F441925

General Info

Members Datasets Scaffolds Average Seq Length
429 250 858 295

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10000157|Ga0207710_1000015711
Length 321
Sequence VTAALRSPAAVAALPATANRLHRMAFEGMPLALLVNPHSAGGRTLKLLPRVEQALDAGRVTFRVQRTTGLEQGVEQALRAVEAGELPVVMSGDGLVGAVGGAMAGSETPLGIIPGGRGNDLARVLGIPNDPEAAVAIVLAGATRRIDVGEANGKRFLGIASFGFDSEANRLANETNFLRGNLVYAYAALRALVSWKPARFTIAVGEERTRLSGYSVCIANSRAYGGGMYVAPAAQLDDGEFDVVTIGEVGKLRFLSNLPKVFKGTHVEQDEVRVFRASRLEVSASKPFALYADGEHLTDLPASLRVLPRALSILAPPQGDA

Samples

Sample ID Description Type Environment
1 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 0
Rhizoplane 10.02
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207710_10000157 3300025900 Bacteria 72764
2 JGI24740J21852_10042747 3300001979 Bacteria 1356
3 JGI25406J46586_10036875 3300003203 Bacteria 1770
4 JGI25407J50210_10022678 3300003373 Bacteria 1632
5 Ga0070658_10242448 3300005327 Bacteria 1528
6 Ga0070683_100003010 3300005329 Bacteria 13531
7 Ga0070683_100043153 3300005329 Bacteria 4156
8 Ga0070683_100051239 3300005329 Bacteria 3822
9 Ga0070683_100059674 3300005329 Bacteria 3544
10 Ga0070682_100114399 3300005337 Bacteria 1803
11 Ga0070660_100011810 3300005339 Bacteria 6222
12 Ga0070691_10000135 3300005341 Bacteria 22871
13 Ga0070661_100000099 3300005344 Bacteria 71115
14 Ga0070668_100027845 3300005347 Bacteria 4289
15 Ga0070668_100117295 3300005347 Bacteria 2124
16 Ga0070675_100000106 3300005354 Bacteria 49336
17 Ga0070674_100000005 3300005356 Bacteria 168443
18 Ga0070674_100000023 3300005356 Bacteria 84887
19 Ga0070673_100029630 3300005364 Bacteria 4084
20 Ga0070688_100000027 3300005365 Bacteria 67477
21 Ga0070688_100000137 3300005365 Bacteria 39585
22 Ga0070688_100063348 3300005365 Bacteria 2343
23 Ga0070667_100000785 3300005367 Bacteria 29854
24 Ga0070667_100196774 3300005367 Unclassified 1787
25 Ga0070703_10006992 3300005406 Bacteria 3163
26 Ga0070714_100106765 3300005435 Bacteria 2474
27 Ga0070713_100000010 3300005436 Bacteria 151790
28 Ga0070713_100178899 3300005436 Bacteria 1905
29 Ga0070700_100053130 3300005441 Bacteria 2528
30 Ga0070700_100086824 3300005441 Bacteria 2032
31 Ga0070663_100001051 3300005455 Bacteria 15108
32 Ga0070662_100000061 3300005457 Bacteria 58911
33 Ga0070662_100004228 3300005457 Bacteria 9051
34 Ga0068867_100001394 3300005459 Bacteria 16721
35 Ga0070685_10000118 3300005466 Bacteria 50597
36 Ga0070685_10000314 3300005466 Bacteria 30259
37 Ga0070679_100016735 3300005530 Bacteria 7085
38 Ga0070679_100022636 3300005530 Bacteria 6144
39 Ga0070684_100194450 3300005535 Bacteria 1847
40 Ga0070684_100292100 3300005535 Bacteria 1495
41 Ga0070684_100324005 3300005535 Bacteria 1415
42 Ga0070672_100000001 3300005543 Bacteria 204624
43 Ga0070696_100016466 3300005546 Bacteria 4979
44 Ga0070665_100000135 3300005548 Bacteria 138925
45 Ga0070665_100005640 3300005548 Bacteria 12868
46 Ga0070665_100023501 3300005548 Bacteria 6206
47 Ga0070665_100076674 3300005548 Bacteria 3349
48 Ga0070665_100172501 3300005548 Bacteria 2164
49 Ga0070665_100602438 3300005548 Bacteria 1112
50 Ga0070664_100057440 3300005564 Bacteria 3308
51 Ga0068854_100020687 3300005578 Bacteria 4458
52 Ga0068852_100000056 3300005616 Bacteria 76111
53 Ga0068852_100013958 3300005616 Bacteria 6163
54 Ga0068866_10000008 3300005718 Bacteria 117658
55 Ga0068866_10000262 3300005718 Bacteria 24827
56 Ga0068866_10065966 3300005718 Bacteria 1895
57 Ga0068861_100031671 3300005719 Bacteria 3887
58 Ga0068861_100047889 3300005719 Bacteria 3229
59 Ga0068851_10000404 3300005834 Bacteria 19513
60 Ga0068863_100000022 3300005841 Bacteria 188278
61 Ga0068858_100000142 3300005842 Bacteria 75787
62 Ga0068858_100054344 3300005842 Bacteria 3703
63 Ga0068860_100119092 3300005843 Bacteria 2527
64 Ga0068860_100126452 3300005843 Bacteria 2450
65 Ga0068862_100004419 3300005844 Bacteria 11866
66 Ga0081455_10094571 3300005937 Bacteria 2413
67 Ga0081455_10163901 3300005937 Bacteria 1700
68 Ga0081455_10224047 3300005937 Bacteria 1392
69 Ga0081538_10000020 3300005981 Bacteria 139567
70 Ga0081538_10000044 3300005981 Bacteria 115394
71 Ga0081538_10000087 3300005981 Bacteria 88954
72 Ga0081538_10000340 3300005981 Bacteria 53140
73 Ga0081538_10000776 3300005981 Bacteria 34847
74 Ga0081538_10002293 3300005981 Bacteria 18902
75 Ga0081538_10004121 3300005981 Bacteria 13501
76 Ga0081538_10005689 3300005981 Bacteria 11151
77 Ga0081538_10014414 3300005981 Bacteria 6192
78 Ga0081538_10023608 3300005981 Bacteria 4414
