F441941

General Info

Members Datasets Scaffolds Average Seq Length
429 280 371 260

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10099627|Ga0307513_100996275
Length 273
Sequence MARAHLAFNPGMPTPNSIELLSVANALADAAAAQSMRYFRTPLEIISKEDQSPVTLADRAAETAMREILSAQCPQDGIYGEEHGRERLDATRVWVLDPIDGTRSFITGSPLWGTLIGVLEGGRVRLGLVDMPVLGERWWGVSDEAGRMALRNGRPVQASQCAQIEQARIVTTSPDIFNVADWQAFDALSKRCAMRRFGGDCYGYAQLAGGTIDLVVETGLQPYDYLGPAGLIEAAGGTISDWEGRPLGLQSDGSVVAAATPELHRAALALLQV

Samples

Sample ID Description Type Environment
1 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
10 2643221594 Achromobacter sp. Root170 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
14 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
18 2738541307 Variovorax sp. GV008 Isolate Unclassified
19 2738543013 Variovorax sp. BT01 Isolate Unclassified
20 2738543019 Variovorax sp. GV040 Isolate Unclassified
21 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
22 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
23 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
24 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
25 2818991446 Variovorax sp. 1180 Isolate Unclassified
26 2818991467 Bosea vestrisii 3192 Isolate Unclassified
27 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
28 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
29 2842677519 Variovorax sp. R-72495 Isolate Unclassified
30 2842733646 Variovorax sp. R-72446 Isolate Unclassified
31 2842747753 Variovorax sp. R-72060 Isolate Unclassified
32 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
33 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
34 2858950400 Achromobacter sp. K91 Isolate Unclassified
35 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
40 2904456579 Variovorax sp. 2002 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
43 2928037797 Variovorax sp. 1126 Isolate Unclassified
44 2928044640 Variovorax sp. 1128 Isolate Unclassified
45 2928051484 Variovorax sp. 1133 Isolate Unclassified
46 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
47 2928070936 Variovorax gossypii 1167 Isolate Unclassified
48 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
49 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
50 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
51 2929520902 Variovorax beijingensis 502 Isolate Unclassified
52 2941479691
53 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
54 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
55 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
56 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
57 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
58 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
63 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
64 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
65 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
66 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
69 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
141 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
142 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
143 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
159 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
160 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
161 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
162 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
165 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
166 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
171 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
178 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
179 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
184 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
196 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
230 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
231 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
236 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
237 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
244 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
251 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
254 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
255 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
261 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
262 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
263 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
264 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
265 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
270 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
271 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
272 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
273 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
274 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
280 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.78
Metatranscriptomes 0.7
Isolates 13.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.3
Nodule 0.7
Rhizoplane 4.9
Rhizosphere 43.59
Stem 0
Stem Tuber 0
Unclassified 20.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013447 3300001979 Bacteria 3051
2 JGI24739J22299_10018763 3300001989 Bacteria 2482
3 JGI25151J46595_10004463 3300003187 Bacteria 7398
4 JGI25151J46595_10005917 3300003187 Bacteria 6238
5 JGI25153J46596_10004050 3300003215 Bacteria 7987
6 Ga0006562J51391_1022424 3300003578 Bacteria 1450
7 Ga0006562J51391_1050175 3300003578 Bacteria 4410
8 Ga0006562J51391_1050176 3300003578 Bacteria 3930
9 Ga0055535_1002254 3300003761 Bacteria 7188
10 Ga0055542_1000084 3300003762 Bacteria 125518
11 Ga0055536_1001919 3300003781 Bacteria 12045
12 Ga0055536_1008121 3300003781 Bacteria 4573
13 Ga0055534_1000240 3300003784 Bacteria 39034
14 Ga0055534_1002481 3300003784 Bacteria 6354
15 Ga0055528_1002132 3300003790 Bacteria 10920
16 Ga0055530_10001195 3300003791 Bacteria 20077
17 Ga0055540_1004031 3300003792 Bacteria 6834
18 Ga0055531_10003661 3300003794 Bacteria 9688
19 Ga0055531_10014009 3300003794 Bacteria 3647
20 Ga0070673_100579465 3300005364 Bacteria 1022
21 Ga0070667_100004081 3300005367 Bacteria 12352
22 Ga0070667_100015516 3300005367 Bacteria 6298
23 Ga0070667_100231818 3300005367 Bacteria 1646
