F441928

General Info

Members Datasets Scaffolds Average Seq Length
429 216 421 314

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10205370|Ga0207650_102053702
Length 302
Sequence MPISDTLTVTNKTHRQVLKLMGNRFELTVVSDDKDWAAKRIDEAVEEIRRIERLLTTFSEESQTNLINRYAGIKPVKVDKEIFDLIERSKRLSKITQGAFDIMTSLPDAETAKAAVHLINYKNILLDEDRCTVFLKQKGMRIGFGGIGKGYAAEKARQLMQQQGVESGIVNAAGDLTAWGLQPDGKEWTIGIADPDSTHHPFSYLSISNMAIATSGNYEKFITVNGKRYSHTIDPKTGLPVTGIKSVTIISPNAEIADAMATPVMIMGVKVGLDLINQLNGLACIIVDDYNNIHTSKNIRLQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541283 Pedobacter sp. OK701 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
211 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.23
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 0.7
Rhizosphere 86.01
Stem 0
Stem Tuber 0
Unclassified 7.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1010489 3300001904 Bacteria 1513
2 JGI24739J22299_10009347 3300001989 Bacteria 3656
3 JGI24737J22298_10004172 3300001990 Bacteria 5052
4 JGI24737J22298_10019029 3300001990 Bacteria 2197
5 JGI24735J21928_10000002 3300002067 Bacteria 624895
6 JGI24751J29686_10000335 3300002459 Bacteria 17022
7 rootH1_10028597 3300003316 Bacteria 6470
8 rootH1_10049901 3300003316 Bacteria 1460
9 rootH1_10049901 3300003323 Bacteria 7231
10 rootH1_10107750 3300003316 Bacteria 1314
11 rootH1_10124572 3300003316 Bacteria 1884
12 rootH1_10142338 3300003316 Bacteria 1341
13 rootH2_10001661 3300003320 Bacteria 18662
14 rootH2_10252229 3300003320 Unclassified 1434
15 rootL2_10054176 3300003322 Bacteria 2896
16 rootL2_10263702 3300003322 Bacteria 2485
17 rootH1_10014057 3300003323 Bacteria 12949
18 rootH1_10014058 3300003323 Bacteria 71578
19 rootH1_10020638 3300003323 Bacteria 25331
20 rootH1_10122275 3300003323 Bacteria 3043
21 rootH1_10361934 3300003323 Unclassified 1522
22 Ga0055542_1010534 3300003762 Unclassified 1684
23 Ga0055536_1000001 3300003781 Bacteria 630663
24 Ga0055530_10007469 3300003791 Bacteria 4590
25 Ga0055531_10000104 3300003794 Bacteria 92278
26 Ga0065712_10068516 3300005290 Bacteria 10145
27 Ga0070658_10134503 3300005327 Bacteria 2062
28 Ga0070658_10299504 3300005327 Bacteria 1371
29 Ga0070676_10004787 3300005328 Bacteria 7159
30 Ga0070683_100004241 3300005329 Bacteria 11758
31 Ga0070670_100101853 3300005331 Unclassified 2473
32 Ga0070670_100268817 3300005331 Bacteria 1487
33 Ga0068869_100048241 3300005334 Bacteria 3078
34 Ga0068869_100095876 3300005334 Bacteria 2239
35 Ga0070666_10000108 3300005335 Bacteria 56931
36 Ga0070682_100080060 3300005337 Unclassified 2111
37 Ga0068868_100002277 3300005338 Bacteria 13263
38 Ga0068868_100018505 3300005338 Bacteria 5210
39 Ga0070660_100060699 3300005339 Bacteria 2935
40 Ga0070661_100008691 3300005344 Bacteria 7029
41 Ga0070661_100052923 3300005344 Unclassified 2971
42 Ga0070692_10062186 3300005345 Unclassified 1970
43 Ga0070668_100141050 3300005347 Unclassified 1942
44 Ga0070669_100005547 3300005353 Bacteria 9112
45 Ga0070669_100006598 3300005353 Bacteria 8353
46 Ga0070669_100104054 3300005353 Bacteria 2146
47 Ga0070669_100113777 3300005353 Bacteria 2056
48 Ga0070674_100048137 3300005356 Unclassified 2925
49 Ga0070673_100299702 3300005364 Bacteria 1415
50 Ga0070659_100000119 3300005366 Bacteria 59333
51 Ga0070659_100003599 3300005366 Bacteria 11026
52 Ga0070659_100026815 3300005366 Bacteria 4435
53 Ga0070659_100027064 3300005366 Bacteria 4415
54 Ga0070667_100030109 3300005367 Bacteria 4526
55 Ga0070701_10154999 3300005438 Unclassified 1322
56 Ga0070663_100138710 3300005455 Unclassified 1854
57 Ga0070678_100052262 3300005456 Unclassified 2966
58 Ga0070662_100000365 3300005457 Bacteria 27040
59 Ga0070662_100229704 3300005457 Bacteria 1484
60 Ga0070681_10062764 3300005458 Bacteria 3689
61 Ga0068867_100000655 3300005459 Bacteria 22898
62 Ga0070685_10001005 3300005466 Bacteria 15141
63 Ga0070684_100003161 3300005535 Bacteria 12305
64 Ga0070684_100007775 3300005535 Bacteria 8357
65 Ga0070684_100060198 3300005535 Bacteria 3320
66 Ga0068853_100003693 3300005539 Bacteria 11746
67 Ga0068853_100014799 3300005539 Bacteria 6402
68 Ga0068853_100261516 3300005539 Bacteria 1591
69 Ga0070672_100137081 3300005543 Bacteria 2016
70 Ga0070665_100000147 3300005548 Bacteria 129683
71 Ga0070665_100105976 3300005548 Bacteria 2813
72 Ga0068855_100002857 3300005563 Bacteria 21215
73 Ga0068855_100012251 3300005563 Bacteria 10363
74 Ga0068855_100156645 3300005563 Bacteria 2587
75 Ga0068855_100157752 3300005563 Bacteria 2577
76 Ga0070664_100004752 3300005564 Bacteria 10894
77 Ga0070664_100005482 3300005564 Bacteria 10188
78 Ga0068857_100043340 3300005577 Bacteria 3992
79 Ga0068857_100071627 3300005577 Bacteria 3088
80 Ga0068857_100093730 3300005577 Bacteria 2689
81 Ga0068857_100246656 3300005577 Bacteria 1636
82 Ga0068854_100022030 3300005578 Bacteria 4333
83 Ga0068854_100086975 3300005578 Bacteria 2318
84 Ga0068854_100134999 3300005578 Bacteria 1888
85 Ga0068856_100000031 3300005614 Bacteria 126668
86 Ga0068856_100003068 3300005614 Bacteria 17069
87 Ga0068856_100018615 3300005614 Bacteria 6731
88 Ga0068856_100118033 3300005614 Bacteria 2654
89 Ga0068856_100121372 3300005614 Bacteria 2615
90 Ga0068852_100000300 3300005616 Bacteria 33247
91 Ga0068859_100000029 3300005617 Bacteria 178422
92 Ga0068859_100039224 3300005617 Bacteria 4751
93 Ga0068864_100003717 3300005618 Bacteria 12596
94 Ga0068864_100142616 3300005618 Bacteria 2163
95 Ga0068861_100129546 3300005719 Bacteria 2046
96 Ga0068870_10016854 3300005840 Bacteria 3502
97 Ga0068863_100615276 3300005841 Unclassified 1076
98 Ga0068858_100557791 3300005842 Unclassified 1109
99 Ga0068860_100008773 3300005843 Bacteria 10074
100 Ga0068860_100013160 3300005843 Bacteria 8119
101 Ga0068860_100100023 3300005843 Bacteria 2766
102 Ga0068862_100010686 3300005844 Bacteria 7582
103 Ga0075366_10022876 3300006195 Unclassified 3640
104 Ga0075366_10037790 3300006195 Bacteria 2851
105 Ga0097621_100000551 3300006237 Bacteria 26354
106 Ga0097621_100129729 3300006237 Bacteria 2145
107 Ga0068871_100000072 3300006358 Bacteria 56289
108 Ga0068871_100377296 3300006358 Unclassified 1259