79 Ga0081539_10005142 3300005985 Bacteria 13633
80 Ga0075364_10036513 3300006051 Bacteria 3177
81 Ga0070715_10000021 3300006163 Bacteria 119283
82 Ga0070715_10083057 3300006163 Bacteria 1458
83 Ga0097621_100201029 3300006237 Unclassified 1730
84 Ga0075428_100031972 3300006844 Bacteria 5814
85 Ga0075428_100292585 3300006844 Bacteria 1751
86 Ga0075430_100000707 3300006846 Bacteria 25466
87 Ga0075431_100003285 3300006847 Bacteria 15652
88 Ga0075431_100185865 3300006847 Bacteria 2131
89 Ga0075433_10000055 3300006852 Bacteria 48950
90 Ga0068865_100000069 3300006881 Bacteria 53927
91 Ga0105240_10045145 3300009093 Bacteria 5593
92 Ga0111539_10170276 3300009094 Bacteria 2545
93 Ga0111539_10733741 3300009094 Bacteria 1150
94 Ga0105245_10000130 3300009098 Bacteria 72166
95 Ga0105245_10000141 3300009098 Bacteria 68413
96 Ga0105245_10003126 3300009098 Bacteria 14812
97 Ga0105247_10000305 3300009101 Bacteria 44071
98 Ga0114129_10039912 3300009147 Bacteria 6622
99 Ga0114129_10081084 3300009147 Bacteria 4510
100 Ga0114129_10105296 3300009147 Bacteria 3899
101 Ga0105241_10280029 3300009174 Bacteria 1424
102 Ga0105242_10000810 3300009176 Bacteria 24262
103 Ga0105248_10000020 3300009177 Bacteria 284637
104 Ga0105237_10020737 3300009545 Bacteria 6769
105 Ga0105238_10008636 3300009551 Bacteria 10194
106 Ga0105249_10012053 3300009553 Bacteria 7610
107 Ga0105249_10038261 3300009553 Bacteria 4353
108 Ga0105239_10236235 3300010375 Bacteria 2051
109 Ga0105239_10354566 3300010375 Bacteria 1656
110 Ga0157370_10009325 3300013104 Bacteria 10507
111 Ga0157370_10108133 3300013104 Bacteria 2601
112 Ga0157369_10000074 3300013105 Bacteria 136668
113 Ga0157374_10005765 3300013296 Bacteria 10452
114 Ga0157378_10005546 3300013297 Bacteria 11048
115 Ga0157378_10115691 3300013297 Bacteria 2465
116 Ga0163162_10344270 3300013306 Bacteria 1623
117 Ga0157372_10000204 3300013307 Bacteria 65798
118 Ga0157372_10139036 3300013307 Bacteria 2797
119 Ga0157375_10024712 3300013308 Bacteria 5566
120 Ga0163163_10083487 3300014325 Bacteria 3200
121 Ga0163163_10090187 3300014325 Bacteria 3079
122 Ga0157380_10005962 3300014326 Bacteria 8525
123 Ga0157379_10031518 3300014968 Bacteria 4723
124 Ga0157376_10011717 3300014969 Bacteria 6476
125 Ga0163161_10000053 3300017792 Bacteria 117408
126 Ga0206353_10475280 3300020082 Bacteria 1810
127 Ga0207656_10000269 3300025321 Bacteria 18036
128 Ga0207682_10000022 3300025893 Bacteria 62630
129 Ga0207642_10000002 3300025899 Bacteria 658166
130 Ga0207642_10000354 3300025899 Bacteria 13777
131 Ga0207642_10040235 3300025899 Bacteria 2038
132 Ga0207680_10029378 3300025903 Bacteria 3087
133 Ga0207680_10041884 3300025903 Bacteria 2675
134 Ga0207685_10000028 3300025905 Bacteria 97935
135 Ga0207705_10236100 3300025909 Bacteria 1392
136 Ga0207671_10246457 3300025914 Bacteria 1404
137 Ga0207663_10000714 3300025916 Bacteria 14787
138 Ga0207663_10005375 3300025916 Bacteria 6444
139 Ga0207660_10100738 3300025917 Bacteria 2157
140 Ga0207657_10028479 3300025919 Bacteria 5096
141 Ga0207649_10000127 3300025920 Bacteria 64603
142 Ga0207652_10002832 3300025921 Bacteria 14548
143 Ga0207694_10204950 3300025924 Bacteria 1605
144 Ga0207659_10000013 3300025926 Bacteria 172742
145 Ga0207687_10000032 3300025927 Bacteria 143196
146 Ga0207687_10000036 3300025927 Bacteria 121934
147 Ga0207687_10018997 3300025927 Bacteria 4547
148 Ga0207700_10000007 3300025928 Bacteria 345720
149 Ga0207700_10011893 3300025928 Bacteria 5579
150 Ga0207664_10010347 3300025929 Bacteria 6589
151 Ga0207690_10002231 3300025932 Bacteria 11820
152 Ga0207706_10000250 3300025933 Bacteria 58868
153 Ga0207706_10002404 3300025933 Bacteria 18253
154 Ga0207686_10001363 3300025934 Bacteria 13897
155 Ga0207686_10107753 3300025934 Bacteria 1873
156 Ga0207709_10044467 3300025935 Bacteria 2683
157 Ga0207669_10000006 3300025937 Bacteria 176348
158 Ga0207669_10000026 3300025937 Bacteria 92199
159 Ga0207704_10000049 3300025938 Bacteria 83173
160 Ga0207691_10000529 3300025940 Bacteria 38127
161 Ga0207711_10000006 3300025941 Bacteria 792692
162 Ga0207661_10000988 3300025944 Bacteria 18799
163 Ga0207661_10029272 3300025944 Bacteria 4228
164 Ga0207661_10180755 3300025944 Bacteria 1842
165 Ga0207651_10017993 3300025960 Bacteria 4192
166 Ga0207712_10000058 3300025961 Bacteria 140948
167 Ga0207712_10008023 3300025961 Bacteria 6677
168 Ga0207712_10019175 3300025961 Bacteria 4463
169 Ga0207712_10163348 3300025961 Bacteria 1733
170 Ga0207668_10014194 3300025972 Bacteria 4928