24 Ga0070710_10012726 3300005437 Bacteria 4187
25 Ga0070678_100109598 3300005456 Bacteria 2157
26 Ga0068853_100024223 3300005539 Bacteria 5087
27 Ga0070672_100122786 3300005543 Bacteria 2128
28 Ga0070665_100031029 3300005548 Bacteria 5379
29 Ga0070665_100273185 3300005548 Bacteria 1692
30 Ga0068860_100133384 3300005843 Bacteria 2384
31 Ga0068862_100017123 3300005844 Bacteria 6031
32 Ga0075363_100026358 3300006048 Bacteria 2973
33 Ga0075363_100032762 3300006048 Bacteria 2701
34 Ga0075432_10020528 3300006058 Bacteria 2259
35 Ga0075362_10026224 3300006177 Bacteria 2487
36 Ga0075362_10072481 3300006177 Bacteria 1575
37 Ga0075367_10008817 3300006178 Bacteria 5245
38 Ga0075367_10024505 3300006178 Bacteria 3404
39 Ga0075367_10088504 3300006178 Bacteria 1882
40 Ga0075367_10363355 3300006178 Bacteria 914
41 Ga0075366_10024508 3300006195 Bacteria 3518
42 Ga0075366_10036567 3300006195 Bacteria 2895
43 Ga0075366_10042290 3300006195 Bacteria 2697
44 Ga0075366_10071511 3300006195 Bacteria 2067
45 Ga0075370_10002922 3300006353 Bacteria 8028
46 Ga0075370_10018695 3300006353 Bacteria 3761
47 Ga0075370_10021436 3300006353 Bacteria 3540
48 Ga0075370_10030516 3300006353 Bacteria 3008
49 Ga0075370_10106822 3300006353 Bacteria 1623
50 Ga0099826_10012916 3300006948 Bacteria 6294
51 Ga0105243_10003150 3300009148 Bacteria 13542
52 Ga0105243_10197068 3300009148 Bacteria 1764
53 Ga0105242_10371005 3300009176 Bacteria 1327
54 Ga0105248_10451429 3300009177 Bacteria 1449
55 Ga0105246_10203567 3300011119 Bacteria 1540
56 Ga0157347_1001091 3300012502 Bacteria 2034
57 Ga0157373_10001810 3300013100 Bacteria 16270
58 Ga0157371_10021080 3300013102 Bacteria 4790
59 Ga0157370_10018595 3300013104 Bacteria 6986
60 Ga0157370_10176792 3300013104 Bacteria 1984
61 Ga0163162_10077532 3300013306 Bacteria 3387
62 Ga0157372_10226932 3300013307 Bacteria 2165
63 Ga0157375_10318435 3300013308 Bacteria 1720
64 Ga0157375_10427055 3300013308 Bacteria 1491
65 Ga0182008_10000065 3300014497 Bacteria 88652
66 Ga0182008_10011284 3300014497 Bacteria 4760
67 Ga0182008_10020013 3300014497 Bacteria 3449
68 Ga0157376_10241517 3300014969 Bacteria 1683
69 Ga0182006_1060904 3300015261 Bacteria 1424
70 Ga0182007_10001385 3300015262 Bacteria 13033
71 Ga0183362_10003 3300015683 Bacteria 977584
72 Ga0163161_10001053 3300017792 Bacteria 20949
73 Ga0163161_10006753 3300017792 Bacteria 7930
74 Ga0163161_10026711 3300017792 Bacteria 4090
75 Ga0163161_10139450 3300017792 Bacteria 1835
76 Ga0209672_101525 3300025228 Bacteria 8049
77 Ga0209147_101867 3300025229 Bacteria 6422
78 Ga0209258_100790 3300025242 Bacteria 18961
79 Ga0207425_1000552 3300025245 Bacteria 22339
80 Ga0209148_1000007 3300025254 Bacteria 1592273
81 Ga0209129_1000147 3300025258 Bacteria 115120
82 Ga0209565_1000117 3300025263 Bacteria 113536
83 Ga0209565_1000282 3300025263 Bacteria 50138
84 Ga0209673_1000218 3300025273 Bacteria 113542
85 Ga0209673_1001256 3300025273 Bacteria 26191
86 Ga0209673_1001287 3300025273 Bacteria 25651
87 Ga0209130_1003952 3300025284 Bacteria 5936
88 Ga0209675_1000113 3300025291 Bacteria 113542
89 Ga0209675_1000745 3300025291 Bacteria 21972
90 Ga0209675_1001118 3300025291 Bacteria 16353
91 Ga0209675_1015736 3300025291 Bacteria 2232
92 Ga0209676_1000028 3300025292 Bacteria 559745
93 Ga0209676_1000216 3300025292 Bacteria 125759
94 Ga0209676_1000486 3300025292 Bacteria 64563
95 Ga0209676_1012347 3300025292 Bacteria 3363
96 Ga0209676_1014026 3300025292 Bacteria 3043
97 Ga0209025_1000375 3300025294 Bacteria 93043
98 Ga0209025_1000503 3300025294 Bacteria 75048
99 Ga0209025_1001127 3300025294 Bacteria 38261
100 Ga0209025_1019657 3300025294 Bacteria 3743
101 Ga0209025_1026175 3300025294 Bacteria 2937
102 Ga0209025_1055390 3300025294 Bacteria 1534
103 Ga0209564_1000220 3300025295 Bacteria 129579
104 Ga0209564_1000327 3300025295 Bacteria 92740
105 Ga0209758_1000096 3300025297 Bacteria 231496
106 Ga0209758_1000199 3300025297 Bacteria 133164
107 Ga0209050_1000072 3300025298 Bacteria 293619
108 Ga0209050_1000133 3300025298 Bacteria 184688
109 Ga0209050_1004745 3300025298 Bacteria 8986
110 Ga0209050_1008127 3300025298 Bacteria 5688
111 Ga0209256_1000117 3300025299 Bacteria 169435
112 Ga0209256_1000206 3300025299 Bacteria 111425
113 Ga0207426_1000049 3300025302 Bacteria 401954
114 Ga0207426_1000166 3300025302 Bacteria 169435
115 Ga0209051_1000015 3300025303 Bacteria 546798
116 Ga0209051_1000255 3300025303 Bacteria 89418
117 Ga0209051_1000440 3300025303 Bacteria 56410
118 Ga0209051_1006243 3300025303 Bacteria 6757
119 Ga0209257_1000037 3300025304 Bacteria 612915
120 Ga0209257_1003603 3300025304 Bacteria 13054
121 Ga0209257_1009791 3300025304 Bacteria 5023
122 Ga0209257_1021205 3300025304 Bacteria 2370
123 Ga0207656_10001836 3300025321 Bacteria 7050
124 Ga0207692_10000446 3300025898 Bacteria 14597
125 Ga0207680_10000002 3300025903 Bacteria 1018646
126 Ga0207680_10137506 3300025903 Bacteria 1616
127 Ga0207649_10001904 3300025920 Bacteria 11910
128 Ga0207694_10003196 3300025924 Bacteria 13068
129 Ga0207709_10003894 3300025935 Bacteria 8725
130 Ga0207691_10069813 3300025940 Bacteria 3173
131 Ga0207658_10008502 3300025986 Bacteria 6985
132 Ga0207658_10053691 3300025986 Bacteria 2979
133 Ga0207639_10038664 3300026041 Bacteria 3550
134 Ga0207648_10512280 3300026089 Bacteria 1099
135 Ga0209282_1000188 3300027666 Bacteria 32983
136 Ga0268266_10000004 3300028379 Bacteria 1495817
137 Ga0268265_10022768 3300028380 Bacteria 4407
138 Ga0268264_10404022 3300028381 Bacteria 1313
139 Ga0307515_10000278 3300028794 Bacteria 125493
140 Ga0307512_10095222 3300030522 Bacteria 2050
141 Ga0316177_1165023 3300030731 Bacteria 5577
142 Ga0316176_1214107 3300030732 Bacteria 2485
143 Ga0314311_1060236 3300030733 Bacteria 6387
144 Ga0314311_1161585 3300030733 Bacteria 4651
145 Ga0316178_1014508 3300030735 Bacteria 6020
146 Ga0316183_1023150 3300030742 Bacteria 3225
147 Ga0316181_1048647 3300030744 Bacteria 4123
148 Ga0316182_1255049 3300030745 Bacteria 2410
149 Ga0316182_1282305 3300030745 Bacteria 6258
150 Ga0265327_10003682 3300031251 Bacteria 14346
151 Ga0265327_10022822 3300031251 Bacteria 3726
152 Ga0307513_10099627 3300031456 Bacteria 2934
153 Ga0307513_10126061 3300031456 Bacteria 2515
154 Ga0307513_10128209 3300031456 Bacteria 2488