109 Ga0068865_100032566 3300006881 Bacteria 3483
110 Ga0097620_100000029 3300006931 Bacteria 178422
111 Ga0097620_100039223 3300006931 Bacteria 4751
112 Ga0097620_100101400 3300006931 Bacteria 2935
113 Ga0105240_10007181 3300009093 Bacteria 16222
114 Ga0105240_10064502 3300009093 Unclassified 4551
115 Ga0105240_10082071 3300009093 Bacteria 3959
116 Ga0111539_10002347 3300009094 Bacteria 25205
117 Ga0105247_10003645 3300009101 Bacteria 10004
118 Ga0105247_10003681 3300009101 Bacteria 9947
119 Ga0114129_10004721 3300009147 Bacteria 19243
120 Ga0105243_10047286 3300009148 Bacteria 3386
121 Ga0105241_10000432 3300009174 Bacteria 31648
122 Ga0105241_10004046 3300009174 Bacteria 10856
123 Ga0105241_10087805 3300009174 Bacteria 2448
124 Ga0105241_10245671 3300009174 Unclassified 1515
125 Ga0105242_10015276 3300009176 Bacteria 5962
126 Ga0105242_10023200 3300009176 Bacteria 4891
127 Ga0105242_10116325 3300009176 Unclassified 2287
128 Ga0105248_10565593 3300009177 Bacteria 1283
129 Ga0105237_10001788 3300009545 Bacteria 27807
130 Ga0105237_10002076 3300009545 Bacteria 25338
131 Ga0105237_10003443 3300009545 Bacteria 18789
132 Ga0105237_10005179 3300009545 Bacteria 14746
133 Ga0105237_10085188 3300009545 Bacteria 3150
134 Ga0105238_10116625 3300009551 Unclassified 2650
135 Ga0105249_10035993 3300009553 Bacteria 4491
136 Ga0105249_10062005 3300009553 Bacteria 3432
137 Ga0105249_10093095 3300009553 Bacteria 2822
138 Ga0105239_10000440 3300010375 Bacteria 60691
139 Ga0105239_10000619 3300010375 Bacteria 50485
140 Ga0105239_10006039 3300010375 Bacteria 14095
141 Ga0105239_10015226 3300010375 Bacteria 8521
142 Ga0105239_10019667 3300010375 Bacteria 7453
143 Ga0105239_10029227 3300010375 Bacteria 6060
144 Ga0105239_10033260 3300010375 Bacteria 5663
145 Ga0105246_10193961 3300011119 Unclassified 1574
146 Ga0157373_10000069 3300013100 Bacteria 91687
147 Ga0157373_10000464 3300013100 Bacteria 32220
148 Ga0157373_10035895 3300013100 Bacteria 3558
149 Ga0157373_10159879 3300013100 Unclassified 1585
150 Ga0157371_10000749 3300013102 Bacteria 37566
151 Ga0157371_10000830 3300013102 Bacteria 35437
152 Ga0157371_10036161 3300013102 Bacteria 3536
153 Ga0157371_10043809 3300013102 Bacteria 3187
154 Ga0157371_10332218 3300013102 Bacteria 1104
155 Ga0157370_10002241 3300013104 Bacteria 23522
156 Ga0157370_10004238 3300013104 Bacteria 16589
157 Ga0157370_10017422 3300013104 Bacteria 7248
158 Ga0157370_10251547 3300013104 Bacteria 1634
159 Ga0157369_10041610 3300013105 Bacteria 5015
160 Ga0157369_10045401 3300013105 Unclassified 4779
161 Ga0157369_10079952 3300013105 Unclassified 3501
162 Ga0157369_10096676 3300013105 Bacteria 3150
163 Ga0157369_10108992 3300013105 Bacteria 2945
164 Ga0157369_10202761 3300013105 Bacteria 2081
165 Ga0157369_10305545 3300013105 Bacteria 1654
166 Ga0157374_10000003 3300013296 Bacteria 854471
167 Ga0157374_10000861 3300013296 Bacteria 26521
168 Ga0157374_10001224 3300013296 Bacteria 21940
169 Ga0157374_10004889 3300013296 Bacteria 11243
170 Ga0157374_10040915 3300013296 Bacteria 4269
171 Ga0157374_10470287 3300013296 Bacteria 1259
172 Ga0157378_10005725 3300013297 Bacteria 10878
173 Ga0157378_10236774 3300013297 Unclassified 1742
174 Ga0157378_10439651 3300013297 Bacteria 1293
175 Ga0163162_10000088 3300013306 Bacteria 85462
176 Ga0163162_10007256 3300013306 Bacteria 10762
177 Ga0163162_10009467 3300013306 Bacteria 9470
178 Ga0163162_10015722 3300013306 Bacteria 7395
179 Ga0163162_10018262 3300013306 Bacteria 6870
180 Ga0163162_10032210 3300013306 Bacteria 5205
181 Ga0163162_10301341 3300013306 Bacteria 1735
182 Ga0157372_10000009 3300013307 Bacteria 302051
183 Ga0157372_10001047 3300013307 Bacteria 30262
184 Ga0157372_10002190 3300013307 Bacteria 21255
185 Ga0157372_10004867 3300013307 Bacteria 14272
186 Ga0157372_10005594 3300013307 Bacteria 13364
187 Ga0157372_10014212 3300013307 Bacteria 8507
188 Ga0157372_10015726 3300013307 Bacteria 8114
189 Ga0157372_10016245 3300013307 Bacteria 7987
190 Ga0157372_10034054 3300013307 Bacteria 5597
191 Ga0157372_10040705 3300013307 Bacteria 5134
192 Ga0157372_10044140 3300013307 Bacteria 4939
193 Ga0157372_10054108 3300013307 Unclassified 4476
194 Ga0157372_10150876 3300013307 Bacteria 2682
195 Ga0157372_10181237 3300013307 Bacteria 2438
196 Ga0157372_10547808 3300013307 Bacteria 1348
197 Ga0157375_10000510 3300013308 Bacteria 34914
198 Ga0157375_10027362 3300013308 Bacteria 5330
199 Ga0157375_10049730 3300013308 Bacteria 4109
200 Ga0157375_10053244 3300013308 Bacteria 3981
201 Ga0157375_10071312 3300013308 Bacteria 3487
202 Ga0157375_10270275 3300013308 Bacteria 1862
203 Ga0163163_10059837 3300014325 Bacteria 3769
204 Ga0163163_10073560 3300014325 Bacteria 3408
205 Ga0163163_10173429 3300014325 Bacteria 2203
206 Ga0163163_10227974 3300014325 Bacteria 1912
207 Ga0163163_10332611 3300014325 Bacteria 1574
208 Ga0157380_10006904 3300014326 Bacteria 8030
209 Ga0157380_10136660 3300014326 Bacteria 2099
210 Ga0157377_10018382 3300014745 Unclassified 3631
211 Ga0157377_10071196 3300014745 Unclassified 2010
212 Ga0157379_10032654 3300014968 Bacteria 4641
213 Ga0157379_10039391 3300014968 Bacteria 4216
214 Ga0157379_10104818 3300014968 Bacteria 2538
215 Ga0157376_10002481 3300014969 Bacteria 12484
216 Ga0157376_10163873 3300014969 Bacteria 2018
217 Ga0157376_10313226 3300014969 Bacteria 1489
218 Ga0183373_1001 3300015682 Bacteria 1410374
219 Ga0163161_10001970 3300017792 Bacteria 14895
220 Ga0163161_10023768 3300017792 Bacteria 4326
221 Ga0163161_10212800 3300017792 Unclassified 1494
222 Ga0206351_10407711 3300020077 Unclassified 1593
223 Ga0213872_10033972 3300021361 Bacteria 2336
224 Ga0213876_10005503 3300021384 Bacteria 6952
225 Ga0209437_100024 3300025233 Bacteria 592878
226 Ga0209258_100252 3300025242 Bacteria 97179
227 Ga0209026_1001737 3300025250 Bacteria 9081
228 Ga0209148_1000217 3300025254 Bacteria 98076
229 Ga0209676_1000008 3300025292 Bacteria 991778
230 Ga0209050_1000343 3300025298 Bacteria 92045
231 Ga0209257_1000013 3300025304 Bacteria 1047305
232 Ga0207682_10023088 3300025893 Bacteria 2456