171 Ga0207640_10000134 3300025981 Bacteria 54961
172 Ga0207640_10014618 3300025981 Bacteria 4523
173 Ga0207640_10021634 3300025981 Bacteria 3837
174 Ga0207658_10059859 3300025986 Bacteria 2839
175 Ga0207658_10188613 3300025986 Unclassified 1712
176 Ga0207677_10000263 3300026023 Bacteria 39869
177 Ga0207678_10004187 3300026067 Bacteria 12947
178 Ga0207708_10006869 3300026075 Bacteria 8419
179 Ga0207708_10021608 3300026075 Bacteria 4855
180 Ga0207641_10000016 3300026088 Bacteria 307363
181 Ga0207648_10000960 3300026089 Bacteria 32619
182 Ga0207675_100006636 3300026118 Bacteria 10943
183 Ga0207675_100093710 3300026118 Bacteria 2825
184 Ga0207698_10000101 3300026142 Bacteria 54530
185 Ga0207698_10002404 3300026142 Bacteria 11077
186 Ga0268266_10000056 3300028379 Bacteria 289176
187 Ga0268266_10003660 3300028379 Bacteria 15184
188 Ga0268266_10004992 3300028379 Bacteria 12539
189 Ga0268266_10055768 3300028379 Bacteria 3398
190 Ga0268266_10134830 3300028379 Bacteria 2211
191 Ga0268266_10374732 3300028379 Bacteria 1341
192 Ga0268265_10012633 3300028380 Bacteria 5727
193 Ga0268264_10019061 3300028381 Bacteria 5609
194 Ga0265337_1000372 3300028556 Bacteria 24062
195 Ga0265326_10000092 3300028558 Bacteria 46613
196 Ga0265326_10031668 3300028558 Bacteria 1507
197 Ga0265319_1000105 3300028563 Bacteria 65502
198 Ga0265322_10000029 3300028654 Bacteria 82867
199 Ga0265338_10000507 3300028800 Bacteria 69026
200 Ga0265324_10000423 3300029957 Bacteria 30311
201 Ga0265324_10021463 3300029957 Bacteria 2315
202 Ga0265332_10012756 3300031238 Bacteria 3729
203 Ga0265320_10000011 3300031240 Bacteria 249534
204 Ga0265329_10013119 3300031242 Bacteria 2962
205 Ga0265331_10003716 3300031250 Bacteria 9705
206 Ga0265327_10000015 3300031251 Bacteria 496677
207 Ga0265316_10015977 3300031344 Bacteria 6533
208 Ga0265314_10000361 3300031711 Bacteria 63269
209 Ga0265342_10132239 3300031712 Bacteria 1397
210 Ga0307406_10250192 3300031901 Unclassified 1335
211 Ga0307415_100003076 3300032126 Bacteria 8423
212 Ga0373953_0045505 3300035117 Bacteria 1759
213 Ga0373924_0036982 3300035410 Bacteria 1986
214 Ga0373937_0065683 3300036401 Bacteria 3340
215 Ga0451853_3921635 3300041512 Bacteria 1028
216 Ga0439463_009439 3300042016 Bacteria 2401
217 Ga0439460_0057766 3300042461 Unclassified 1178
218 Ga0466963_0006811 3300044694 Bacteria 6797
219 Ga0466957_0021691 3300044842 Bacteria 3785
220 Ga0466958_0190272 3300045836 Unclassified 1304
221 Ga0466967_0000001 3300045976 Bacteria 229823
222 Ga0495592_0117118 3300046454 Bacteria 1879
223 Ga0495603_0000596 3300046455 Bacteria 20312
224 Ga0495603_0003660 3300046455 Bacteria 9145
225 Ga0495629_0002489 3300046459 Bacteria 14130
226 Ga0495638_0106745 3300046460 Bacteria 1668
227 Ga0495641_0073818 3300046461 Unclassified 1530
228 Ga0495641_0100765 3300046461 Unclassified 1289
229 Ga0495653_0033576 3300046463 Bacteria 4064
230 Ga0495582_0000001 3300046473 Bacteria 252434
231 Ga0495662_0000071 3300046476 Bacteria 35579
232 Ga0495662_0001913 3300046476 Bacteria 10453
233 Ga0495584_0043801 3300046491 Bacteria 2259
234 Ga0495608_0000007 3300046511 Bacteria 313495
235 Ga0495608_0004166 3300046511 Bacteria 10368
236 Ga0495608_0077019 3300046511 Bacteria 2171
237 Ga0495618_0000091 3300046514 Bacteria 64654
238 Ga0495620_0000139 3300046515 Bacteria 59244
239 Ga0495628_0000815 3300046516 Bacteria 28812
240 Ga0495628_0029825 3300046516 Bacteria 4420
241 Ga0495628_0035913 3300046516 Bacteria 3981
242 Ga0495630_0000075 3300046517 Bacteria 77378
243 Ga0495630_0006550 3300046517 Bacteria 8295
244 Ga0495652_0000037 3300046529 Bacteria 133232
245 Ga0495640_0103002 3300046533 Bacteria 1872
246 Ga0495586_0001547 3300046535 Bacteria 12691
247 Ga0495587_0057196 3300046536 Bacteria 2293
248 Ga0495598_0005712 3300046537 Bacteria 2774
249 Ga0495645_0049716 3300046543 Bacteria 3053
250 Ga0495622_0000080 3300046557 Bacteria 85557
251 Ga0495667_0000020 3300046559 Bacteria 180876
252 Ga0495656_0002960 3300046615 Bacteria 5700
253 Ga0495656_0083185 3300046615 Bacteria 1449
254 Ga0495625_0000409 3300046660 Bacteria 65188
255 Ga0495635_0000076 3300046663 Bacteria 61665
256 Ga0495657_0000001 3300046675 Bacteria 445641
257 Ga0495657_0019117 3300046675 Bacteria 4946
258 Ga0495647_0000001 3300046681 Bacteria 222371
259 Ga0495658_0000002 3300046683 Bacteria 309651
260 Ga0495658_0002140 3300046683 Bacteria 10004
261 Ga0495669_0000904 3300046684 Bacteria 12495
262 Ga0495613_0000005 3300046689 Bacteria 222558