155 Ga0307513_10343269 3300031456 Bacteria 1243
156 Ga0307408_100230564 3300031548 Bacteria 1516
157 Ga0307408_100257073 3300031548 Bacteria 1443
158 Ga0307408_100344479 3300031548 Bacteria 1262
159 Ga0307408_100398987 3300031548 Bacteria 1180
160 Ga0307408_100587622 3300031548 Bacteria 987
161 Ga0307514_10001608 3300031649 Bacteria 26584
162 Ga0307405_10081315 3300031731 Bacteria 2117
163 Ga0307405_10132140 3300031731 Bacteria 1726
164 Ga0307405_10144826 3300031731 Bacteria 1662
165 Ga0307405_10263761 3300031731 Bacteria 1288
166 Ga0307410_10061331 3300031852 Bacteria 2573
167 Ga0307406_10003432 3300031901 Bacteria 8623
168 Ga0307406_10624071 3300031901 Bacteria 892
169 Ga0307412_10000514 3300031911 Bacteria 23072
170 Ga0307412_10009751 3300031911 Bacteria 5514
171 Ga0307412_10149276 3300031911 Bacteria 1722
172 Ga0307416_100082607 3300032002 Bacteria 2722
173 Ga0307416_100142341 3300032002 Bacteria 2182
174 Ga0307416_100231355 3300032002 Bacteria 1782
175 Ga0307414_10081523 3300032004 Bacteria 2369
176 Ga0307414_10242978 3300032004 Bacteria 1491
177 Ga0307414_10425970 3300032004 Bacteria 1158
178 Ga0307411_10302861 3300032005 Bacteria 1282
179 Ga0307510_10025957 3300033180 Bacteria 6747
180 Ga0439436_0001106 3300041404 Bacteria 7616
181 Ga0439438_028723 3300041405 Bacteria 1494
182 Ga0439439_0007278 3300041406 Bacteria 2586
183 Ga0439447_014562 3300041407 Bacteria 2202
184 Ga0439447_053159 3300041407 Bacteria 963
185 Ga0439461_0014139 3300041410 Bacteria 1513
186 Ga0439466_0008747 3300041411 Bacteria 3814
187 Ga0439465_0004172 3300041413 Bacteria 4702
188 Ga0451843_0742469 3300041509 Bacteria 970
189 Ga0439431_0001773 3300041997 Bacteria 4776
190 Ga0439431_0040826 3300041997 Bacteria 1181
191 Ga0439433_0000073 3300041999 Bacteria 13008
192 Ga0439445_0017196 3300042004 Bacteria 1786
193 Ga0439432_003345 3300042006 Bacteria 5950
194 Ga0439432_012846 3300042006 Bacteria 2854
195 Ga0439449_0004725 3300042007 Bacteria 5255
196 Ga0439449_0013662 3300042007 Bacteria 3055
197 Ga0439449_0036226 3300042007 Bacteria 1835
198 Ga0439452_005844 3300042010 Bacteria 3919
199 Ga0439452_009932 3300042010 Bacteria 2788
200 Ga0439454_005299 3300042011 Bacteria 1534
201 Ga0439457_028987 3300042014 Bacteria 1226
202 Ga0439462_0000528 3300042015 Bacteria 7579
203 Ga0450920_007142 3300042122 Bacteria 2019
204 Ga0450921_000087 3300042123 Bacteria 2790
205 Ga0450923_001111 3300042125 Bacteria 3406
206 Ga0450894_004830 3300042131 Bacteria 1743
207 Ga0450906_002179 3300042145 Bacteria 4276
208 Ga0450907_007153 3300042146 Bacteria 1863
209 Ga0450908_002739 3300042184 Bacteria 3440
210 Ga0450909_020336 3300042185 Bacteria 989
211 Ga0439434_0009398 3300042435 Bacteria 2873
212 Ga0450918_001850 3300042531 Bacteria 4113
213 Ga0450893_0027145 3300042532 Bacteria 1008
214 Ga0466972_0003708 3300044658 Bacteria 7602
215 Ga0466965_0006213 3300044683 Bacteria 5404
216 Ga0466965_0009719 3300044683 Bacteria 4472
217 Ga0466965_0032872 3300044683 Bacteria 2534
218 Ga0466965_0061310 3300044683 Bacteria 1880
219 Ga0466968_0012484 3300044735 Bacteria 3327
220 Ga0466960_0003924 3300044901 Bacteria 5773
221 Ga0451576_0108045 3300045051 Bacteria 2895
222 Ga0495627_003948 3300046453 Bacteria 6336
223 Ga0495629_0139730 3300046459 Bacteria 1686
224 Ga0495638_0021928 3300046460 Bacteria 4198
225 Ga0495638_0033484 3300046460 Bacteria 3287
226 Ga0495607_0000280 3300046501 Bacteria 54943
227 Ga0495616_0002314 3300046513 Bacteria 12736
228 Ga0495620_0009668 3300046515 Bacteria 5119
229 Ga0495620_0054742 3300046515 Bacteria 1684
230 Ga0495631_0000007 3300046518 Bacteria 130158
231 Ga0495632_0003267 3300046519 Bacteria 11588
232 Ga0495637_0001478 3300046520 Bacteria 13799
233 Ga0495637_0036504 3300046520 Bacteria 2140
234 Ga0495663_0061522 3300046525 Bacteria 1181
235 Ga0495642_0025460 3300046528 Bacteria 2346
236 Ga0495654_0038103 3300046530 Bacteria 2406
237 Ga0495587_0062831 3300046536 Bacteria 2174
238 Ga0495609_0020101 3300046538 Bacteria 3086
239 Ga0495621_0017222 3300046539 Bacteria 2332
240 Ga0495656_0000306 3300046615 Bacteria 16984
241 Ga0495668_0079935 3300046616 Bacteria 1794
242 Ga0495625_0000329 3300046660 Bacteria 72358
243 Ga0495625_0110163 3300046660 Bacteria 1882
244 Ga0495625_0208827 3300046660 Bacteria 1284
245 Ga0495661_0120234 3300046665 Bacteria 1452
246 Ga0495588_0023003 3300046674 Bacteria 3082
247 Ga0495588_0027305 3300046674 Bacteria 2853
248 Ga0495588_0092801 3300046674 Bacteria 1582
249 Ga0495599_0145394 3300046678 Bacteria 1470
250 Ga0495613_0191329 3300046689 Bacteria 1446
251 Ga0495624_0312377 3300046690 Bacteria 947
252 Ga0495670_0025910 3300046691 Bacteria 2903
253 Ga0495670_0093113 3300046691 Bacteria 1544
254 Ga0495671_0012336 3300046692 Bacteria 4671
255 Ga0495660_0049605 3300046810 Bacteria 2290
256 Ga0495660_0184714 3300046810 Bacteria 1006
257 Ga0495614_0021088 3300048089 Bacteria 2816
258 Ga0495614_0056346 3300048089 Bacteria 1687
259 Ga0495615_0012670 3300048090 Bacteria 1744
260 Ga0496100_0006455 3300048903 Bacteria 6396
261 Ga0496100_0214056 3300048903 Bacteria 1411
262 Ga0496101_0002678 3300048904 Bacteria 10935
263 Ga0496101_0025941 3300048904 Bacteria 4070
264 Ga0496102_0001281 3300048905 Bacteria 22670
265 Ga0496102_0628623 3300048905 Bacteria 997
266 Ga0496103_0153663 3300048906 Bacteria 1474
267 Ga0496104_0000492 3300048907 Bacteria 34067
268 Ga0496105_0002998 3300048908 Bacteria 12415
269 Ga0496105_0204738 3300048908 Bacteria 1610
270 Ga0496105_0326005 3300048908 Bacteria 1230
271 Ga0496105_0330422 3300048908 Bacteria 1220
272 Ga0496106_0122920 3300048909 Bacteria 2030
273 Ga0496107_0232728 3300048910 Bacteria 1371
274 Ga0496110_0003826 3300048913 Bacteria 11593
275 Ga0496114_0679656 3300048917 Bacteria 904
276 Ga0496115_0431047 3300048918 Bacteria 1067
277 Ga0496116_0004874 3300048919 Bacteria 12658
278 Ga0496116_0045302 3300048919 Bacteria 2978
279 Ga0496116_0142973 3300048919 Bacteria 1342
280 Ga0496117_0014724 3300048920 Bacteria 6717
281 Ga0496117_0018028 3300048920 Bacteria 5872
282 Ga0496117_0125479 3300048920 Bacteria 1568
283 Ga0496117_0263367 3300048920 Bacteria 933
284 Ga0496118_0005897 3300048921 Bacteria 13716
285 Ga0496118_0007943 3300048921 Bacteria 11101