233 Ga0207710_10000898 3300025900 Bacteria 15911
234 Ga0207680_10000016 3300025903 Bacteria 134657
235 Ga0207647_10000040 3300025904 Bacteria 93526
236 Ga0207647_10000043 3300025904 Bacteria 91109
237 Ga0207647_10000258 3300025904 Bacteria 43440
238 Ga0207647_10015200 3300025904 Bacteria 5285
239 Ga0207645_10001124 3300025907 Bacteria 22129
240 Ga0207645_10001730 3300025907 Bacteria 17692
241 Ga0207643_10008981 3300025908 Bacteria 5365
242 Ga0207643_10033000 3300025908 Bacteria 2895
243 Ga0207705_10012408 3300025909 Bacteria 6157
244 Ga0207705_10271697 3300025909 Unclassified 1296
245 Ga0207705_10311783 3300025909 Bacteria 1208
246 Ga0207654_10008059 3300025911 Bacteria 5309
247 Ga0207654_10035035 3300025911 Bacteria 2794
248 Ga0207707_10312568 3300025912 Bacteria 1357
249 Ga0207671_10000778 3300025914 Bacteria 40392
250 Ga0207671_10003472 3300025914 Bacteria 15675
251 Ga0207671_10003995 3300025914 Bacteria 14338
252 Ga0207671_10006199 3300025914 Bacteria 10738
253 Ga0207671_10047680 3300025914 Bacteria 3171
254 Ga0207671_10053412 3300025914 Bacteria 2994
255 Ga0207657_10197009 3300025919 Unclassified 1622
256 Ga0207657_10232675 3300025919 Bacteria 1473
257 Ga0207649_10023979 3300025920 Bacteria 3540
258 Ga0207649_10297531 3300025920 Bacteria 1179
259 Ga0207650_10033375 3300025925 Bacteria 3727
260 Ga0207650_10205370 3300025925 Bacteria 1580
261 Ga0207659_10050907 3300025926 Bacteria 2944
262 Ga0207659_10056945 3300025926 Unclassified 2801
263 Ga0207644_10094365 3300025931 Bacteria 2235
264 Ga0207690_10000465 3300025932 Bacteria 26044
265 Ga0207690_10017965 3300025932 Bacteria 4330
266 Ga0207706_10000779 3300025933 Bacteria 33001
267 Ga0207706_10059354 3300025933 Bacteria 3368
268 Ga0207706_10096585 3300025933 Bacteria 2598
269 Ga0207706_10107487 3300025933 Bacteria 2455
270 Ga0207706_10186753 3300025933 Unclassified 1820
271 Ga0207686_10000655 3300025934 Bacteria 21369
272 Ga0207686_10119273 3300025934 Bacteria 1793
273 Ga0207670_10022643 3300025936 Bacteria 3897
274 Ga0207670_10059572 3300025936 Bacteria 2597
275 Ga0207670_10140453 3300025936 Bacteria 1781
276 Ga0207669_10084662 3300025937 Unclassified 2044
277 Ga0207704_10000220 3300025938 Bacteria 28668
278 Ga0207691_10017517 3300025940 Bacteria 6792
279 Ga0207691_10165431 3300025940 Unclassified 1939
280 Ga0207689_10000339 3300025942 Bacteria 43619
281 Ga0207689_10004698 3300025942 Bacteria 12328
282 Ga0207689_10068922 3300025942 Bacteria 2907
283 Ga0207661_10045479 3300025944 Bacteria 3475
284 Ga0207661_10158296 3300025944 Bacteria 1963
285 Ga0207661_10331490 3300025944 Bacteria 1370
286 Ga0207679_10013695 3300025945 Bacteria 5318
287 Ga0207679_10043023 3300025945 Unclassified 3249
288 Ga0207679_10421836 3300025945 Unclassified 1178
289 Ga0207667_10000046 3300025949 Bacteria 245420
290 Ga0207667_10006175 3300025949 Bacteria 14545
291 Ga0207667_10038440 3300025949 Bacteria 5112
292 Ga0207667_10101976 3300025949 Bacteria 2960
293 Ga0207651_10080222 3300025960 Bacteria 2348
294 Ga0207712_10008426 3300025961 Bacteria 6516
295 Ga0207712_10012326 3300025961 Bacteria 5462
296 Ga0207712_10179456 3300025961 Unclassified 1662
297 Ga0207668_10074574 3300025972 Bacteria 2436
298 Ga0207640_10022905 3300025981 Bacteria 3747
299 Ga0207640_10112504 3300025981 Bacteria 1933
300 Ga0207658_10025555 3300025986 Bacteria 4135
301 Ga0207658_10303855 3300025986 Unclassified 1375
302 Ga0207658_10403402 3300025986 Bacteria 1202
303 Ga0207677_10027005 3300026023 Bacteria 3609
304 Ga0207677_10230278 3300026023 Unclassified 1492
305 Ga0207677_10457071 3300026023 Unclassified 1095
306 Ga0207703_10478326 3300026035 Bacteria 1167
307 Ga0207639_10033641 3300026041 Bacteria 3783
308 Ga0207639_10043598 3300026041 Bacteria 3369
309 Ga0207639_10046804 3300026041 Bacteria 3265
310 Ga0207639_10210754 3300026041 Unclassified 1672
311 Ga0207678_10202183 3300026067 Unclassified 1699
312 Ga0207708_10351533 3300026075 Unclassified 1209
313 Ga0207702_10000071 3300026078 Bacteria 114394
314 Ga0207702_10010778 3300026078 Bacteria 7631
315 Ga0207702_10022805 3300026078 Bacteria 5193
316 Ga0207702_10235767 3300026078 Bacteria 1712
317 Ga0207641_10000244 3300026088 Bacteria 70430
318 Ga0207641_10121373 3300026088 Bacteria 2333
319 Ga0207648_10001785 3300026089 Bacteria 23566
320 Ga0207648_10027382 3300026089 Bacteria 5059
321 Ga0207648_10098827 3300026089 Bacteria 2556
322 Ga0207676_10003078 3300026095 Bacteria 11905
323 Ga0207676_10129029 3300026095 Bacteria 2146
324 Ga0207674_10009917 3300026116 Bacteria 10837
325 Ga0207674_10030917 3300026116 Bacteria 5628
326 Ga0207674_10037862 3300026116 Bacteria 5011
327 Ga0207674_10272021 3300026116 Bacteria 1642
328 Ga0207675_100001377 3300026118 Bacteria 24367
329 Ga0207675_100005780 3300026118 Bacteria 11828
330 Ga0207675_100059885 3300026118 Bacteria 3554
331 Ga0207683_10051591 3300026121 Bacteria 3604
332 Ga0207683_10099992 3300026121 Bacteria 2589
333 Ga0207698_10035552 3300026142 Bacteria 3646
334 Ga0207698_10070615 3300026142 Unclassified 2767
335 Ga0207698_10094192 3300026142 Bacteria 2462
336 Ga0207428_10073029 3300027907 Bacteria 2692
337 Ga0268266_10000030 3300028379 Bacteria 417120
338 Ga0268266_10109825 3300028379 Bacteria 2442
339 Ga0268265_10017475 3300028380 Bacteria 4951
340 Ga0268264_10003377 3300028381 Bacteria 13785
341 Ga0268264_10006219 3300028381 Bacteria 10077
342 Ga0268264_10043578 3300028381 Bacteria 3719
343 Ga0307517_10007033 3300028786 Bacteria 16512
344 Ga0307515_10000147 3300028794 Bacteria 170482
345 Ga0265327_10000544 3300031251 Bacteria 64453
346 Ga0265327_10059451 3300031251 Bacteria 1958
347 Ga0307513_10197305 3300031456 Bacteria 1857
348 Ga0307509_10037859 3300031507 Bacteria 5269
349 Ga0307509_10156517 3300031507 Bacteria 2184
350 Ga0307516_10001856 3300031730 Bacteria 28962
351 Ga0307405_10000002 3300031731 Bacteria 575196
352 Ga0307409_100092238 3300031995 Bacteria 2485
353 Ga0307414_10001835 3300032004 Bacteria 10977
354 Ga0307507_10000111 3300033179 Bacteria 134722
355 Ga0307510_10003615 3300033180 Bacteria 18053
356 Ga0373941_0010527 3300035115 Bacteria 2365
357 Ga0373927_0051262 3300035695 Bacteria 2669