263 Ga0495613_0000041 3300046689 Bacteria 130784
264 Ga0495624_0000027 3300046690 Bacteria 93611
265 Ga0495624_0000724 3300046690 Bacteria 25913
266 Ga0495670_0128987 3300046691 Bacteria 1317
267 Ga0495649_0003941 3300046694 Bacteria 9804
268 Ga0495600_0000420 3300046809 Bacteria 21910
269 Ga0495600_0001753 3300046809 Bacteria 12131
270 Ga0495604_0000050 3300047317 Bacteria 108094
271 Ga0495604_0000718 3300047317 Bacteria 28069
272 Ga0495604_0009073 3300047317 Bacteria 7869
273 Ga0495604_0027665 3300047317 Bacteria 4508
274 Ga0495674_0000030 3300047319 Bacteria 115975
275 Ga0495672_0027988 3300047320 Bacteria 3574
276 Ga0495676_0000131 3300047321 Bacteria 56689
277 Ga0495676_0000805 3300047321 Bacteria 26189
278 Ga0495676_0103977 3300047321 Bacteria 2096
279 Ga0495680_0000241 3300047322 Bacteria 60168
280 Ga0495680_0015596 3300047322 Bacteria 6552
281 Ga0495680_0042614 3300047322 Bacteria 3600
282 Ga0495675_0000055 3300047444 Bacteria 77878
283 Ga0495684_0066413 3300047471 Bacteria 2743
284 Ga0495602_0000007 3300048088 Bacteria 273212
285 Ga0495602_0001626 3300048088 Bacteria 22343
286 Ga0496100_0000001 3300048903 Bacteria 530179
287 Ga0496100_0000013 3300048903 Bacteria 177476
288 Ga0496101_0000004 3300048904 Bacteria 331599
289 Ga0496101_0000035 3300048904 Bacteria 177237
290 Ga0496102_0012974 3300048905 Bacteria 7217
291 Ga0496102_0096443 3300048905 Bacteria 2742
292 Ga0496102_0473133 3300048905 Bacteria 1174
293 Ga0496103_0017113 3300048906 Bacteria 4335
294 Ga0496103_0024830 3300048906 Bacteria 3618
295 Ga0496104_0000015 3300048907 Bacteria 374530
296 Ga0496104_0000052 3300048907 Bacteria 137286
297 Ga0496104_0000387 3300048907 Bacteria 38531
298 Ga0496104_0068705 3300048907 Bacteria 3367
299 Ga0496105_0000004 3300048908 Bacteria 475798
300 Ga0496105_0000030 3300048908 Bacteria 137325
301 Ga0496105_0001994 3300048908 Bacteria 14717
302 Ga0496106_0000062 3300048909 Bacteria 85769
303 Ga0496106_0000076 3300048909 Bacteria 79088
304 Ga0496106_0000461 3300048909 Bacteria 29143
305 Ga0496107_0000005 3300048910 Bacteria 281747
306 Ga0496107_0000020 3300048910 Bacteria 148990
307 Ga0496107_0067428 3300048910 Bacteria 2596
308 Ga0496108_0000006 3300048911 Bacteria 469473
309 Ga0496108_0000137 3300048911 Bacteria 70783
310 Ga0496108_0010488 3300048911 Bacteria 7526
311 Ga0496108_0343927 3300048911 Bacteria 1301
312 Ga0496109_0000009 3300048912 Bacteria 236561
313 Ga0496109_0000088 3300048912 Bacteria 94877
314 Ga0496109_0000218 3300048912 Bacteria 56316
315 Ga0496109_0036242 3300048912 Bacteria 4453
316 Ga0496109_0191449 3300048912 Unclassified 1922
317 Ga0496110_0000038 3300048913 Bacteria 64272
318 Ga0496110_0083707 3300048913 Bacteria 2846
319 Ga0496110_0236411 3300048913 Bacteria 1662
320 Ga0496111_0000708 3300048914 Bacteria 17669
321 Ga0496111_0025272 3300048914 Bacteria 4190
322 Ga0496112_0000025 3300048915 Bacteria 146197
323 Ga0496112_0004155 3300048915 Bacteria 12190
324 Ga0496112_0201008 3300048915 Bacteria 1952
325 Ga0496113_0000027 3300048916 Bacteria 63463
326 Ga0496113_0009653 3300048916 Bacteria 6338
327 Ga0496113_0037692 3300048916 Bacteria 3550
328 Ga0496114_0007985 3300048917 Bacteria 8374
329 Ga0496116_0000176 3300048919 Bacteria 128426
330 Ga0496117_0002925 3300048920 Bacteria 20664
331 Ga0496117_0107626 3300048920 Bacteria 1746
332 Ga0496118_0004080 3300048921 Bacteria 17711
333 Ga0496118_0096586 3300048921 Bacteria 2013
334 Ga0496119_0002021 3300048922 Bacteria 22972
335 Ga0496119_0012335 3300048922 Bacteria 6952
336 Ga0496119_0043739 3300048922 Bacteria 2827
337 Ga0496120_0011386 3300048923 Bacteria 6118
338 Ga0496121_0023938 3300048924 Bacteria 5856
339 Ga0496121_0028248 3300048924 Bacteria 5227
340 Ga0496121_0031381 3300048924 Bacteria 4855
341 Ga0496124_0082183 3300048927 Bacteria 2645
342 Ga0496124_0127606 3300048927 Bacteria 2025
343 Ga0496125_0052194 3300048928 Bacteria 3364
344 Ga0496125_0160947 3300048928 Bacteria 1525
345 Ga0496126_0005865 3300048929 Bacteria 13855
346 Ga0496126_0028478 3300048929 Bacteria 5322
347 Ga0501031_0344487 3300049568 Bacteria 965
348 Ga0501032_0001889 3300049569 Bacteria 16548
349 Ga0501033_0001429 3300049570 Bacteria 21198
350 Ga0501034_0230398 3300049571 Bacteria 1802
351 Ga0501036_0001887 3300049572 Bacteria 16280
352 Ga0501036_0313265 3300049572 Bacteria 1312
353 Ga0501037_0000985 3300049573 Bacteria 21110
354 Ga0501038_0002804 3300049574 Bacteria 16230
355 Ga0501038_0167555 3300049574 Unclassified 1781