286 Ga0496118_0016642 3300048921 Bacteria 6738
287 Ga0496118_0075600 3300048921 Bacteria 2401
288 Ga0496119_0012198 3300048922 Bacteria 7011
289 Ga0496119_0046982 3300048922 Bacteria 2690
290 Ga0496120_0046839 3300048923 Bacteria 2496
291 Ga0496121_0001111 3300048924 Bacteria 47443
292 Ga0496121_0051153 3300048924 Bacteria 3482
293 Ga0496121_0291871 3300048924 Bacteria 1110
294 Ga0496122_0000319 3300048925 Bacteria 105543
295 Ga0496122_0001794 3300048925 Bacteria 32871
296 Ga0496122_0127091 3300048925 Bacteria 1629
297 Ga0496122_0135192 3300048925 Bacteria 1556
298 Ga0496122_0163663 3300048925 Bacteria 1352
299 Ga0496122_0169505 3300048925 Bacteria 1318
300 Ga0496123_0000117 3300048926 Bacteria 161679
301 Ga0496123_0017100 3300048926 Bacteria 5853
302 Ga0496123_0031910 3300048926 Bacteria 3824
303 Ga0496124_0087262 3300048927 Bacteria 2552
304 Ga0496124_0102407 3300048927 Bacteria 2317
305 Ga0496124_0167870 3300048927 Bacteria 1703
306 Ga0496124_0215345 3300048927 Bacteria 1449
307 Ga0496124_0337078 3300048927 Bacteria 1073
308 Ga0496125_0000168 3300048928 Bacteria 146364
309 Ga0496125_0032536 3300048928 Bacteria 4632
310 Ga0496125_0036303 3300048928 Bacteria 4307
311 Ga0496125_0065336 3300048928 Bacteria 2883
312 Ga0496125_0093664 3300048928 Bacteria 2241
313 Ga0496125_0216578 3300048928 Bacteria 1238
314 Ga0496126_0053370 3300048929 Bacteria 3668
315 Ga0496126_0119056 3300048929 Bacteria 2292
316 Ga0495678_065900 3300049459 Bacteria 1343
317 Ga0501223_015438 3300049663 Bacteria 1512
318 Ga0501225_0003874 3300049705 Bacteria 4488
319 Ga0501262_000067 3300049759 Bacteria 12576
320 Ga0501266_000568 3300049763 Bacteria 4889
321 nmdc:mga03683_1228_c1 3300050489 Bacteria 7574
322 nmdc:mga03683_5904_c1 3300050489 Bacteria 4165
323 nmdc:mga03n38_92576_c1 3300050490 Bacteria 1442
324 nmdc:mga0yw44_51994_c1 3300050492 Bacteria 2483
325 nmdc:mga0k408_18754_c2 3300050493 Bacteria 3125
326 nmdc:mga0k408_20817_c1 3300050493 Bacteria 3680
327 nmdc:mga0k408_45505_c1 3300050493 Bacteria 2532
328 nmdc:mga0k408_8386_c1 3300050493 Bacteria 5543
329 nmdc:mga06z11_228532_c1 3300050494 Bacteria 1089
330 nmdc:mga07m45_20005_c1 3300050496 Bacteria 3633
331 nmdc:mga07m45_2383_c1 3300050496 Bacteria 8805
332 nmdc:mga07m45_45420_c1 3300050496 Bacteria 2467
333 nmdc:mga07m45_46783_c1 3300050496 Bacteria 2431
334 nmdc:mga07m45_71249_c1 3300050496 Bacteria 1978
335 Ga0500610_0002114 3300053079 Bacteria 7163
336 Ga0500610_0068011 3300053079 Bacteria 1858
337 Ga0500610_0140205 3300053079 Bacteria 1221
338 Ga0500643_013348 3300053087 Bacteria 2904
339 Ga0500644_0046962 3300053088 Bacteria 1462
340 Ga0500583_0056234 3300053092 Bacteria 1843
341 Ga0500651_0000305 3300053093 Bacteria 28418
342 Ga0500651_0008611 3300053093 Bacteria 6019
343 Ga0500651_0025468 3300053093 Bacteria 3712
344 Ga0500566_0099745 3300053094 Bacteria 1594
345 Ga0500641_0105759 3300053096 Bacteria 1209
346 Ga0500571_001655 3300053110 Bacteria 10607
347 Ga0500593_001728 3300053117 Bacteria 7879
348 Ga0500607_000744 3300053121 Bacteria 31300
349 Ga0500607_019694 3300053121 Bacteria 3817
350 Ga0500608_003525 3300053122 Bacteria 5884
351 Ga0500623_048151 3300053127 Bacteria 2156
352 Ga0500626_034002 3300053128 Bacteria 2303
353 Ga0500628_002962 3300053129 Bacteria 2792
354 Ga0500642_0003472 3300053130 Bacteria 4770
355 Ga0500652_000553 3300053131 Bacteria 13017
356 Ga0500655_000766 3300053133 Bacteria 6341
357 Ga0500655_004404 3300053133 Bacteria 2540
358 Ga0500658_0001043 3300053134 Bacteria 11326
359 Ga0500658_0001267 3300053134 Bacteria 10241
360 Ga0500559_0000819 3300053136 Bacteria 20200
361 Ga0500564_044032 3300053138 Bacteria 2051
362 Ga0500568_0000934 3300053139 Bacteria 20169
363 Ga0500568_0050525 3300053139 Bacteria 1638
364 Ga0500573_0015391 3300053140 Bacteria 4336
365 Ga0500577_0025140 3300053142 Bacteria 2011
366 Ga0500604_0007524 3300053151 Bacteria 2884
367 Ga0500616_0017295 3300053153 Bacteria 4093
368 Ga0500622_0000650 3300053156 Bacteria 30982
369 Ga0500627_0000537 3300053158 Bacteria 10255
370 Ga0500634_0054460 3300053161 Bacteria 2143
371 Ga0500638_006150 3300053162 Bacteria 4879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030731 Ga0316177_1165023 Ga0316177_11650236 215
2 3300030733 Ga0314311_1060236 Ga0314311_10602362 215
3 3300005437 Ga0070710_10012726 Ga0070710_100127262 243
4 3300025898 Ga0207692_10000446 Ga0207692_1000044610 243
5 3300044658 Ga0466972_0003708 Ga0466972_0003708_5900_6679 243
6 3300044683 Ga0466965_0009719 Ga0466965_0009719_453_1232 243
7 3300044683 Ga0466965_0061310 Ga0466965_0061310_830_1609 243
8 3300044735 Ga0466968_0012484 Ga0466968_0012484_478_1257 243
9 3300044901 Ga0466960_0003924 Ga0466960_0003924_1729_2508 243
10 iso_pu_bacteria 2928115317 2928117194 249
11 3300044683 Ga0466965_0006213 Ga0466965_0006213_1034_1813 250
12 3300045051 Ga0451576_0108045 Ga0451576_0108045_1253_2017 251
13 iso_pu_bacteria 2738543013 2739249523 252
14 iso_pu_bacteria 2842733646 2842733809 252
15 iso_pu_bacteria 639633007 639788991 252
16 3300048927 Ga0496124_0087262 Ga0496124_0087262_664_1443 253
17 iso_pu_bacteria 2842733646 2842734057 253
18 iso_pu_bacteria 2842747753 2842749664 253
19 3300053093 Ga0500651_0025468 Ga0500651_0025468_2415_3206 254
20 iso_pu_bacteria 2599185214 2599620807 254
21 iso_pu_bacteria 2599185226 2599674106 254
22 iso_pu_bacteria 2599185227 2599678577 254
23 iso_pu_bacteria 2599185229 2599690318 254
24 iso_pu_bacteria 2643221683 2644465938 254
25 iso_pu_bacteria 2643221717 2644648075 254
26 iso_pu_bacteria 2818991446 2819601340 254
27 iso_pu_bacteria 2831265667 2831269761 254
28 iso_pu_bacteria 2838054893 2838055221 254
29 iso_pu_bacteria 2842677519 2842682343 254
30 iso_pu_bacteria 2885192300 2885196754 254
31 iso_pu_bacteria 2885198086 2885201692 254
32 iso_pu_bacteria 2885211737 2885215597 254
33 iso_pu_bacteria 2899924645 2899927311 254
34 iso_pu_bacteria 2904449895 2904450974 254
35 iso_pu_bacteria 2904456579 2904459523 254
36 iso_pu_bacteria 2904541872 2904549210 254
37 iso_pu_bacteria 2919462493 2919465482 254
38 iso_pu_bacteria 2928037797 2928042775 254
39 iso_pu_bacteria 2928044640 2928048798 254
40 iso_pu_bacteria 2928051484 2928055130 254
41 iso_pu_bacteria 2928064002 2928068556 254
42 iso_pu_bacteria 2928070936 2928073535 254