358 Ga0373937_0066158 3300036401 Bacteria 3328
359 Ga0395899_0000220 3300037312 Bacteria 78900
360 Ga0395899_0086789 3300037312 Bacteria 2272
361 Ga0395900_0000048 3300037418 Bacteria 227760
362 Ga0395900_0000115 3300037418 Bacteria 138474
363 Ga0395900_0476042 3300037418 Unclassified 1202
364 Ga0395898_0024702 3300037466 Bacteria 6060
365 Ga0395898_0038613 3300037466 Bacteria 4731
366 Ga0395898_0055877 3300037466 Bacteria 3850
367 Ga0395905_0000045 3300037471 Bacteria 241370
368 Ga0395905_0000411 3300037471 Bacteria 60254
369 Ga0395905_0248254 3300037471 Bacteria 1663
370 Ga0395901_0000706 3300038443 Bacteria 38128
371 Ga0395901_0019801 3300038443 Bacteria 6882
372 Ga0436365_0720735 3300039437 Unclassified 2776
373 Ga0436365_1743396 3300039437 Bacteria 55864
374 Ga0436361_0831474 3300039447 Bacteria 12282
375 Ga0439436_0015882 3300041404 Bacteria 2262
376 Ga0451807_0755309 3300041486 Bacteria 1815
377 Ga0451853_4103022 3300041512 Bacteria 1202
378 Ga0439457_001778 3300042014 Bacteria 6374
379 Ga0466969_0000520 3300044656 Bacteria 21174
380 Ga0466966_0095337 3300044684 Bacteria 1843
381 Ga0466959_0000286 3300045049 Bacteria 30789
382 Ga0495651_0250413 3300046462 Bacteria 1210
383 Ga0495606_0000143 3300046507 Bacteria 123231
384 Ga0495610_0001642 3300046512 Bacteria 19658
385 Ga0495610_0001747 3300046512 Bacteria 19026
386 Ga0495616_0008524 3300046513 Bacteria 6062
387 Ga0495648_0010424 3300046524 Bacteria 7079
388 Ga0495648_0011643 3300046524 Bacteria 6608
389 Ga0495648_0042406 3300046524 Bacteria 2862
390 Ga0495587_0180621 3300046536 Unclassified 1197
391 Ga0495622_0038611 3300046557 Bacteria 2223
392 Ga0495633_0024395 3300046558 Bacteria 2989
393 Ga0495668_0000011 3300046616 Bacteria 472186
394 Ga0495668_0000023 3300046616 Bacteria 363848
395 Ga0495668_0002446 3300046616 Bacteria 15264
396 Ga0495625_0000009 3300046660 Bacteria 404954
397 Ga0495625_0008116 3300046660 Bacteria 8998
398 Ga0495625_0076019 3300046660 Unclassified 2349
399 Ga0495661_0016299 3300046665 Bacteria 4929
400 Ga0495670_0115069 3300046691 Unclassified 1394
401 Ga0495649_0000008 3300046694 Bacteria 483706
402 Ga0495660_0023770 3300046810 Bacteria 3495
403 Ga0495636_0008023 3300047318 Bacteria 4163
404 Ga0495683_0002545 3300047323 Bacteria 10956
405 Ga0495687_001322 3300047443 Bacteria 23124
406 Ga0495687_005561 3300047443 Bacteria 7988
407 Ga0496110_0379353 3300048913 Bacteria 1288
408 Ga0501242_011466 3300049674 Bacteria 1071
409 Ga0501083_0182044 3300049744 Bacteria 1372
410 nmdc:mga0k408_68577_c1 3300050493 Bacteria 2069
411 nmdc:mga08y16_72114_c1 3300050511 Unclassified 3599
412 Ga0500644_0000101 3300053088 Bacteria 54447
413 Ga0500556_0082376 3300053104 Bacteria 1218
414 Ga0500607_055454 3300053121 Unclassified 2095
415 Ga0500608_000600 3300053122 Bacteria 13258
416 Ga0500559_0016923 3300053136 Bacteria 3080
417 Ga0500568_0000407 3300053139 Bacteria 32843
418 Ga0500573_0091950 3300053140 Unclassified 1713
419 Ga0500633_0004971 3300053160 Bacteria 3112
420 Ga0500637_0032055 3300053178 Bacteria 2929
421 Ga0500637_0115506 3300053178 Unclassified 1557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013100 Ga0157373_10159879 Ga0157373_101598792 291
2 3300031995 Ga0307409_100092238 Ga0307409_1000922383 293
3 3300003323 rootH1_10122275 rootH1_101222754 300
4 3300005331 Ga0070670_100268817 Ga0070670_1002688172 300
5 3300005563 Ga0068855_100002857 Ga0068855_10000285711 300
6 3300005577 Ga0068857_100071627 Ga0068857_1000716273 300
7 3300009148 Ga0105243_10047286 Ga0105243_100472863 300
8 3300009545 Ga0105237_10002076 Ga0105237_100020764 300
9 3300009553 Ga0105249_10062005 Ga0105249_100620053 300
10 3300010375 Ga0105239_10029227 Ga0105239_100292274 300
11 3300011119 Ga0105246_10193961 Ga0105246_101939612 300
12 3300013306 Ga0163162_10007256 Ga0163162_100072569 300
13 3300013306 Ga0163162_10009467 Ga0163162_100094673 300
14 3300013307 Ga0157372_10002190 Ga0157372_1000219010 300
15 3300013308 Ga0157375_10027362 Ga0157375_100273626 300
16 3300014325 Ga0163163_10332611 Ga0163163_103326112 300
17 3300014968 Ga0157379_10032654 Ga0157379_100326542 300
18 3300025925 Ga0207650_10205370 Ga0207650_102053702 300
19 3300046691 Ga0495670_0115069 Ga0495670_0115069_465_1373 300
20 3300047318 Ga0495636_0008023 Ga0495636_0008023_2911_3816 300
21 iso_pu_bacteria 2738541283 2738758780 305
22 3300002459 JGI24751J29686_10000335 JGI24751J29686_100003354 306
23 3300003316 rootH1_10049901 rootH1_100499013 306
24 iso_pu_bacteria 2738541302 2738852229 306
25 iso_pu_bacteria 2738543023 2739300312 306
26 iso_pu_bacteria 2739367651 2739589408 306
27 3300003320 rootH2_10252229 rootH2_102522292 307
28 3300003323 rootH1_10014057 rootH1_1001405715 307
29 3300003323 rootH1_10014058 rootH1_1001405849 307
30 3300005614 Ga0068856_100018615 Ga0068856_1000186157 307
31 3300009093 Ga0105240_10007181 Ga0105240_100071815 307
32 3300013104 Ga0157370_10017422 Ga0157370_100174228 307
33 3300026078 Ga0207702_10022805 Ga0207702_100228057 307
34 3300031731 Ga0307405_10000002 Ga0307405_10000002112 307
35 3300046616 Ga0495668_0000023 Ga0495668_0000023_269854_270780 307
36 3300001990 JGI24737J22298_10019029 JGI24737J22298_100190293 308
37 3300003322 rootL2_10263702 rootL2_102637022 308
38 3300005327 Ga0070658_10134503 Ga0070658_101345032 308
39 3300005577 Ga0068857_100246656 Ga0068857_1002466561 308
40 3300005843 Ga0068860_100100023 Ga0068860_1001000232 308
41 3300009093 Ga0105240_10064502 Ga0105240_100645025 308
42 3300009174 Ga0105241_10245671 Ga0105241_102456712 308
43 3300009551 Ga0105238_10116625 Ga0105238_101166253 308
44 3300013100 Ga0157373_10000464 Ga0157373_100004649 308
45 3300013102 Ga0157371_10000749 Ga0157371_1000074910 308
46 3300013104 Ga0157370_10002241 Ga0157370_100022413 308
47 3300013105 Ga0157369_10079952 Ga0157369_100799522 308
48 3300013296 Ga0157374_10000003 Ga0157374_10000003220 308
49 3300013296 Ga0157374_10470287 Ga0157374_104702872 308
50 3300013297 Ga0157378_10236774 Ga0157378_102367743 308
51 3300013307 Ga0157372_10001047 Ga0157372_100010478 308
52 3300014968 Ga0157379_10039391 Ga0157379_100393911 308