356 Ga0501040_0040768 3300049576 Bacteria 3161
357 Ga0501040_0044721 3300049576 Bacteria 3019
358 Ga0501040_0330262 3300049576 Bacteria 1091
359 Ga0501041_0161459 3300049577 Unclassified 1401
360 Ga0501042_0016081 3300049578 Bacteria 5134
361 Ga0501042_0017416 3300049578 Bacteria 4955
362 Ga0501042_0144304 3300049578 Bacteria 1716
363 Ga0501042_0171088 3300049578 Bacteria 1567
364 Ga0501043_0002678 3300049579 Bacteria 14939
365 Ga0501043_0100314 3300049579 Bacteria 2276
366 Ga0501046_0002843 3300049580 Bacteria 16106
367 Ga0501047_0000430 3300049581 Bacteria 46649
368 Ga0501047_0008425 3300049581 Bacteria 9727
369 Ga0501047_0071337 3300049581 Bacteria 3343
370 Ga0501047_0166248 3300049581 Bacteria 2076
371 Ga0501048_0001723 3300049582 Bacteria 16662
372 Ga0501048_0020373 3300049582 Bacteria 4860
373 Ga0501048_0131645 3300049582 Bacteria 1768
374 Ga0501068_0082558 3300049584 Bacteria 1974
375 Ga0501069_0009217 3300049585 Bacteria 5206
376 Ga0501069_0012958 3300049585 Bacteria 4440
377 Ga0501070_0000592 3300049586 Bacteria 33029
378 Ga0501070_0010951 3300049586 Bacteria 7655
379 Ga0501070_0669058 3300049586 Bacteria 823
380 Ga0501071_0117152 3300049587 Bacteria 1972
381 Ga0501071_0339302 3300049587 Bacteria 1142
382 Ga0501072_0041242 3300049588 Bacteria 3625
383 Ga0501072_0066998 3300049588 Bacteria 2833
384 Ga0501073_0005921 3300049589 Bacteria 9129
385 Ga0501074_0057597 3300049590 Bacteria 2799
386 Ga0501074_0058061 3300049590 Bacteria 2787
387 Ga0501074_0145735 3300049590 Bacteria 1693
388 Ga0501074_0301774 3300049590 Bacteria 1137
389 Ga0501075_0171022 3300049591 Bacteria 1658
390 Ga0501079_0006383 3300049741 Bacteria 8853
391 Ga0501079_0016857 3300049741 Bacteria 5578
392 Ga0501079_0048459 3300049741 Bacteria 3278
393 Ga0501080_0017371 3300049742 Bacteria 6652
394 Ga0501080_0092751 3300049742 Bacteria 2804
395 Ga0501081_0039293 3300049743 Bacteria 3237
396 Ga0501081_0058185 3300049743 Unclassified 2674
397 Ga0501083_0005790 3300049744 Bacteria 8752
398 Ga0501083_0009461 3300049744 Bacteria 6883
399 Ga0501083_0048400 3300049744 Bacteria 2869
400 Ga0501035_0001710 3300049822 Bacteria 22170
401 Ga0501044_0002472 3300049823 Bacteria 21084
402 Ga0501044_0008570 3300049823 Bacteria 11202
403 Ga0501045_0237895 3300049824 Bacteria 1356
404 nmdc:mga0yw44_81730_c1 3300050492 Bacteria 2026
405 nmdc:mga05p37_111965_c1 3300050507 Bacteria 3356
406 nmdc:mga05p37_286118_c1 3300050507 Bacteria 1964
407 nmdc:mga06r32_361704_c1 3300050510 Bacteria 1435
408 nmdc:mga06r32_500200_c1 3300050510 Bacteria 1192
409 nmdc:mga08y16_533036_c1 3300050511 Bacteria 1190
410 nmdc:mga0a205_366_c1 3300050515 Bacteria 34091
411 Ga0495601_0000043 3300053077 Bacteria 77025
412 Ga0495601_0000535 3300053077 Bacteria 20089
413 Ga0495601_0027536 3300053077 Bacteria 3514
414 Ga0495612_0000114 3300053078 Bacteria 34233
415 Ga0495595_0000002 3300053084 Bacteria 445641
416 Ga0495595_0000150 3300053084 Bacteria 27718
417 Ga0495595_0004795 3300053084 Bacteria 5447
418 Ga0495595_0071905 3300053084 Bacteria 1636
419 Ga0495619_0000047 3300053085 Bacteria 102152
420 Ga0495619_0000494 3300053085 Bacteria 26437
421 Ga0495619_0002630 3300053085 Bacteria 11732
422 Ga0495619_0005486 3300053085 Bacteria 8043
423 Ga0495619_0226087 3300053085 Bacteria 1296
424 Ga0500650_0086326 3300053098 Bacteria 1469
425 Ga0500568_0048181 3300053139 Bacteria 1686
426 Ga0501084_0061273 3300054114 Bacteria 3150
427 Ga0501082_0010118 3300060353 Bacteria 8119
428 Ga0501082_0162652 3300060353 Bacteria 1940
429 Ga0501082_0187043 3300060353 Bacteria 1802
430 Ga0207710_10000157
431 JGI24740J21852_10042747
432 JGI25406J46586_10036875
433 JGI25407J50210_10022678
434 Ga0070658_10242448
435 Ga0070683_100003010
436 Ga0070683_100043153
437 Ga0070683_100051239
438 Ga0070683_100059674
439 Ga0070682_100114399
440 Ga0070660_100011810
441 Ga0070691_10000135
442 Ga0070661_100000099
443 Ga0070668_100027845
444 Ga0070668_100117295
445 Ga0070675_100000106
446 Ga0070674_100000005
447 Ga0070674_100000023
448 Ga0070673_100029630
449 Ga0070688_100000027
450 Ga0070688_100000137
451 Ga0070688_100063348
452 Ga0070667_100000785
453 Ga0070667_100196774
454 Ga0070703_10006992
455 Ga0070714_100106765
456 Ga0070713_100000010
457 Ga0070713_100178899
458 Ga0070700_100053130
459 Ga0070700_100086824
460 Ga0070663_100001051
461 Ga0070662_100000061
462 Ga0070662_100004228
463 Ga0068867_100001394
464 Ga0070685_10000118
465 Ga0070685_10000314
466 Ga0070679_100016735
467 Ga0070679_100022636