43 iso_pu_bacteria 2928084124 2928089762 254
44 iso_pu_bacteria 2929160207 2929161387 254
45 iso_pu_bacteria 2929520902 2929521637 254
46 iso_pu_bacteria 2945945610 2945949727 254
47 iso_pu_bacteria 2945972063 2945973751 254
48 iso_pu_bacteria 2945984333 2945990466 254
49 iso_pu_bacteria 2954767861 2954770660 254
50 iso_pu_bacteria 2643221570 2643866239 255
51 iso_pu_bacteria 2818991467 2819721164 255
52 3300003784 Ga0055534_1002481 Ga0055534_10024817 256
53 3300025284 Ga0209130_1003952 Ga0209130_10039523 256
54 3300025292 Ga0209676_1012347 Ga0209676_10123473 256
55 3300025294 Ga0209025_1055390 Ga0209025_10553903 256
56 3300025304 Ga0209257_1009791 Ga0209257_10097913 256
57 iso_pu_bacteria 2585428058 2587734719 256
58 iso_pu_bacteria 2599185292 2599903003 256
59 iso_pu_bacteria 2643221592 2643969911 256
60 iso_pu_bacteria 2643221594 2643980113 256
61 iso_pu_bacteria 2643221621 2644123399 256
62 iso_pu_bacteria 2643221625 2644138278 256
63 iso_pu_bacteria 2643221648 2644274049 256
64 iso_pu_bacteria 2687453129 2687580578 256
65 iso_pu_bacteria 2808606395 2809033341 256
66 iso_pu_bacteria 2857576091 2857576634 256
67 iso_pu_bacteria 2858950400 2858951980 256
68 iso_pu_bacteria 2941479691 2941482405 256
69 3300005367 Ga0070667_100004081 Ga0070667_1000040816 257
70 3300005548 Ga0070665_100031029 Ga0070665_1000310294 257
71 3300005843 Ga0068860_100133384 Ga0068860_1001333842 257
72 3300014497 Ga0182008_10000065 Ga0182008_1000006511 257
73 3300014497 Ga0182008_10020013 Ga0182008_100200134 257
74 3300015262 Ga0182007_10001385 Ga0182007_1000138511 257
75 3300025903 Ga0207680_10000002 Ga0207680_10000002768 257
76 3300025920 Ga0207649_10001904 Ga0207649_1000190410 257
77 3300025924 Ga0207694_10003196 Ga0207694_100031963 257
78 3300028379 Ga0268266_10000004 Ga0268266_10000004762 257
79 3300028381 Ga0268264_10404022 Ga0268264_104040222 257
80 3300031456 Ga0307513_10343269 Ga0307513_103432691 257
81 3300033180 Ga0307510_10025957 Ga0307510_100259575 257
82 3300041509 Ga0451843_0742469 Ga0451843_0742469_125_916 257
83 3300046460 Ga0495638_0033484 Ga0495638_0033484_2044_2847 257
84 3300046515 Ga0495620_0054742 Ga0495620_0054742_808_1611 257
85 3300046519 Ga0495632_0003267 Ga0495632_0003267_6040_6843 257
86 3300048920 Ga0496117_0263367 Ga0496117_0263367_138_911 257
87 3300048927 Ga0496124_0167870 Ga0496124_0167870_471_1244 257
88 3300048927 Ga0496124_0337078 Ga0496124_0337078_76_849 257
89 3300048929 Ga0496126_0119056 Ga0496126_0119056_585_1358 257
90 3300050493 nmdc:mga0k408_8386_c1 nmdc:mga0k408_8386_c1_2811_3614 257
91 3300053088 Ga0500644_0046962 Ga0500644_0046962_376_1179 257
92 3300053092 Ga0500583_0056234 Ga0500583_0056234_374_1177 257
93 3300053093 Ga0500651_0008611 Ga0500651_0008611_4487_5290 257
94 3300053127 Ga0500623_048151 Ga0500623_048151_946_1749 257
95 3300053129 Ga0500628_002962 Ga0500628_002962_1355_2158 257
96 3300053130 Ga0500642_0003472 Ga0500642_0003472_1343_2146 257
97 3300053131 Ga0500652_000553 Ga0500652_000553_4722_5525 257
98 3300053133 Ga0500655_004404 Ga0500655_004404_616_1419 257
99 3300053136 Ga0500559_0000819 Ga0500559_0000819_16343_17116 257
100 3300053139 Ga0500568_0050525 Ga0500568_0050525_344_1147 257
101 3300053140 Ga0500573_0015391 Ga0500573_0015391_923_1696 257
102 3300053142 Ga0500577_0025140 Ga0500577_0025140_1142_1945 257
103 3300053151 Ga0500604_0007524 Ga0500604_0007524_711_1514 257
104 3300053156 Ga0500622_0000650 Ga0500622_0000650_16142_16945 257
105 iso_pu_bacteria 2510917015 2511105284 257
106 iso_pu_bacteria 2808606384 2808972523 257
107 iso_pu_bacteria 2808606390 2809007484 257
108 iso_pu_bacteria 2808606391 2809014490 257
109 3300001979 JGI24740J21852_10013447 JGI24740J21852_100134473 258
110 3300001989 JGI24739J22299_10018763 JGI24739J22299_100187633 258
111 3300003187 JGI25151J46595_10004463 JGI25151J46595_100044631 258
112 3300003187 JGI25151J46595_10005917 JGI25151J46595_100059173 258
113 3300003215 JGI25153J46596_10004050 JGI25153J46596_100040504 258
114 3300003578 Ga0006562J51391_1022424 Ga0006562J51391_10224242 258
115 3300003578 Ga0006562J51391_1050175 Ga0006562J51391_10501754 258
116 3300003578 Ga0006562J51391_1050176 Ga0006562J51391_10501763 258
117 3300003761 Ga0055535_1002254 Ga0055535_10022546 258
118 3300003762 Ga0055542_1000084 Ga0055542_10000846 258
119 3300003781 Ga0055536_1001919 Ga0055536_10019199 258
120 3300003781 Ga0055536_1008121 Ga0055536_10081213 258
121 3300003784 Ga0055534_1000240 Ga0055534_100024025 258
122 3300003790 Ga0055528_1002132 Ga0055528_10021327 258
123 3300003791 Ga0055530_10001195 Ga0055530_100011956 258
124 3300003792 Ga0055540_1004031 Ga0055540_10040315 258
125 3300003794 Ga0055531_10003661 Ga0055531_100036616 258
126 3300003794 Ga0055531_10014009 Ga0055531_100140094 258
127 3300005364 Ga0070673_100579465 Ga0070673_1005794651 258
128 3300005367 Ga0070667_100015516 Ga0070667_1000155164 258
129 3300005367 Ga0070667_100231818 Ga0070667_1002318183 258
130 3300005456 Ga0070678_100109598 Ga0070678_1001095982 258
131 3300005539 Ga0068853_100024223 Ga0068853_1000242236 258
132 3300005543 Ga0070672_100122786 Ga0070672_1001227863 258
133 3300005548 Ga0070665_100273185 Ga0070665_1002731852 258
134 3300005844 Ga0068862_100017123 Ga0068862_1000171236 258
135 3300006048 Ga0075363_100026358 Ga0075363_1000263583 258
136 3300006048 Ga0075363_100032762 Ga0075363_1000327623 258
137 3300006058 Ga0075432_10020528 Ga0075432_100205283 258
138 3300006177 Ga0075362_10026224 Ga0075362_100262243 258
139 3300006177 Ga0075362_10072481 Ga0075362_100724812 258
140 3300006178 Ga0075367_10008817 Ga0075367_100088174 258
141 3300006178 Ga0075367_10024505 Ga0075367_100245055 258
142 3300006178 Ga0075367_10088504 Ga0075367_100885042 258
143 3300006178 Ga0075367_10363355 Ga0075367_103633551 258
144 3300006195 Ga0075366_10024508 Ga0075366_100245084 258
145 3300006195 Ga0075366_10036567 Ga0075366_100365673 258
146 3300006195 Ga0075366_10042290 Ga0075366_100422903 258
147 3300006195 Ga0075366_10071511 Ga0075366_100715113 258
148 3300006353 Ga0075370_10002922 Ga0075370_100029224 258
149 3300006353 Ga0075370_10018695 Ga0075370_100186953 258
150 3300006353 Ga0075370_10021436 Ga0075370_100214363 258
151 3300006353 Ga0075370_10030516 Ga0075370_100305163 258