53 3300014969 Ga0157376_10002481 Ga0157376_100024812 308
54 3300020077 Ga0206351_10407711 Ga0206351_104077112 308
55 3300025904 Ga0207647_10000043 Ga0207647_1000004331 308
56 3300026023 Ga0207677_10457071 Ga0207677_104570711 308
57 3300026116 Ga0207674_10272021 Ga0207674_102720211 308
58 3300028381 Ga0268264_10006219 Ga0268264_100062199 308
59 3300028794 Ga0307515_10000147 Ga0307515_1000014776 308
60 3300031730 Ga0307516_10001856 Ga0307516_100018564 308
61 3300053140 Ga0500573_0091950 Ga0500573_0091950_174_1103 308
62 3300053178 Ga0500637_0115506 Ga0500637_0115506_95_1024 308
63 3300003316 rootH1_10124572 rootH1_101245722 309
64 3300003316 rootH1_10142338 rootH1_101423381 309
65 3300003320 rootH2_10001661 rootH2_100016614 309
66 3300003781 Ga0055536_1000001 Ga0055536_100000170 309
67 3300003791 Ga0055530_10007469 Ga0055530_100074693 309
68 3300005327 Ga0070658_10299504 Ga0070658_102995041 309
69 3300005328 Ga0070676_10004787 Ga0070676_100047875 309
70 3300005338 Ga0068868_100002277 Ga0068868_1000022771 309
71 3300005338 Ga0068868_100018505 Ga0068868_1000185056 309
72 3300005345 Ga0070692_10062186 Ga0070692_100621862 309
73 3300005366 Ga0070659_100026815 Ga0070659_1000268156 309
74 3300005457 Ga0070662_100000365 Ga0070662_1000003652 309
75 3300005458 Ga0070681_10062764 Ga0070681_100627643 309
76 3300005459 Ga0068867_100000655 Ga0068867_10000065510 309
77 3300005539 Ga0068853_100014799 Ga0068853_1000147994 309
78 3300005539 Ga0068853_100261516 Ga0068853_1002615163 309
79 3300005548 Ga0070665_100000147 Ga0070665_10000014773 309
80 3300005563 Ga0068855_100012251 Ga0068855_1000122518 309
81 3300005563 Ga0068855_100156645 Ga0068855_1001566453 309
82 3300005563 Ga0068855_100157752 Ga0068855_1001577522 309
83 3300005578 Ga0068854_100086975 Ga0068854_1000869751 309
84 3300005614 Ga0068856_100000031 Ga0068856_10000003174 309
85 3300005614 Ga0068856_100003068 Ga0068856_10000306811 309
86 3300005614 Ga0068856_100118033 Ga0068856_1001180334 309
87 3300006237 Ga0097621_100000551 Ga0097621_10000055124 309
88 3300006358 Ga0068871_100000072 Ga0068871_10000007216 309
89 3300006881 Ga0068865_100032566 Ga0068865_1000325664 309
90 3300009093 Ga0105240_10082071 Ga0105240_100820712 309
91 3300009174 Ga0105241_10004046 Ga0105241_100040464 309
92 3300009174 Ga0105241_10087805 Ga0105241_100878052 309
93 3300009545 Ga0105237_10001788 Ga0105237_1000178810 309
94 3300009545 Ga0105237_10005179 Ga0105237_100051797 309
95 3300009545 Ga0105237_10085188 Ga0105237_100851884 309
96 3300010375 Ga0105239_10006039 Ga0105239_1000603913 309
97 3300010375 Ga0105239_10015226 Ga0105239_1001522611 309
98 3300010375 Ga0105239_10033260 Ga0105239_100332609 309
99 3300013100 Ga0157373_10000069 Ga0157373_1000006934 309
100 3300013100 Ga0157373_10035895 Ga0157373_100358952 309
101 3300013102 Ga0157371_10000830 Ga0157371_1000083039 309
102 3300013102 Ga0157371_10036161 Ga0157371_100361613 309
103 3300013102 Ga0157371_10332218 Ga0157371_103322181 309
104 3300013104 Ga0157370_10251547 Ga0157370_102515472 309
105 3300013105 Ga0157369_10041610 Ga0157369_100416104 309
106 3300013105 Ga0157369_10045401 Ga0157369_100454013 309
107 3300013105 Ga0157369_10108992 Ga0157369_101089925 309
108 3300013105 Ga0157369_10305545 Ga0157369_103055452 309
109 3300013296 Ga0157374_10000861 Ga0157374_100008612 309
110 3300013296 Ga0157374_10001224 Ga0157374_100012249 309
111 3300013297 Ga0157378_10005725 Ga0157378_100057256 309
112 3300013306 Ga0163162_10000088 Ga0163162_1000008856 309
113 3300013307 Ga0157372_10000009 Ga0157372_10000009167 309
114 3300013307 Ga0157372_10005594 Ga0157372_100055943 309
115 3300013307 Ga0157372_10015726 Ga0157372_100157266 309
116 3300013307 Ga0157372_10034054 Ga0157372_100340543 309
117 3300013307 Ga0157372_10150876 Ga0157372_101508761 309
118 3300013307 Ga0157372_10181237 Ga0157372_101812373 309
119 3300013308 Ga0157375_10049730 Ga0157375_100497304 309
120 3300014325 Ga0163163_10227974 Ga0163163_102279741 309
121 3300014969 Ga0157376_10313226 Ga0157376_103132262 309
122 3300015682 Ga0183373_1001 Ga0183373_1001289 309
123 3300017792 Ga0163161_10001970 Ga0163161_1000197010 309
124 3300021361 Ga0213872_10033972 Ga0213872_100339723 309
125 3300025292 Ga0209676_1000008 Ga0209676_1000008787 309
126 3300025298 Ga0209050_1000343 Ga0209050_10003434 309
127 3300025904 Ga0207647_10000258 Ga0207647_1000025819 309
128 3300025904 Ga0207647_10015200 Ga0207647_100152004 309
129 3300025907 Ga0207645_10001730 Ga0207645_100017307 309
130 3300025909 Ga0207705_10012408 Ga0207705_100124083 309
131 3300025909 Ga0207705_10271697 Ga0207705_102716972 309
132 3300025909 Ga0207705_10311783 Ga0207705_103117832 309
133 3300025911 Ga0207654_10035035 Ga0207654_100350351 309
134 3300025912 Ga0207707_10312568 Ga0207707_103125681 309
135 3300025914 Ga0207671_10003472 Ga0207671_1000347217 309
136 3300025914 Ga0207671_10047680 Ga0207671_100476801 309
137 3300025914 Ga0207671_10053412 Ga0207671_100534122 309
138 3300025919 Ga0207657_10232675 Ga0207657_102326751 309
139 3300025933 Ga0207706_10000779 Ga0207706_100007794 309
140 3300025938 Ga0207704_10000220 Ga0207704_1000022011 309
141 3300025944 Ga0207661_10045479 Ga0207661_100454793 309
142 3300025949 Ga0207667_10006175 Ga0207667_1000617511 309
143 3300025949 Ga0207667_10038440 Ga0207667_100384404 309
144 3300025949 Ga0207667_10101976 Ga0207667_101019764 309
145 3300025981 Ga0207640_10022905 Ga0207640_100229053 309
146 3300026023 Ga0207677_10027005 Ga0207677_100270053 309
147 3300026041 Ga0207639_10033641 Ga0207639_100336412 309
148 3300026041 Ga0207639_10046804 Ga0207639_100468042 309
149 3300026078 Ga0207702_10000071 Ga0207702_1000007175 309
150 3300026078 Ga0207702_10010778 Ga0207702_100107785 309
151 3300026078 Ga0207702_10235767 Ga0207702_102357671 309
152 3300026089 Ga0207648_10001785 Ga0207648_1000178514 309
153 3300026142 Ga0207698_10035552 Ga0207698_100355523 309
154 3300028379 Ga0268266_10000030 Ga0268266_10000030366 309
155 3300028786 Ga0307517_10007033 Ga0307517_100070337 309
156 3300031251 Ga0265327_10059451 Ga0265327_100594511 309
