 Ga0081539_10001733
553 Ga0081539_10015835
554 Ga0081539_10068907
555 Ga0075432_10017555
556 Ga0097621_100568848
557 Ga0068871_100043339
558 Ga0075428_100030281
559 Ga0075428_100042056
560 Ga0075428_100048331
561 Ga0075428_100048574
562 Ga0075428_100153032
563 Ga0075428_101098291
564 Ga0075430_100037958
565 Ga0075430_100051437
566 Ga0075430_100053574
567 Ga0075430_100143849
568 Ga0075431_100009311
569 Ga0075431_100010353
570 Ga0075431_100071076
571 Ga0075431_100133294
572 Ga0075431_100231077
573 Ga0075431_100316896
574 Ga0075431_100917489
575 Ga0075433_10001828
576 Ga0075433_10005343
577 Ga0075433_10100707
578 Ga0075433_10497500
579 Ga0075434_100005506
580 Ga0075434_100016453
581 Ga0075434_100017722
582 Ga0075434_100043693
583 Ga0075434_100088551
584 Ga0075429_100005543
585 Ga0075429_100056646
586 Ga0075429_100172906
587 Ga0097620_100112487
588 Ga0075435_100043436
589 Ga0075435_100057244
590 Ga0075435_100126528
591 Ga0111539_10003780
592 Ga0111539_10006406
593 Ga0111539_10131130
594 Ga0111539_10179530
595 Ga0111539_10415968
596 Ga0111539_10786783
597 Ga0105245_10846216
598 Ga0105247_10046195
599 Ga0114129_10012297
600 Ga0114129_10019881
601 Ga0114129_10030066
602 Ga0114129_10032842
603 Ga0114129_10034834
604 Ga0114129_10064533
605 Ga0114129_10071855
606 Ga0114129_10839258
607 Ga0105243_10483803
608 Ga0105242_10011159
609 Ga0105242_10077563
610 Ga0105242_10103391
611 Ga0105248_10041281
612 Ga0105248_10078549
613 Ga0105248_10096828
614 Ga0105248_10118851
615 Ga0105248_10272233
616 Ga0105248_10468691
617 Ga0105249_10254695
618 Ga0105249_10389497
619 Ga0105249_10520804
620 Ga0157370_10044193
621 Ga0157378_10055512
622 Ga0157378_10309923
623 Ga0163162_10489176
624 Ga0157372_10073556
625 Ga0157372_10140336
626 Ga0157375_10104751
627 Ga0157375_10118325
628 Ga0157375_10285125
629 Ga0157375_10479276
630 Ga0163163_10087366
631 Ga0163163_10984109
632 Ga0157377_10015932
633 Ga0157379_10032513
634 Ga0157379_10473191
635 Ga0157376_10118517
636 Ga0157376_10392508
637 Ga0207682_10023405
638 Ga0207680_10143989
639 Ga0207645_10228316
640 Ga0207643_10142417
641 Ga0207684_10293660
642 Ga0207684_10523315
643 Ga0207707_10003825
644 Ga0207660_10000684
645 Ga0207660_10286189
646 Ga0207660_10602538
647 Ga0207662_10202637
648 Ga0207662_10291080
649 Ga0207649_10047022
650 Ga0207652_10003431
651 Ga0207652_10199844
652 Ga0207652_10696805
653 Ga0207646_10126620
654 Ga0207646_10221668
655 Ga0207646_10254704
656 Ga0207646_10330951
657 Ga0207681_10241912
658 Ga0207650_10039612
659 Ga0207650_10050878
660 Ga0207650_10128989
661 Ga0207650_10131158
662 Ga0207659_10010558
663 Ga0207659_10014643
664 Ga0207659_10080446
665 Ga0207659_10106804
666 Ga0207659_10152995
667 Ga0207687_10056584
668 Ga0207687_10119852
669 Ga0207700_10015817
670 Ga0207644_10013020
671 Ga0207644_10029226
672 Ga0207644_10527516
673 Ga0207706_10295877
674 Ga0207686_10018902
675 Ga0207686_10057125
676 Ga0207686_10069835
677 Ga0207704_10410181
678 Ga0207691_10040988
679 Ga0207691_10132040
680 Ga0207691_10158996
681 Ga0207691_10336881
682 Ga0207711_10041973
683 Ga0207711_10180896
684 Ga0207689_10224256
685 Ga0207661_10295040
686 Ga0207651_10001056
687 Ga0207651_10186609
688 Ga0207712_10290120
689 Ga0207712_10610019
690 Ga0207668_10079786
691 Ga0207658_10041542
692 Ga0207703_10098414
693 Ga0207639_10542751
694 Ga0207641_10042979
695 Ga0207641_10233910
696 Ga0207641_10353972
697 Ga0207648_10206555
698 Ga0207676_10017168
699 Ga0207676_10121954
700 Ga0207674_10194719
701 Ga0207674_10664495
702 Ga0207675_100086685
703 Ga0207675_100572632
704 Ga0207683_10127015
705 Ga0207683_10229146
706 Ga0207683_10468612
707 Ga0209998_10056371
708 Ga0207428_10000359
709 Ga0207428_10007923
710 Ga0207428_10440970
711 Ga0268266_10009270
712 Ga0268266_10219316
713 Ga0268266_10468723
714 Ga0307408_100065359
715 Ga0307408_100099378
716 Ga0307408_100182545
717 Ga0307405_10314686
718 Ga0307413_10082075
719 Ga0307413_10195722
720 Ga0307410_10011406
721 Ga0307410_10075184
722 Ga0307410_10576812
723 Ga0307406_10075182
724 Ga0307412_10086571
725 Ga0307412_10116697
726 Ga0307409_100293819
727 Ga0307416_100761171
728 Ga0307411_10067810
729 Ga0307411_10239506
730 Ga0307415_100090201
731 Ga0307415_100208241
732 Ga0373937_0036683
733 Ga0373937_0230541