152 3300006353 Ga0075370_10106822 Ga0075370_101068223 258
153 3300006948 Ga0099826_10012916 Ga0099826_100129161 258
154 3300009148 Ga0105243_10003150 Ga0105243_1000315012 258
155 3300009148 Ga0105243_10197068 Ga0105243_101970681 258
156 3300009176 Ga0105242_10371005 Ga0105242_103710053 258
157 3300009177 Ga0105248_10451429 Ga0105248_104514292 258
158 3300011119 Ga0105246_10203567 Ga0105246_102035671 258
159 3300012502 Ga0157347_1001091 Ga0157347_10010912 258
160 3300013100 Ga0157373_10001810 Ga0157373_1000181010 258
161 3300013102 Ga0157371_10021080 Ga0157371_100210801 258
162 3300013104 Ga0157370_10018595 Ga0157370_100185957 258
163 3300013104 Ga0157370_10176792 Ga0157370_101767923 258
164 3300013306 Ga0163162_10077532 Ga0163162_100775323 258
165 3300013307 Ga0157372_10226932 Ga0157372_102269322 258
166 3300013308 Ga0157375_10318435 Ga0157375_103184353 258
167 3300013308 Ga0157375_10427055 Ga0157375_104270551 258
168 3300014497 Ga0182008_10011284 Ga0182008_100112842 258
169 3300014969 Ga0157376_10241517 Ga0157376_102415173 258
170 3300015261 Ga0182006_1060904 Ga0182006_10609041 258
171 3300015683 Ga0183362_10003 Ga0183362_10003821 258
172 3300017792 Ga0163161_10001053 Ga0163161_100010536 258
173 3300017792 Ga0163161_10006753 Ga0163161_100067533 258
174 3300017792 Ga0163161_10026711 Ga0163161_100267112 258
175 3300017792 Ga0163161_10139450 Ga0163161_101394503 258
176 3300025228 Ga0209672_101525 Ga0209672_1015253 258
177 3300025229 Ga0209147_101867 Ga0209147_1018677 258
178 3300025242 Ga0209258_100790 Ga0209258_1007906 258
179 3300025245 Ga0207425_1000552 Ga0207425_10005526 258
180 3300025254 Ga0209148_1000007 Ga0209148_10000071181 258
181 3300025258 Ga0209129_1000147 Ga0209129_100014768 258
182 3300025263 Ga0209565_1000117 Ga0209565_100011779 258
183 3300025263 Ga0209565_1000282 Ga0209565_100028226 258
184 3300025273 Ga0209673_1000218 Ga0209673_100021826 258
185 3300025273 Ga0209673_1001256 Ga0209673_10012569 258
186 3300025273 Ga0209673_1001287 Ga0209673_100128718 258
187 3300025291 Ga0209675_1000113 Ga0209675_100011379 258
188 3300025291 Ga0209675_1000745 Ga0209675_10007456 258
189 3300025291 Ga0209675_1001118 Ga0209675_10011183 258
190 3300025291 Ga0209675_1015736 Ga0209675_10157364 258
191 3300025292 Ga0209676_1000028 Ga0209676_1000028487 258
192 3300025292 Ga0209676_1000216 Ga0209676_100021632 258
193 3300025292 Ga0209676_1000486 Ga0209676_100048617 258
194 3300025292 Ga0209676_1014026 Ga0209676_10140263 258
195 3300025294 Ga0209025_1000375 Ga0209025_100037571 258
196 3300025294 Ga0209025_1000503 Ga0209025_10005036 258
197 3300025294 Ga0209025_1001127 Ga0209025_100112715 258
198 3300025294 Ga0209025_1019657 Ga0209025_10196573 258
199 3300025294 Ga0209025_1026175 Ga0209025_10261754 258
200 3300025295 Ga0209564_1000220 Ga0209564_100022033 258
201 3300025295 Ga0209564_1000327 Ga0209564_100032749 258
202 3300025297 Ga0209758_1000096 Ga0209758_100009638 258
203 3300025297 Ga0209758_1000199 Ga0209758_100019923 258
204 3300025298 Ga0209050_1000072 Ga0209050_1000072244 258
205 3300025298 Ga0209050_1000133 Ga0209050_100013323 258
206 3300025298 Ga0209050_1004745 Ga0209050_10047455 258
207 3300025298 Ga0209050_1008127 Ga0209050_10081276 258
208 3300025299 Ga0209256_1000117 Ga0209256_100011733 258
209 3300025299 Ga0209256_1000206 Ga0209256_100020680 258
210 3300025302 Ga0207426_1000049 Ga0207426_1000049216 258
211 3300025302 Ga0207426_1000166 Ga0207426_100016633 258
212 3300025303 Ga0209051_1000015 Ga0209051_1000015416 258
213 3300025303 Ga0209051_1000255 Ga0209051_100025563 258
214 3300025303 Ga0209051_1000440 Ga0209051_100044018 258
215 3300025303 Ga0209051_1006243 Ga0209051_10062434 258
216 3300025304 Ga0209257_1000037 Ga0209257_1000037329 258
217 3300025304 Ga0209257_1003603 Ga0209257_10036036 258
218 3300025304 Ga0209257_1021205 Ga0209257_10212052 258
219 3300025321 Ga0207656_10001836 Ga0207656_100018364 258
220 3300025903 Ga0207680_10137506 Ga0207680_101375062 258
221 3300025935 Ga0207709_10003894 Ga0207709_100038943 258
222 3300025940 Ga0207691_10069813 Ga0207691_100698134 258
223 3300025986 Ga0207658_10008502 Ga0207658_100085024 258
224 3300025986 Ga0207658_10053691 Ga0207658_100536912 258
225 3300026041 Ga0207639_10038664 Ga0207639_100386643 258
226 3300026089 Ga0207648_10512280 Ga0207648_105122802 258
227 3300027666 Ga0209282_1000188 Ga0209282_100018816 258
228 3300028380 Ga0268265_10022768 Ga0268265_100227684 258
229 3300028794 Ga0307515_10000278 Ga0307515_100002785 258
230 3300030522 Ga0307512_10095222 Ga0307512_100952222 258
231 3300030732 Ga0316176_1214107 Ga0316176_12141073 258
232 3300030733 Ga0314311_1161585 Ga0314311_11615853 258
233 3300030735 Ga0316178_1014508 Ga0316178_10145083 258
234 3300030742 Ga0316183_1023150 Ga0316183_10231503 258
235 3300030744 Ga0316181_1048647 Ga0316181_10486474 258
236 3300030745 Ga0316182_1255049 Ga0316182_12550493 258
237 3300030745 Ga0316182_1282305 Ga0316182_12823056 258
238 3300031251 Ga0265327_10003682 Ga0265327_100036829 258
239 3300031251 Ga0265327_10022822 Ga0265327_100228222 258
240 3300031456 Ga0307513_10099627 Ga0307513_100996275 258
241 3300031456 Ga0307513_10126061 Ga0307513_101260612 258
242 3300031456 Ga0307513_10128209 Ga0307513_101282092 258
243 3300031548 Ga0307408_100230564 Ga0307408_1002305642 258
244 3300031548 Ga0307408_100257073 Ga0307408_1002570732 258
245 3300031548 Ga0307408_100344479 Ga0307408_1003444792 258
246 3300031548 Ga0307408_100398987 Ga0307408_1003989872 258
247 3300031548 Ga0307408_100587622 Ga0307408_1005876221 258
248 3300031649 Ga0307514_10001608 Ga0307514_100016086 258
249 3300031731 Ga0307405_10081315 Ga0307405_100813153 258
250 3300031731 Ga0307405_10132140 Ga0307405_101321403 258
251 3300031731 Ga0307405_10144826 Ga0307405_101448262 258
252 3300031731 Ga0307405_10263761 Ga0307405_102637612 258
253 3300031852 Ga0307410_10061331 Ga0307410_100613313 258
254 3300031901 Ga0307406_10003432 Ga0307406_100034326 258
255 3300031901 Ga0307406_10624071 Ga0307406_106240711 258
256 3300031911 Ga0307412_10000514 Ga0307412_1000051416 258
257 3300031911 Ga0307412_10009751 Ga0307412_100097516 258
258 3300031911 Ga0307412_10149276 Ga0307412_101492763 258
259 3300032002 Ga0307416_100082607 Ga0307416_1000826074 258