157 3300031507 Ga0307509_10037859 Ga0307509_100378596 309
158 3300032004 Ga0307414_10001835 Ga0307414_100018355 309
159 3300033179 Ga0307507_10000111 Ga0307507_10000111112 309
160 3300033180 Ga0307510_10003615 Ga0307510_1000361517 309
161 3300035115 Ga0373941_0010527 Ga0373941_0010527_177_1109 309
162 3300035695 Ga0373927_0051262 Ga0373927_0051262_134_1066 309
163 3300036401 Ga0373937_0066158 Ga0373937_0066158_774_1706 309
164 3300037312 Ga0395899_0000220 Ga0395899_0000220_35591_36523 309
165 3300037312 Ga0395899_0086789 Ga0395899_0086789_641_1708 309
166 3300037418 Ga0395900_0000048 Ga0395900_0000048_203852_204808 309
167 3300037418 Ga0395900_0000115 Ga0395900_0000115_24021_24962 309
168 3300037418 Ga0395900_0476042 Ga0395900_0476042_121_1077 309
169 3300037466 Ga0395898_0024702 Ga0395898_0024702_4480_5547 309
170 3300037466 Ga0395898_0038613 Ga0395898_0038613_2334_3275 309
171 3300037466 Ga0395898_0055877 Ga0395898_0055877_2678_3610 309
172 3300037471 Ga0395905_0000045 Ga0395905_0000045_23827_24768 309
173 3300037471 Ga0395905_0000411 Ga0395905_0000411_37839_38969 309
174 3300037471 Ga0395905_0248254 Ga0395905_0248254_398_1342 309
175 3300038443 Ga0395901_0000706 Ga0395901_0000706_32443_33384 309
176 3300038443 Ga0395901_0019801 Ga0395901_0019801_5075_6142 309
177 3300039447 Ga0436361_0831474 Ga0436361_0831474_10421_11353 309
178 3300044656 Ga0466969_0000520 Ga0466969_0000520_17696_18634 309
179 3300044684 Ga0466966_0095337 Ga0466966_0095337_807_1745 309
180 3300045049 Ga0466959_0000286 Ga0466959_0000286_5761_6699 309
181 3300046462 Ga0495651_0250413 Ga0495651_0250413_130_1083 309
182 3300046512 Ga0495610_0001642 Ga0495610_0001642_11762_12694 309
183 3300046524 Ga0495648_0011643 Ga0495648_0011643_5314_6246 309
184 3300046536 Ga0495587_0180621 Ga0495587_0180621_166_1098 309
185 3300046616 Ga0495668_0000011 Ga0495668_0000011_108401_109333 309
186 3300047323 Ga0495683_0002545 Ga0495683_0002545_7669_8601 309
187 3300047443 Ga0495687_001322 Ga0495687_001322_13740_14684 309
188 3300049674 Ga0501242_011466 Ga0501242_011466_88_1044 309
189 3300053122 Ga0500608_000600 Ga0500608_000600_7231_8163 309
190 3300053178 Ga0500637_0032055 Ga0500637_0032055_958_1890 309
191 iso_pu_bacteria 2599185184 2599478098 309
192 iso_pu_bacteria 2928147474 2928147482 309
193 iso_pu_bacteria 2932082852 2932083593 309
194 iso_pu_bacteria 2738541278 2738731248 310
195 iso_pu_bacteria 2977232053 2977232098 310
196 3300053088 Ga0500644_0000101 Ga0500644_0000101_2912_3850 311
197 3300053121 Ga0500607_055454 Ga0500607_055454_485_1423 311
198 3300053136 Ga0500559_0016923 Ga0500559_0016923_514_1452 311
199 3300053160 Ga0500633_0004971 Ga0500633_0004971_193_1131 311
200 3300005290 Ga0065712_10068516 Ga0065712_100685163 312
201 3300005353 Ga0070669_100113777 Ga0070669_1001137773 312
202 3300005466 Ga0070685_10001005 Ga0070685_100010058 312
203 3300005719 Ga0068861_100129546 Ga0068861_1001295464 312
204 3300006931 Ga0097620_100101400 Ga0097620_1001014003 312
205 3300009176 Ga0105242_10015276 Ga0105242_100152765 312
206 3300009176 Ga0105242_10116325 Ga0105242_101163252 312
207 3300009177 Ga0105248_10565593 Ga0105248_105655932 312
208 3300013306 Ga0163162_10032210 Ga0163162_100322104 312
209 3300013306 Ga0163162_10301341 Ga0163162_103013413 312
210 3300013308 Ga0157375_10071312 Ga0157375_100713124 312
211 3300013308 Ga0157375_10270275 Ga0157375_102702751 312
212 3300014325 Ga0163163_10173429 Ga0163163_101734292 312
213 3300014969 Ga0157376_10163873 Ga0157376_101638732 312
214 3300017792 Ga0163161_10023768 Ga0163161_100237681 312
215 3300025934 Ga0207686_10000655 Ga0207686_100006555 312
216 3300025934 Ga0207686_10119273 Ga0207686_101192733 312
217 3300025936 Ga0207670_10022643 Ga0207670_100226434 312
218 3300025961 Ga0207712_10008426 Ga0207712_100084264 312
219 3300026075 Ga0207708_10351533 Ga0207708_103515332 312
220 3300026118 Ga0207675_100005780 Ga0207675_10000578013 312
221 3300026118 Ga0207675_100059885 Ga0207675_1000598853 312
222 3300026121 Ga0207683_10051591 Ga0207683_100515912 312
223 3300046524 Ga0495648_0042406 Ga0495648_0042406_844_1791 312
224 3300046557 Ga0495622_0038611 Ga0495622_0038611_1116_2063 312
225 3300046660 Ga0495625_0008116 Ga0495625_0008116_3618_4565 312
226 3300053104 Ga0500556_0082376 Ga0500556_0082376_188_1132 312
227 3300001989 JGI24739J22299_10009347 JGI24739J22299_100093474 313
228 3300001990 JGI24737J22298_10004172 JGI24737J22298_100041725 313
229 3300002067 JGI24735J21928_10000002 JGI24735J21928_1000000255 313
230 3300003316 rootH1_10028597 rootH1_100285976 313
231 3300003322 rootL2_10054176 rootL2_100541763 313
232 3300003323 rootH1_10020638 rootH1_100206383 313
233 3300005331 Ga0070670_100101853 Ga0070670_1001018533 313
234 3300009553 Ga0105249_10093095 Ga0105249_100930953 313
235 3300013102 Ga0157371_10043809 Ga0157371_100438093 313
236 3300013307 Ga0157372_10004867 Ga0157372_100048677 313
237 3300013307 Ga0157372_10016245 Ga0157372_100162454 313
238 3300014326 Ga0157380_10136660 Ga0157380_101366602 313
239 3300031456 Ga0307513_10197305 Ga0307513_101973053 313
240 3300046507 Ga0495606_0000143 Ga0495606_0000143_68777_69724 313
241 3300046512 Ga0495610_0001747 Ga0495610_0001747_9887_10834 313
242 3300046513 Ga0495616_0008524 Ga0495616_0008524_1167_2114 313
243 3300046558 Ga0495633_0024395 Ga0495633_0024395_518_1465 313
244 3300046660 Ga0495625_0000009 Ga0495625_0000009_26910_27857 313
245 3300046665 Ga0495661_0016299 Ga0495661_0016299_2332_3279 313
246 3300046694 Ga0495649_0000008 Ga0495649_0000008_220701_221648 313
247 3300046810 Ga0495660_0023770 Ga0495660_0023770_842_1789 313
248 3300047443 Ga0495687_005561 Ga0495687_005561_2554_3501 313
249 3300003794 Ga0055531_10000104 Ga0055531_1000010447 314
250 3300005329 Ga0070683_100004241 Ga0070683_1000042416 314
251 3300005337 Ga0070682_100080060 Ga0070682_1000800603 314
252 3300005344 Ga0070661_100008691 Ga0070661_1000086914 314
253 3300005366 Ga0070659_100027064 Ga0070659_1000270643 314
254 3300005455 Ga0070663_100138710 Ga0070663_1001387102 314
255 3300005535 Ga0070684_100007775 Ga0070684_1000077754 314
256 3300005539 Ga0068853_100003693 Ga0068853_1000036938 314