734 Ga0373937_0308800
735 Ga0395900_0050473
736 Ga0395905_0005416
737 Ga0450921_000237
738 Ga0450923_023840
739 Ga0450894_001355
740 Ga0450896_003315
741 Ga0450906_026325
742 Ga0439446_0067249
743 Ga0439434_0015703
744 Ga0439435_0009188
745 Ga0451577_0140873
746 Ga0466963_0251740
747 Ga0451576_0005338
748 Ga0451576_0021273
749 Ga0451576_0270747
750 Ga0495603_0012736
751 Ga0495603_0020811
752 Ga0495629_0001607
753 Ga0495639_0031997
754 Ga0495584_0077528
755 Ga0495584_0112583
756 Ga0495594_0038994
757 Ga0495594_0039842
758 Ga0495628_0165204
759 Ga0495643_0004267
760 Ga0495642_0004341
761 Ga0495598_0016414
762 Ga0495598_0132662
763 Ga0495609_0025496
764 Ga0495621_0007014
765 Ga0495621_0025241
766 Ga0495621_0065495
767 Ga0495659_0016469
768 Ga0495659_0017173
769 Ga0495659_0200976
770 Ga0495588_0006395
771 Ga0495646_0116401
772 Ga0495636_0012284
773 Ga0495685_008133
774 Ga0495684_0372082
775 Ga0495614_0073351
776 Ga0495614_0123536
777 Ga0496100_0413016
778 Ga0496102_0748849
779 Ga0496104_0017187
780 Ga0496104_0484020
781 Ga0496105_0296052
782 Ga0496106_0092163
783 Ga0496108_0006533
784 Ga0496109_0000433
785 Ga0496109_0104683
786 Ga0496110_0021818
787 Ga0496112_0000294
788 Ga0496113_0005611
789 Ga0496126_0020566
790 Ga0501290_011920
791 Ga0501036_0161011
792 Ga0501038_0131044
793 Ga0501040_0142884
794 Ga0501041_0075794
795 Ga0501042_0089299
796 Ga0501046_0092455
797 Ga0501072_0002809
798 Ga0501072_0059051
799 Ga0501072_0439824
800 Ga0501074_0213559
801 Ga0501075_0084671
802 Ga0501075_0125332
803 Ga0501076_0004160
804 Ga0501076_0054644
805 Ga0501236_034947
806 Ga0501079_0047349
807 Ga0501079_0106223
808 Ga0501081_0024031
809 Ga0501268_009999
810 Ga0501283_012574
811 Ga0501045_0028117
812 nmdc:mga05p37_101850_c2
813 nmdc:mga05p37_10739_c2
814 nmdc:mga05p37_124517_c1
815 nmdc:mga05p37_30666_c1
816 nmdc:mga05p37_42859_c1
817 nmdc:mga05p37_579176_c1
818 nmdc:mga05p37_58596_c1
819 nmdc:mga09592_298467_c1
820 nmdc:mga0qj67_302688_c1
821 nmdc:mga0qj67_363645_c1
822 nmdc:mga0qj67_50841_c1
823 nmdc:mga0qj67_55728_c1
824 nmdc:mga0qj67_73555_c1
825 nmdc:mga06r32_18355_c2
826 nmdc:mga06r32_26772_c1
827 nmdc:mga06r32_310783_c1
828 nmdc:mga06r32_871624_c1
829 nmdc:mga06r32_97411_c1
830 nmdc:mga08y16_1180_c1
831 nmdc:mga08y16_131249_c1
832 nmdc:mga08y16_17742_c1
833 nmdc:mga08y16_291295_c1
834 nmdc:mga08y16_8526_c1
835 nmdc:mga0n895_105422_c1
836 nmdc:mga0n895_16689_c1
837 nmdc:mga0n895_263531_c1
838 nmdc:mga0n895_401_c1
839 nmdc:mga0n895_493175_c1
840 nmdc:mga0n895_93452_c1
841 nmdc:mga0rr50_233058_c1
842 nmdc:mga0rr50_260832_c1
843 nmdc:mga0rr50_90365_c1
844 nmdc:mga0a205_2615_c1
845 nmdc:mga0a205_31164_c2
846 nmdc:mga0a205_7304_c1
847 nmdc:mga0a205_81471_c2
848 Ga0495619_0188136
849 Ga0590071_000828
850 Ga0590074_001607
851 Ga0590075_000571
852 Ga0590077_001036
853 Ga0501082_0027965
854 Ga0501082_0035743
855 Ga0501082_0290398
856 Ga0501082_0304619
857 Ga0530510_0003724
858 Ga0530510_0021481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

202

278

0.98

PF00072

Response_reg

Response regulator receiver domain

40

152

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9677 2 121
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.965 1 120
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9645 1 122
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9628 3 121
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9624 1 123
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9811 1 83 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9693 1 83 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9657 1 83 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9621 3 83 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9619 3 83 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A358G4E9-F1-model_v4 deleted 0.9639 1 104
AF-A0A849T863-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9623 2 120 GO:0000155
GO:0005524
GO:0005886
AF-A0A2D9T3L3-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.961 1 120 GO:0000155
AF-A0A849U489-F1-model_v4 Response regulator transcription factor 0.9564 2 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2N2X0H8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9553 2 120 GO:0000155

Map