260 3300032002 Ga0307416_100142341 Ga0307416_1001423412 258
261 3300032002 Ga0307416_100231355 Ga0307416_1002313551 258
262 3300032004 Ga0307414_10081523 Ga0307414_100815233 258
263 3300032004 Ga0307414_10242978 Ga0307414_102429783 258
264 3300032004 Ga0307414_10425970 Ga0307414_104259702 258
265 3300032005 Ga0307411_10302861 Ga0307411_103028612 258
266 3300041404 Ga0439436_0001106 Ga0439436_0001106_4263_5060 258
267 3300041405 Ga0439438_028723 Ga0439438_028723_66_848 258
268 3300041406 Ga0439439_0007278 Ga0439439_0007278_57_839 258
269 3300041407 Ga0439447_014562 Ga0439447_014562_902_1699 258
270 3300041407 Ga0439447_053159 Ga0439447_053159_157_939 258
271 3300041410 Ga0439461_0014139 Ga0439461_0014139_618_1415 258
272 3300041411 Ga0439466_0008747 Ga0439466_0008747_689_1486 258
273 3300041413 Ga0439465_0004172 Ga0439465_0004172_2664_3461 258
274 3300041997 Ga0439431_0001773 Ga0439431_0001773_3311_4108 258
275 3300041997 Ga0439431_0040826 Ga0439431_0040826_26_808 258
276 3300041999 Ga0439433_0000073 Ga0439433_0000073_8764_9561 258
277 3300042004 Ga0439445_0017196 Ga0439445_0017196_535_1332 258
278 3300042006 Ga0439432_003345 Ga0439432_003345_2383_3180 258
279 3300042006 Ga0439432_012846 Ga0439432_012846_378_1160 258
280 3300042007 Ga0439449_0004725 Ga0439449_0004725_2342_3139 258
281 3300042007 Ga0439449_0013662 Ga0439449_0013662_2225_3007 258
282 3300042007 Ga0439449_0036226 Ga0439449_0036226_834_1634 258
283 3300042010 Ga0439452_005844 Ga0439452_005844_2585_3382 258
284 3300042010 Ga0439452_009932 Ga0439452_009932_1974_2756 258
285 3300042011 Ga0439454_005299 Ga0439454_005299_689_1471 258
286 3300042014 Ga0439457_028987 Ga0439457_028987_286_1083 258
287 3300042015 Ga0439462_0000528 Ga0439462_0000528_6301_7098 258
288 3300042122 Ga0450920_007142 Ga0450920_007142_35_817 258
289 3300042123 Ga0450921_000087 Ga0450921_000087_1072_1854 258
290 3300042125 Ga0450923_001111 Ga0450923_001111_1552_2334 258
291 3300042131 Ga0450894_004830 Ga0450894_004830_261_1043 258
292 3300042145 Ga0450906_002179 Ga0450906_002179_1484_2266 258
293 3300042146 Ga0450907_007153 Ga0450907_007153_602_1384 258
294 3300042184 Ga0450908_002739 Ga0450908_002739_1044_1826 258
295 3300042185 Ga0450909_020336 Ga0450909_020336_149_931 258
296 3300042435 Ga0439434_0009398 Ga0439434_0009398_661_1443 258
297 3300042531 Ga0450918_001850 Ga0450918_001850_1569_2351 258
298 3300042532 Ga0450893_0027145 Ga0450893_0027145_19_801 258
299 3300044683 Ga0466965_0032872 Ga0466965_0032872_937_1719 258
300 3300046453 Ga0495627_003948 Ga0495627_003948_2192_2968 258
301 3300046459 Ga0495629_0139730 Ga0495629_0139730_336_1112 258
302 3300046460 Ga0495638_0021928 Ga0495638_0021928_1748_2524 258
303 3300046501 Ga0495607_0000280 Ga0495607_0000280_1092_1898 258
304 3300046513 Ga0495616_0002314 Ga0495616_0002314_4696_5472 258
305 3300046515 Ga0495620_0009668 Ga0495620_0009668_3345_4121 258
306 3300046518 Ga0495631_0000007 Ga0495631_0000007_18359_19135 258
307 3300046520 Ga0495637_0001478 Ga0495637_0001478_11295_12071 258
308 3300046520 Ga0495637_0036504 Ga0495637_0036504_659_1435 258
309 3300046525 Ga0495663_0061522 Ga0495663_0061522_71_847 258
310 3300046528 Ga0495642_0025460 Ga0495642_0025460_1231_2013 258
311 3300046530 Ga0495654_0038103 Ga0495654_0038103_537_1313 258
312 3300046536 Ga0495587_0062831 Ga0495587_0062831_479_1255 258
313 3300046538 Ga0495609_0020101 Ga0495609_0020101_1394_2170 258
314 3300046539 Ga0495621_0017222 Ga0495621_0017222_978_1760 258
315 3300046615 Ga0495656_0000306 Ga0495656_0000306_6246_7028 258
316 3300046616 Ga0495668_0079935 Ga0495668_0079935_717_1493 258
317 3300046660 Ga0495625_0000329 Ga0495625_0000329_44642_45424 258
318 3300046660 Ga0495625_0110163 Ga0495625_0110163_139_915 258
319 3300046660 Ga0495625_0208827 Ga0495625_0208827_85_861 258
320 3300046665 Ga0495661_0120234 Ga0495661_0120234_584_1360 258
321 3300046674 Ga0495588_0023003 Ga0495588_0023003_818_1600 258
322 3300046674 Ga0495588_0027305 Ga0495588_0027305_1065_1841 258
323 3300046674 Ga0495588_0092801 Ga0495588_0092801_202_978 258
324 3300046678 Ga0495599_0145394 Ga0495599_0145394_383_1165 258
325 3300046689 Ga0495613_0191329 Ga0495613_0191329_467_1249 258
326 3300046690 Ga0495624_0312377 Ga0495624_0312377_161_937 258
327 3300046691 Ga0495670_0025910 Ga0495670_0025910_211_993 258
328 3300046691 Ga0495670_0093113 Ga0495670_0093113_691_1467 258
329 3300046692 Ga0495671_0012336 Ga0495671_0012336_2728_3504 258
330 3300046810 Ga0495660_0049605 Ga0495660_0049605_78_854 258
331 3300046810 Ga0495660_0184714 Ga0495660_0184714_16_792 258
332 3300048089 Ga0495614_0021088 Ga0495614_0021088_869_1645 258
333 3300048089 Ga0495614_0056346 Ga0495614_0056346_452_1228 258
334 3300048090 Ga0495615_0012670 Ga0495615_0012670_675_1457 258
335 3300048903 Ga0496100_0006455 Ga0496100_0006455_2370_3152 258
336 3300048903 Ga0496100_0214056 Ga0496100_0214056_137_919 258
337 3300048904 Ga0496101_0002678 Ga0496101_0002678_8332_9114 258
338 3300048904 Ga0496101_0025941 Ga0496101_0025941_3189_3965 258
339 3300048905 Ga0496102_0001281 Ga0496102_0001281_14937_15719 258
340 3300048905 Ga0496102_0628623 Ga0496102_0628623_141_923 258
341 3300048906 Ga0496103_0153663 Ga0496103_0153663_574_1356 258
342 3300048907 Ga0496104_0000492 Ga0496104_0000492_15472_16254 258
343 3300048908 Ga0496105_0002998 Ga0496105_0002998_10727_11509 258
344 3300048908 Ga0496105_0204738 Ga0496105_0204738_21_803 258
345 3300048908 Ga0496105_0326005 Ga0496105_0326005_365_1147 258
346 3300048908 Ga0496105_0330422 Ga0496105_0330422_185_967 258
347 3300048909 Ga0496106_0122920 Ga0496106_0122920_889_1671 258
348 3300048910 Ga0496107_0232728 Ga0496107_0232728_143_925 258
349 3300048913 Ga0496110_0003826 Ga0496110_0003826_8621_9403 258
350 3300048917 Ga0496114_0679656 Ga0496114_0679656_29_808 258
351 3300048918 Ga0496115_0431047 Ga0496115_0431047_166_948 258
352 3300048919 Ga0496116_0004874 Ga0496116_0004874_298_1104 258
353 3300048919 Ga0496116_0045302 Ga0496116_0045302_2131_2937 258
354 3300048919 Ga0496116_0142973 Ga0496116_0142973_37_843 258
355 3300048920 Ga0496117_0014724 Ga0496117_0014724_1167_1973 258
356 3300048920 Ga0496117_0018028 Ga0496117_0018028_745_1521 258
357 3300048920 Ga0496117_0125479 Ga0496117_0125479_538_1344 258