468 Ga0070684_100194450
469 Ga0070684_100292100
470 Ga0070684_100324005
471 Ga0070672_100000001
472 Ga0070696_100016466
473 Ga0070665_100000135
474 Ga0070665_100005640
475 Ga0070665_100023501
476 Ga0070665_100076674
477 Ga0070665_100172501
478 Ga0070665_100602438
479 Ga0070664_100057440
480 Ga0068854_100020687
481 Ga0068852_100000056
482 Ga0068852_100013958
483 Ga0068866_10000008
484 Ga0068866_10000262
485 Ga0068866_10065966
486 Ga0068861_100031671
487 Ga0068861_100047889
488 Ga0068851_10000404
489 Ga0068863_100000022
490 Ga0068858_100000142
491 Ga0068858_100054344
492 Ga0068860_100119092
493 Ga0068860_100126452
494 Ga0068862_100004419
495 Ga0081455_10094571
496 Ga0081455_10163901
497 Ga0081455_10224047
498 Ga0081538_10000020
499 Ga0081538_10000044
500 Ga0081538_10000087
501 Ga0081538_10000340
502 Ga0081538_10000776
503 Ga0081538_10002293
504 Ga0081538_10004121
505 Ga0081538_10005689
506 Ga0081538_10014414
507 Ga0081538_10023608
508 Ga0081539_10005142
509 Ga0075364_10036513
510 Ga0070715_10000021
511 Ga0070715_10083057
512 Ga0097621_100201029
513 Ga0075428_100031972
514 Ga0075428_100292585
515 Ga0075430_100000707
516 Ga0075431_100003285
517 Ga0075431_100185865
518 Ga0075433_10000055
519 Ga0068865_100000069
520 Ga0105240_10045145
521 Ga0111539_10170276
522 Ga0111539_10733741
523 Ga0105245_10000130
524 Ga0105245_10000141
525 Ga0105245_10003126
526 Ga0105247_10000305
527 Ga0114129_10039912
528 Ga0114129_10081084
529 Ga0114129_10105296
530 Ga0105241_10280029
531 Ga0105242_10000810
532 Ga0105248_10000020
533 Ga0105237_10020737
534 Ga0105238_10008636
535 Ga0105249_10012053
536 Ga0105249_10038261
537 Ga0105239_10236235
538 Ga0105239_10354566
539 Ga0157370_10009325
540 Ga0157370_10108133
541 Ga0157369_10000074
542 Ga0157374_10005765
543 Ga0157378_10005546
544 Ga0157378_10115691
545 Ga0163162_10344270
546 Ga0157372_10000204
547 Ga0157372_10139036
548 Ga0157375_10024712
549 Ga0163163_10083487
550 Ga0163163_10090187
551 Ga0157380_10005962
552 Ga0157379_10031518
553 Ga0157376_10011717
554 Ga0163161_10000053
555 Ga0206353_10475280
556 Ga0207656_10000269
557 Ga0207682_10000022
558 Ga0207642_10000002
559 Ga0207642_10000354
560 Ga0207642_10040235
561 Ga0207680_10029378
562 Ga0207680_10041884
563 Ga0207685_10000028
564 Ga0207705_10236100
565 Ga0207671_10246457
566 Ga0207663_10000714
567 Ga0207663_10005375
568 Ga0207660_10100738
569 Ga0207657_10028479
570 Ga0207649_10000127
571 Ga0207652_10002832
572 Ga0207694_10204950
573 Ga0207659_10000013
574 Ga0207687_10000032
575 Ga0207687_10000036
576 Ga0207687_10018997
577 Ga0207700_10000007
578 Ga0207700_10011893
579 Ga0207664_10010347
580 Ga0207690_10002231
581 Ga0207706_10000250
582 Ga0207706_10002404
583 Ga0207686_10001363
584 Ga0207686_10107753
585 Ga0207709_10044467
586 Ga0207669_10000006
587 Ga0207669_10000026
588 Ga0207704_10000049
589 Ga0207691_10000529
590 Ga0207711_10000006
591 Ga0207661_10000988
592 Ga0207661_10029272
593 Ga0207661_10180755
594 Ga0207651_10017993
595 Ga0207712_10000058
596 Ga0207712_10008023
597 Ga0207712_10019175
598 Ga0207712_10163348
599 Ga0207668_10014194
600 Ga0207640_10000134
601 Ga0207640_10014618
602 Ga0207640_10021634
603 Ga0207658_10059859
604 Ga0207658_10188613
605 Ga0207677_10000263
606 Ga0207678_10004187
607 Ga0207708_10006869
608 Ga0207708_10021608
609 Ga0207641_10000016
610 Ga0207648_10000960
611 Ga0207675_100006636
612 Ga0207675_100093710
613 Ga0207698_10000101
614 Ga0207698_10002404
615 Ga0268266_10000056
616 Ga0268266_10003660
617 Ga0268266_10004992
618 Ga0268266_10055768
619 Ga0268266_10134830
620 Ga0268266_10374732
621 Ga0268265_10012633
622 Ga0268264_10019061
623 Ga0265337_1000372
624 Ga0265326_10000092
625 Ga0265326_10031668
626 Ga0265319_1000105
627 Ga0265322_10000029
628 Ga0265338_10000507
629 Ga0265324_10000423
630 Ga0265324_10021463
631 Ga0265332_10012756
632 Ga0265320_10000011
633 Ga0265329_10013119
634 Ga0265331_10003716
635 Ga0265327_10000015
636 Ga0265316_10015977
637 Ga0265314_10000361
638 Ga0265342_10132239
639 Ga0307406_10250192
640 Ga0307415_100003076
641 Ga0373953_0045505
642 Ga0373924_0036982
643 Ga0373937_0065683
644 Ga0451853_3921635
645 Ga0439463_009439
646 Ga0439460_0057766
647 Ga0466963_0006811
648 Ga0466957_0021691
649 Ga0466958_0190272
650 Ga0466967_0000001
651 Ga0495592_0117118
652 Ga0495603_0000596
653 Ga0495603_0003660
654 Ga0495629_0002489
655 Ga0495638_0106745
656 Ga0495641_0073818
657 Ga0495641_0100765
658 Ga0495653_0033576
659 Ga0495582_0000001
660 Ga0495662_0000071