257 3300005564 Ga0070664_100005482 Ga0070664_1000054828 314
258 3300005578 Ga0068854_100134999 Ga0068854_1001349992 314
259 3300005842 Ga0068858_100557791 Ga0068858_1005577912 314
260 3300006195 Ga0075366_10037790 Ga0075366_100377903 314
261 3300025304 Ga0209257_1000013 Ga0209257_1000013206 314
262 3300025919 Ga0207657_10197009 Ga0207657_101970092 314
263 3300025932 Ga0207690_10017965 Ga0207690_100179654 314
264 3300025945 Ga0207679_10043023 Ga0207679_100430231 314
265 3300026035 Ga0207703_10478326 Ga0207703_104783262 314
266 3300026041 Ga0207639_10210754 Ga0207639_102107542 314
267 3300026067 Ga0207678_10202183 Ga0207678_102021832 314
268 3300026116 Ga0207674_10009917 Ga0207674_1000991710 314
269 3300041404 Ga0439436_0015882 Ga0439436_0015882_516_1463 314
270 3300041512 Ga0451853_4103022 Ga0451853_4103022_109_1056 314
271 3300042014 Ga0439457_001778 Ga0439457_001778_3360_4307 314
272 3300046616 Ga0495668_0002446 Ga0495668_0002446_3313_4260 314
273 3300001904 JGI24736J21556_1010489 JGI24736J21556_10104893 315
274 3300003316 rootH1_10107750 rootH1_101077501 315
275 3300003323 rootH1_10361934 rootH1_103619342 315
276 3300003762 Ga0055542_1010534 Ga0055542_10105342 315
277 3300005334 Ga0068869_100048241 Ga0068869_1000482412 315
278 3300005334 Ga0068869_100095876 Ga0068869_1000958761 315
279 3300005335 Ga0070666_10000108 Ga0070666_1000010845 315
280 3300005339 Ga0070660_100060699 Ga0070660_1000606992 315
281 3300005344 Ga0070661_100052923 Ga0070661_1000529233 315
282 3300005347 Ga0070668_100141050 Ga0070668_1001410503 315
283 3300005353 Ga0070669_100005547 Ga0070669_1000055477 315
284 3300005353 Ga0070669_100006598 Ga0070669_1000065983 315
285 3300005353 Ga0070669_100104054 Ga0070669_1001040542 315
286 3300005356 Ga0070674_100048137 Ga0070674_1000481372 315
287 3300005364 Ga0070673_100299702 Ga0070673_1002997023 315
288 3300005366 Ga0070659_100000119 Ga0070659_10000011912 315
289 3300005366 Ga0070659_100003599 Ga0070659_10000359910 315
290 3300005367 Ga0070667_100030109 Ga0070667_1000301095 315
291 3300005438 Ga0070701_10154999 Ga0070701_101549992 315
292 3300005456 Ga0070678_100052262 Ga0070678_1000522623 315
293 3300005457 Ga0070662_100229704 Ga0070662_1002297043 315
294 3300005535 Ga0070684_100003161 Ga0070684_10000316114 315
295 3300005535 Ga0070684_100060198 Ga0070684_1000601984 315
296 3300005543 Ga0070672_100137081 Ga0070672_1001370812 315
297 3300005548 Ga0070665_100105976 Ga0070665_1001059763 315
298 3300005564 Ga0070664_100004752 Ga0070664_10000475213 315
299 3300005577 Ga0068857_100043340 Ga0068857_1000433403 315
300 3300005577 Ga0068857_100093730 Ga0068857_1000937303 315
301 3300005578 Ga0068854_100022030 Ga0068854_1000220305 315
302 3300005614 Ga0068856_100121372 Ga0068856_1001213723 315
303 3300005616 Ga0068852_100000300 Ga0068852_10000030028 315
304 3300005617 Ga0068859_100000029 Ga0068859_10000002960 315
305 3300005617 Ga0068859_100039224 Ga0068859_1000392243 315
306 3300005618 Ga0068864_100003717 Ga0068864_10000371711 315
307 3300005618 Ga0068864_100142616 Ga0068864_1001426162 315
308 3300005840 Ga0068870_10016854 Ga0068870_100168543 315
309 3300005841 Ga0068863_100615276 Ga0068863_1006152762 315
310 3300005843 Ga0068860_100008773 Ga0068860_1000087737 315
311 3300005843 Ga0068860_100013160 Ga0068860_1000131609 315
312 3300005844 Ga0068862_100010686 Ga0068862_1000106861 315
313 3300006195 Ga0075366_10022876 Ga0075366_100228765 315
314 3300006237 Ga0097621_100129729 Ga0097621_1001297292 315
315 3300006358 Ga0068871_100377296 Ga0068871_1003772962 315
316 3300006931 Ga0097620_100000029 Ga0097620_10000002960 315
317 3300006931 Ga0097620_100039223 Ga0097620_1000392233 315
318 3300009094 Ga0111539_10002347 Ga0111539_1000234717 315
319 3300009101 Ga0105247_10003645 Ga0105247_100036452 315
320 3300009101 Ga0105247_10003681 Ga0105247_100036815 315
321 3300009147 Ga0114129_10004721 Ga0114129_1000472124 315
322 3300009174 Ga0105241_10000432 Ga0105241_1000043217 315
323 3300009176 Ga0105242_10023200 Ga0105242_100232003 315
324 3300009545 Ga0105237_10003443 Ga0105237_1000344319 315
325 3300009553 Ga0105249_10035993 Ga0105249_100359933 315
326 3300010375 Ga0105239_10000440 Ga0105239_1000044048 315
327 3300010375 Ga0105239_10000619 Ga0105239_100006195 315
328 3300010375 Ga0105239_10019667 Ga0105239_1001966710 315
329 3300013104 Ga0157370_10004238 Ga0157370_100042387 315
330 3300013105 Ga0157369_10096676 Ga0157369_100966764 315
331 3300013105 Ga0157369_10202761 Ga0157369_102027613 315
332 3300013296 Ga0157374_10004889 Ga0157374_100048896 315
333 3300013296 Ga0157374_10040915 Ga0157374_100409152 315
334 3300013297 Ga0157378_10439651 Ga0157378_104396512 315
335 3300013306 Ga0163162_10015722 Ga0163162_100157225 315
336 3300013306 Ga0163162_10018262 Ga0163162_100182628 315
337 3300013307 Ga0157372_10014212 Ga0157372_100142127 315
338 3300013307 Ga0157372_10040705 Ga0157372_100407056 315
339 3300013307 Ga0157372_10044140 Ga0157372_100441404 315
340 3300013307 Ga0157372_10054108 Ga0157372_100541083 315
341 3300013307 Ga0157372_10547808 Ga0157372_105478082 315
342 3300013308 Ga0157375_10000510 Ga0157375_1000051037 315
343 3300013308 Ga0157375_10053244 Ga0157375_100532443 315
344 3300014325 Ga0163163_10059837 Ga0163163_100598372 315
345 3300014325 Ga0163163_10073560 Ga0163163_100735602 315
346 3300014326 Ga0157380_10006904 Ga0157380_100069044 315
347 3300014745 Ga0157377_10018382 Ga0157377_100183822 315
348 3300014745 Ga0157377_10071196 Ga0157377_100711962 315
349 3300014968 Ga0157379_10104818 Ga0157379_101048182 315
350 3300017792 Ga0163161_10212800 Ga0163161_102128002 315
351 3300021384 Ga0213876_10005503 Ga0213876_100055036 315
352 3300025233 Ga0209437_100024 Ga0209437_100024567 315
353 3300025242 Ga0209258_100252 Ga0209258_10025239 315
354 3300025250 Ga0209026_1001737 Ga0209026_10017377 315
355 3300025254 Ga0209148_1000217 Ga0209148_100021739 315
356 3300025893 Ga0207682_10023088 Ga0207682_100230883 315
357 3300025900 Ga0207710_10000898 Ga0207710_1000089816 315
358 3300025903 Ga0207680_10000016 Ga0207680_1000001655 315