358 3300048921 Ga0496118_0005897 Ga0496118_0005897_4928_5734 258
359 3300048921 Ga0496118_0007943 Ga0496118_0007943_6372_7148 258
360 3300048921 Ga0496118_0016642 Ga0496118_0016642_4757_5563 258
361 3300048921 Ga0496118_0075600 Ga0496118_0075600_1032_1808 258
362 3300048922 Ga0496119_0012198 Ga0496119_0012198_4737_5543 258
363 3300048922 Ga0496119_0046982 Ga0496119_0046982_713_1489 258
364 3300048923 Ga0496120_0046839 Ga0496120_0046839_601_1407 258
365 3300048924 Ga0496121_0001111 Ga0496121_0001111_4737_5543 258
366 3300048924 Ga0496121_0051153 Ga0496121_0051153_1389_2165 258
367 3300048924 Ga0496121_0291871 Ga0496121_0291871_264_1040 258
368 3300048925 Ga0496122_0000319 Ga0496122_0000319_69295_70116 258
369 3300048925 Ga0496122_0001794 Ga0496122_0001794_4739_5545 258
370 3300048925 Ga0496122_0127091 Ga0496122_0127091_839_1615 258
371 3300048925 Ga0496122_0135192 Ga0496122_0135192_571_1347 258
372 3300048925 Ga0496122_0163663 Ga0496122_0163663_204_998 258
373 3300048925 Ga0496122_0169505 Ga0496122_0169505_118_894 258
374 3300048926 Ga0496123_0000117 Ga0496123_0000117_49086_49907 258
375 3300048926 Ga0496123_0017100 Ga0496123_0017100_309_1115 258
376 3300048926 Ga0496123_0031910 Ga0496123_0031910_2366_3142 258
377 3300048927 Ga0496124_0102407 Ga0496124_0102407_846_1622 258
378 3300048927 Ga0496124_0215345 Ga0496124_0215345_292_1098 258
379 3300048928 Ga0496125_0000168 Ga0496125_0000168_4737_5543 258
380 3300048928 Ga0496125_0032536 Ga0496125_0032536_947_1723 258
381 3300048928 Ga0496125_0036303 Ga0496125_0036303_883_1689 258
382 3300048928 Ga0496125_0065336 Ga0496125_0065336_1637_2443 258
383 3300048928 Ga0496125_0093664 Ga0496125_0093664_597_1373 258
384 3300048928 Ga0496125_0216578 Ga0496125_0216578_297_1073 258
385 3300048929 Ga0496126_0053370 Ga0496126_0053370_1918_2724 258
386 3300049459 Ga0495678_065900 Ga0495678_065900_236_1012 258
387 3300049663 Ga0501223_015438 Ga0501223_015438_23_985 258
388 3300049705 Ga0501225_0003874 Ga0501225_0003874_1977_2753 258
389 3300049759 Ga0501262_000067 Ga0501262_000067_10168_10944 258
390 3300049763 Ga0501266_000568 Ga0501266_000568_2500_3288 258
391 3300050489 nmdc:mga03683_1228_c1 nmdc:mga03683_1228_c1_5722_6504 258
392 3300050489 nmdc:mga03683_5904_c1 nmdc:mga03683_5904_c1_1543_2331 258
393 3300050490 nmdc:mga03n38_92576_c1 nmdc:mga03n38_92576_c1_353_1132 258
394 3300050492 nmdc:mga0yw44_51994_c1 nmdc:mga0yw44_51994_c1_972_1754 258
395 3300050493 nmdc:mga0k408_18754_c2 nmdc:mga0k408_18754_c2_65_847 258
396 3300050493 nmdc:mga0k408_20817_c1 nmdc:mga0k408_20817_c1_2493_3275 258
397 3300050493 nmdc:mga0k408_45505_c1 nmdc:mga0k408_45505_c1_158_940 258
398 3300050494 nmdc:mga06z11_228532_c1 nmdc:mga06z11_228532_c1_149_925 258
399 3300050496 nmdc:mga07m45_20005_c1 nmdc:mga07m45_20005_c1_1381_2157 258
400 3300050496 nmdc:mga07m45_2383_c1 nmdc:mga07m45_2383_c1_7675_8451 258
401 3300050496 nmdc:mga07m45_45420_c1 nmdc:mga07m45_45420_c1_1154_1936 258
402 3300050496 nmdc:mga07m45_46783_c1 nmdc:mga07m45_46783_c1_828_1604 258
403 3300050496 nmdc:mga07m45_71249_c1 nmdc:mga07m45_71249_c1_951_1730 258
404 3300053079 Ga0500610_0002114 Ga0500610_0002114_5830_6606 258
405 3300053079 Ga0500610_0068011 Ga0500610_0068011_841_1617 258
406 3300053079 Ga0500610_0140205 Ga0500610_0140205_98_874 258
407 3300053087 Ga0500643_013348 Ga0500643_013348_1412_2188 258
408 3300053093 Ga0500651_0000305 Ga0500651_0000305_5257_6033 258
409 3300053094 Ga0500566_0099745 Ga0500566_0099745_582_1358 258
410 3300053096 Ga0500641_0105759 Ga0500641_0105759_55_831 258
411 3300053110 Ga0500571_001655 Ga0500571_001655_8414_9190 258
412 3300053117 Ga0500593_001728 Ga0500593_001728_1742_2518 258
413 3300053121 Ga0500607_000744 Ga0500607_000744_14874_15650 258
414 3300053121 Ga0500607_019694 Ga0500607_019694_2085_2861 258
415 3300053122 Ga0500608_003525 Ga0500608_003525_4406_5182 258
416 3300053128 Ga0500626_034002 Ga0500626_034002_813_1589 258
417 3300053133 Ga0500655_000766 Ga0500655_000766_1417_2193 258
418 3300053134 Ga0500658_0001043 Ga0500658_0001043_7986_8762 258
419 3300053134 Ga0500658_0001267 Ga0500658_0001267_7042_7818 258
420 3300053138 Ga0500564_044032 Ga0500564_044032_671_1447 258
421 3300053139 Ga0500568_0000934 Ga0500568_0000934_15551_16327 258
422 3300053153 Ga0500616_0017295 Ga0500616_0017295_1696_2472 258
423 3300053158 Ga0500627_0000537 Ga0500627_0000537_4514_5290 258
424 3300053161 Ga0500634_0054460 Ga0500634_0054460_396_1172 258
425 3300053162 Ga0500638_006150 Ga0500638_006150_1882_2658 258
426 iso_pu_bacteria 2643221628 2644161395 258
427 iso_pu_bacteria 2738541307 2738886253 258
428 iso_pu_bacteria 2738543019 2739279856 258
429 iso_pu_bacteria 2857537821 2857538172 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

17

272

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9516 3 258
4n81-assembly1.cif.gz_A-2 another flexible region at the active site of an inositol monophosphatase from zymomonas mobilis 0.9443 3 258
5eq8-assembly1.cif.gz_A-2 crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol 0.9188 8 258
5eq7-assembly1.cif.gz_A crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with free phosphate 0.9188 8 258
5eq9-assembly2.cif.gz_D crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ 0.9165 8 258
ID Description Score Start End Superfamily
af_Q6Z4I1_66_215_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9682 8 141 3.30.540.10
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9606 141 258 3.40.190.80
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9543 10 141 3.30.540.10
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9529 10 141 3.30.540.10
4n81A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9447 141 258 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A2D9MTX7-F1-model_v4 Histidinol phosphate phosphatase 0.9839 53 258 GO:0000105
GO:0016791
GO:0046872
AF-A0A2W7HCP7-F1-model_v4 deleted 0.983 1 258
AF-A0A5C1B6A6-F1-model_v4 Inositol monophosphatase 0.9799 142 258 GO:0000105
GO:0042578
GO:0046872
AF-A0A2W7HCP7-F1-model_v4 deleted 0.9792 1 258
AF-A0A2E6X688-F1-model_v4 Histidinol-phosphatase (EC 3.1.3.15) 0.9739 6 258 GO:0000105
GO:0004401
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.35 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map