661 Ga0495662_0001913
662 Ga0495584_0043801
663 Ga0495608_0000007
664 Ga0495608_0004166
665 Ga0495608_0077019
666 Ga0495618_0000091
667 Ga0495620_0000139
668 Ga0495628_0000815
669 Ga0495628_0029825
670 Ga0495628_0035913
671 Ga0495630_0000075
672 Ga0495630_0006550
673 Ga0495652_0000037
674 Ga0495640_0103002
675 Ga0495586_0001547
676 Ga0495587_0057196
677 Ga0495598_0005712
678 Ga0495645_0049716
679 Ga0495622_0000080
680 Ga0495667_0000020
681 Ga0495656_0002960
682 Ga0495656_0083185
683 Ga0495625_0000409
684 Ga0495635_0000076
685 Ga0495657_0000001
686 Ga0495657_0019117
687 Ga0495647_0000001
688 Ga0495658_0000002
689 Ga0495658_0002140
690 Ga0495669_0000904
691 Ga0495613_0000005
692 Ga0495613_0000041
693 Ga0495624_0000027
694 Ga0495624_0000724
695 Ga0495670_0128987
696 Ga0495649_0003941
697 Ga0495600_0000420
698 Ga0495600_0001753
699 Ga0495604_0000050
700 Ga0495604_0000718
701 Ga0495604_0009073
702 Ga0495604_0027665
703 Ga0495674_0000030
704 Ga0495672_0027988
705 Ga0495676_0000131
706 Ga0495676_0000805
707 Ga0495676_0103977
708 Ga0495680_0000241
709 Ga0495680_0015596
710 Ga0495680_0042614
711 Ga0495675_0000055
712 Ga0495684_0066413
713 Ga0495602_0000007
714 Ga0495602_0001626
715 Ga0496100_0000001
716 Ga0496100_0000013
717 Ga0496101_0000004
718 Ga0496101_0000035
719 Ga0496102_0012974
720 Ga0496102_0096443
721 Ga0496102_0473133
722 Ga0496103_0017113
723 Ga0496103_0024830
724 Ga0496104_0000015
725 Ga0496104_0000052
726 Ga0496104_0000387
727 Ga0496104_0068705
728 Ga0496105_0000004
729 Ga0496105_0000030
730 Ga0496105_0001994
731 Ga0496106_0000062
732 Ga0496106_0000076
733 Ga0496106_0000461
734 Ga0496107_0000005
735 Ga0496107_0000020
736 Ga0496107_0067428
737 Ga0496108_0000006
738 Ga0496108_0000137
739 Ga0496108_0010488
740 Ga0496108_0343927
741 Ga0496109_0000009
742 Ga0496109_0000088
743 Ga0496109_0000218
744 Ga0496109_0036242
745 Ga0496109_0191449
746 Ga0496110_0000038
747 Ga0496110_0083707
748 Ga0496110_0236411
749 Ga0496111_0000708
750 Ga0496111_0025272
751 Ga0496112_0000025
752 Ga0496112_0004155
753 Ga0496112_0201008
754 Ga0496113_0000027
755 Ga0496113_0009653
756 Ga0496113_0037692
757 Ga0496114_0007985
758 Ga0496116_0000176
759 Ga0496117_0002925
760 Ga0496117_0107626
761 Ga0496118_0004080
762 Ga0496118_0096586
763 Ga0496119_0002021
764 Ga0496119_0012335
765 Ga0496119_0043739
766 Ga0496120_0011386
767 Ga0496121_0023938
768 Ga0496121_0028248
769 Ga0496121_0031381
770 Ga0496124_0082183
771 Ga0496124_0127606
772 Ga0496125_0052194
773 Ga0496125_0160947
774 Ga0496126_0005865
775 Ga0496126_0028478
776 Ga0501031_0344487
777 Ga0501032_0001889
778 Ga0501033_0001429
779 Ga0501034_0230398
780 Ga0501036_0001887
781 Ga0501036_0313265
782 Ga0501037_0000985
783 Ga0501038_0002804
784 Ga0501038_0167555
785 Ga0501040_0040768
786 Ga0501040_0044721
787 Ga0501040_0330262
788 Ga0501041_0161459
789 Ga0501042_0016081
790 Ga0501042_0017416
791 Ga0501042_0144304
792 Ga0501042_0171088
793 Ga0501043_0002678
794 Ga0501043_0100314
795 Ga0501046_0002843
796 Ga0501047_0000430
797 Ga0501047_0008425
798 Ga0501047_0071337
799 Ga0501047_0166248
800 Ga0501048_0001723
801 Ga0501048_0020373
802 Ga0501048_0131645
803 Ga0501068_0082558
804 Ga0501069_0009217
805 Ga0501069_0012958
806 Ga0501070_0000592
807 Ga0501070_0010951
808 Ga0501070_0669058
809 Ga0501071_0117152
810 Ga0501071_0339302
811 Ga0501072_0041242
812 Ga0501072_0066998
813 Ga0501073_0005921
814 Ga0501074_0057597
815 Ga0501074_0058061
816 Ga0501074_0145735
817 Ga0501074_0301774
818 Ga0501075_0171022
819 Ga0501079_0006383
820 Ga0501079_0016857
821 Ga0501079_0048459
822 Ga0501080_0017371
823 Ga0501080_0092751
824 Ga0501081_0039293
825 Ga0501081_0058185
826 Ga0501083_0005790
827 Ga0501083_0009461
828 Ga0501083_0048400
829 Ga0501035_0001710
830 Ga0501044_0002472
831 Ga0501044_0008570
832 Ga0501045_0237895
833 nmdc:mga0yw44_81730_c1
834 nmdc:mga05p37_111965_c1
835 nmdc:mga05p37_286118_c1
836 nmdc:mga06r32_361704_c1
837 nmdc:mga06r32_500200_c1
838 nmdc:mga08y16_533036_c1
839 nmdc:mga0a205_366_c1
840 Ga0495601_0000043
841 Ga0495601_0000535
842 Ga0495601_0027536
843 Ga0495612_0000114
844 Ga0495595_0000002
845 Ga0495595_0000150
846 Ga0495595_0004795
847 Ga0495595_0071905
848 Ga0495619_0000047
849 Ga0495619_0000494
850 Ga0495619_0002630
851 Ga0495619_0005486
852 Ga0495619_0226087
853 Ga0500650_0086326
854 Ga0500568_0048181
855 Ga0501084_0061273
856 Ga0501082_0010118
857 Ga0501082_0162652
858 Ga0501082_0187043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19279