359 3300025904 Ga0207647_10000040 Ga0207647_1000004089 315
360 3300025907 Ga0207645_10001124 Ga0207645_1000112412 315
361 3300025908 Ga0207643_10008981 Ga0207643_100089813 315
362 3300025908 Ga0207643_10033000 Ga0207643_100330003 315
363 3300025911 Ga0207654_10008059 Ga0207654_100080595 315
364 3300025914 Ga0207671_10000778 Ga0207671_100007786 315
365 3300025914 Ga0207671_10003995 Ga0207671_1000399511 315
366 3300025914 Ga0207671_10006199 Ga0207671_100061992 315
367 3300025920 Ga0207649_10023979 Ga0207649_100239793 315
368 3300025920 Ga0207649_10297531 Ga0207649_102975312 315
369 3300025925 Ga0207650_10033375 Ga0207650_100333752 315
370 3300025926 Ga0207659_10050907 Ga0207659_100509071 315
371 3300025926 Ga0207659_10056945 Ga0207659_100569452 315
372 3300025931 Ga0207644_10094365 Ga0207644_100943653 315
373 3300025932 Ga0207690_10000465 Ga0207690_100004654 315
374 3300025933 Ga0207706_10059354 Ga0207706_100593543 315
375 3300025933 Ga0207706_10096585 Ga0207706_100965853 315
376 3300025933 Ga0207706_10107487 Ga0207706_101074872 315
377 3300025933 Ga0207706_10186753 Ga0207706_101867532 315
378 3300025936 Ga0207670_10059572 Ga0207670_100595723 315
379 3300025936 Ga0207670_10140453 Ga0207670_101404532 315
380 3300025937 Ga0207669_10084662 Ga0207669_100846622 315
381 3300025940 Ga0207691_10017517 Ga0207691_100175175 315
382 3300025940 Ga0207691_10165431 Ga0207691_101654312 315
383 3300025942 Ga0207689_10000339 Ga0207689_100003392 315
384 3300025942 Ga0207689_10004698 Ga0207689_1000469813 315
385 3300025942 Ga0207689_10068922 Ga0207689_100689223 315
386 3300025944 Ga0207661_10158296 Ga0207661_101582963 315
387 3300025944 Ga0207661_10331490 Ga0207661_103314902 315
388 3300025945 Ga0207679_10013695 Ga0207679_100136953 315
389 3300025945 Ga0207679_10421836 Ga0207679_104218362 315
390 3300025949 Ga0207667_10000046 Ga0207667_1000004661 315
391 3300025960 Ga0207651_10080222 Ga0207651_100802223 315
392 3300025961 Ga0207712_10012326 Ga0207712_100123266 315
393 3300025961 Ga0207712_10179456 Ga0207712_101794563 315
394 3300025972 Ga0207668_10074574 Ga0207668_100745743 315
395 3300025981 Ga0207640_10112504 Ga0207640_101125042 315
396 3300025986 Ga0207658_10025555 Ga0207658_100255555 315
397 3300025986 Ga0207658_10303855 Ga0207658_103038553 315
398 3300025986 Ga0207658_10403402 Ga0207658_104034022 315
399 3300026023 Ga0207677_10230278 Ga0207677_102302782 315
400 3300026041 Ga0207639_10043598 Ga0207639_100435984 315
401 3300026088 Ga0207641_10000244 Ga0207641_100002447 315
402 3300026088 Ga0207641_10121373 Ga0207641_101213732 315
403 3300026089 Ga0207648_10027382 Ga0207648_100273822 315
404 3300026089 Ga0207648_10098827 Ga0207648_100988273 315
405 3300026095 Ga0207676_10003078 Ga0207676_100030788 315
406 3300026095 Ga0207676_10129029 Ga0207676_101290293 315
407 3300026116 Ga0207674_10030917 Ga0207674_100309173 315
408 3300026116 Ga0207674_10037862 Ga0207674_100378623 315
409 3300026118 Ga0207675_100001377 Ga0207675_10000137718 315
410 3300026121 Ga0207683_10099992 Ga0207683_100999923 315
411 3300026142 Ga0207698_10070615 Ga0207698_100706153 315
412 3300026142 Ga0207698_10094192 Ga0207698_100941923 315
413 3300027907 Ga0207428_10073029 Ga0207428_100730293 315
414 3300028379 Ga0268266_10109825 Ga0268266_101098253 315
415 3300028380 Ga0268265_10017475 Ga0268265_100174751 315
416 3300028381 Ga0268264_10003377 Ga0268264_100033778 315
417 3300028381 Ga0268264_10043578 Ga0268264_100435783 315
418 3300031251 Ga0265327_10000544 Ga0265327_1000054442 315
419 3300031507 Ga0307509_10156517 Ga0307509_101565172 315
420 3300039437 Ga0436365_0720735 Ga0436365_0720735_1116_2069 315
421 3300039437 Ga0436365_1743396 Ga0436365_1743396_18271_19224 315
422 3300041486 Ga0451807_0755309 Ga0451807_0755309_176_1132 315
423 3300046524 Ga0495648_0010424 Ga0495648_0010424_3777_4733 315
424 3300046660 Ga0495625_0076019 Ga0495625_0076019_91_1047 315
425 3300048913 Ga0496110_0379353 Ga0496110_0379353_313_1266 315
426 3300049744 Ga0501083_0182044 Ga0501083_0182044_86_1033 315
427 3300050493 nmdc:mga0k408_68577_c1 nmdc:mga0k408_68577_c1_356_1306 315
428 3300050511 nmdc:mga08y16_72114_c1 nmdc:mga08y16_72114_c1_2298_3251 315
429 3300053139 Ga0500568_0000407 Ga0500568_0000407_31429_32382 315

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02424

ApbE

ApbE family

21

286

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ifx-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein, fad substrate bound form 0.9013 9 310
4xdr-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein, a bifunctional fmn transferase/fad pyrophosphatase, d284a mutant, adn bound form 0.9012 9 310
7esb-assembly1.cif.gz_A fmnb complexed with atp 0.8988 10 310
4ifw-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein, adp inhibited form 0.8986 9 310
4xdu-assembly1.cif.gz_A crystal structure of treponema pallidum tp0796 flavin trafficking protein,a bifunctional fmn transferase/fad pyrophosphatase, n55y mutant, adp bound form 0.8951 9 310
ID Description Score Start End Superfamily
af_Q564W9_25_124_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9291 295 309 3.10.450.50
af_Q9D3G2_18_127_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.9118 295 309 2.60.40.10
4xdtA00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8968 9 310 3.10.520.10
6nxjB00 Alpha Beta;Roll;T-fold;ApbE-like domains 0.8722 10 311 3.10.520.10
af_Q9ET39_36_143_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8647 295 309 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6N8JLC5-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9651 7 315 GO:0016740
GO:0046872
AF-A0A3L9LZU7-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9598 150 310 GO:0016740
GO:0046872
AF-A0A4R5DCW9-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9547 20 313 GO:0016740
GO:0046872
AF-A0A5P2G5T0-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9547 20 307 GO:0016740
GO:0046872
AF-A0A2G2E5N4-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9535 2 312 GO:0016740
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.07 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map