YegS_C

YegS C-terminal NAD kinase beta sandwich-like domain

158

315

0.98

PF00781

DAGK_cat

Diacylglycerol kinase catalytic domain

30

151

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.859 7 287
3s40-assembly5.cif.gz_D the crystal structure of a diacylglycerol kinases from bacillus anthracis str. sterne 0.8381 7 287
2jgr-assembly1.cif.gz_A crystal structure of yegs in complex with adp 0.8333 6 285
3t5p-assembly3.cif.gz_E crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8319 7 285
3t5p-assembly1.cif.gz_F crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne 0.8287 7 285
ID Description Score Start End Superfamily
af_P9WP29_9_143_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9401 6 127 3.40.50.10330
af_Q2FWZ2_3_120_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8904 7 119 3.40.50.10330
af_Q9VNA6_190_340_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8804 6 116 3.40.50.10330
af_D3Z9Y3_114_268_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8733 7 119 3.40.50.10330
af_Q9VYY8_174_325_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.8682 5 119 3.40.50.10330
ID Description Score Start End GO Terms
AF-A0A538CDI0-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9463 8 284 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A0R2P5H7-F1-model_v4 DAGKc domain-containing protein 0.9427 8 233 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A7X3ZEY0-F1-model_v4 Diacylglycerol kinase family lipid kinase 0.9415 6 233 GO:0005524
GO:0005886
GO:0008654
GO:0016301
AF-A0A1H9NWP5-F1-model_v4 Lipid kinase, YegS/Rv2252/BmrU family 0.9409 6 281 GO:0005524
GO:0008654
GO:0016301
AF-A0A3N1D6F6-F1-model_v4 YegS/Rv2252/BmrU family lipid kinase 0.939 6 284 GO:0005524
GO:0005886
GO:0016301

Map