F441983

General Info

Members Datasets Scaffolds Average Seq Length
429 171 858 311

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0028540|Ga0495585_0028540_1622_2692
Length 356
Sequence MLSVQYQGHYKYYIVIIGSRVRGSDGFTDGGTVSANVQNKLSDHKEEHKVQAQTVYAIGECMIELQRNGAGMDYRFGGDTLNAAVYMARLLDPAQVKVAYVTGLGVDGMSDEMCASWREEGIATCCVLRLPDRLPGIYMIETDPTGERRFHYWRRDSAARHWLEAPDAGKVLLKLSRASMVYLSGISLAILSPADRELLISALARCRAAGGSVVFDNNYRPRLWESAADAAAVYARVLGHCDIALLTLDDEEALYGPHDVMAAIERTRARGVKEVVVKRGAEPCVVWDGGQAVEVAAAPVADVVDTTAAGDSFGGAYLAARLSGATPEEAARAGHRLAGTVIRHRGAIIPRDAMPA

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
32 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
36 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
39 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
40 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
41 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
46 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
57 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
58 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
61 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
62 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
63 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
64 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
65 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
66 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
67 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
71 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
75 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
79 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
82 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
83 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
91 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
100 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
112 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
143 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
144 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
145 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
146 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
147 2643221556 Massilia sp. Root1485 Isolate Unclassified
148 2643221684 Massilia sp. Root133 Isolate Unclassified
149 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
150 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
151 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
152 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
153 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
154 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
155 2904699407
156 2906610324
157 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
158 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
159 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
160 2922425934
161 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
162 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
163 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
164 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
165 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
166 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
167 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
168 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
169 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
170 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
171 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 3.96
Rhizoplane 3.73
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0028540 3300046492 Bacteria 3182
2 SwRhRL2b_contig_987987 2162886007 Bacteria 1592
3 rootH2_10092768 3300003320 Bacteria 2490
4 rootL2_10022850 3300003322 Bacteria 5912
5 rootH1_10009614 3300003323 Bacteria 4865
6 rootH1_10105594 3300003323 Bacteria 5238
7 Ga0070658_10136990 3300005327 Bacteria 2043
8 Ga0070658_10220618 3300005327 Bacteria 1603
9 Ga0070680_100036016 3300005336 Bacteria 3997
10 Ga0070660_100007896 3300005339 Bacteria 7425
11 Ga0070661_100003703 3300005344 Bacteria 10533
12 Ga0070659_100015833 3300005366 Bacteria 5654
13 Ga0070659_100019882 3300005366 Bacteria 5096
14 Ga0070659_100034790 3300005366 Bacteria 3920
15 Ga0070709_10022469 3300005434 Bacteria 3690
16 Ga0070662_100044540 3300005457 Bacteria 3179
17 Ga0070664_100027983 3300005564 Bacteria 4688
18 Ga0068856_100368122 3300005614 Bacteria 1456
19 Ga0105240_10422396 3300009093 Bacteria 1497
20 Ga0105238_10184024 3300009551 Bacteria 2066
21 Ga0105239_10375387 3300010375 Bacteria 1607
22 Ga0157369_10469536 3300013105 Bacteria 1302
23 Ga0209563_100003 3300025230 Bacteria 1932942
24 Ga0209148_1000859 3300025254 Bacteria 21262
25 Ga0207705_10002033 3300025909 Bacteria 15750
26 Ga0207657_10009858 3300025919 Bacteria 9567
27 Ga0207657_10018842 3300025919 Bacteria 6572
28 Ga0207657_10197950 3300025919 Bacteria 1617
29 Ga0207706_10037433 3300025933 Bacteria 4308
30 Ga0207709_10105316 3300025935 Bacteria 1874
31 Ga0207667_10049102 3300025949 Bacteria 4459
32 Ga0207667_10177156 3300025949 Bacteria 2190
33 Ga0207702_10483949 3300026078 Bacteria 1205
34 Ga0207698_10220466 3300026142 Bacteria 1714
35 Ga0209281_1001126 3300027111 Bacteria 19167
36 Ga0307408_100000493 3300031548 Bacteria 34421
37 Ga0307408_100503970 3300031548 Bacteria 1060
38 Ga0307406_10017568 3300031901 Bacteria 4167
39 Ga0315911_1000006 3300033442 Bacteria 414563
40 Ga0395899_0000012 3300037312 Bacteria 517561
41 Ga0395899_0011733 3300037312 Bacteria 6707
42 Ga0395899_0040278 3300037312 Bacteria 3494
43 Ga0395900_0000164 3300037418 Bacteria 108590
44 Ga0395900_0000177 3300037418 Bacteria 102548
45 Ga0395900_0003029 3300037418 Bacteria 18287
46 Ga0395900_0009624 3300037418 Bacteria 9910
47 Ga0395900_0015848 3300037418 Bacteria 7680
48 Ga0395900_0039749 3300037418 Bacteria 4846
49 Ga0395900_0118555 3300037418 Bacteria 2716
50 Ga0395900_0238699 3300037418 Bacteria 1824
51 Ga0395900_0480065 3300037418 Bacteria 1196
52 Ga0395898_0035402 3300037466 Bacteria 4964
53 Ga0395898_0039749 3300037466 Bacteria 4654
54 Ga0395898_0098783 3300037466 Bacteria 2803
55 Ga0395898_0101520 3300037466 Bacteria 2762
56 Ga0395898_0188220 3300037466 Bacteria 1972
57 Ga0395898_0412481 3300037466 Bacteria 1287
58 Ga0395905_0021984 3300037471 Bacteria 6034
59 Ga0395905_0035307 3300037471 Bacteria 4694
60 Ga0395905_0037497 3300037471 Bacteria 4550
61 Ga0395901_0000226 3300038443 Bacteria 70810
62 Ga0395901_0000263 3300038443 Bacteria 65735
63 Ga0395901_0023316 3300038443 Bacteria 6343
64 Ga0395901_0065308 3300038443 Bacteria 3789
65 Ga0395901_0135977 3300038443 Bacteria 2583
66 Ga0395901_0182157 3300038443 Bacteria 2203
67 Ga0439448_0025013 3300042005 Bacteria 1870
68 Ga0439448_0028023 3300042005 Bacteria 1777
69 Ga0439455_0042858 3300042012 Bacteria 1163
70 Ga0450891_001733 3300042129 Bacteria 2245
71 Ga0439458_0006760 3300042157 Bacteria 2554
72 Ga0466969_0029666 3300044656 Bacteria 2792
73 Ga0466965_0000437 3300044683 Bacteria 14508
74 Ga0466965_0018971 3300044683 Bacteria 3300
75 Ga0466966_0012849 3300044684 Bacteria 5544
76 Ga0466966_0087622 3300044684 Bacteria 1934
77 Ga0466961_0045293 3300044693 Bacteria 2814
78 Ga0466961_0156225 3300044693 Bacteria 1423
79 Ga0466963_0180371 3300044694 Bacteria 1474
80 Ga0466964_0021743 3300044706 Bacteria 2482
81 Ga0466964_0025109 3300044706 Bacteria 2325
82 Ga0466968_0001513 3300044735 Bacteria 8331
83 Ga0466970_0133864 3300044765 Bacteria 1363
84 Ga0466957_0000103 3300044842 Bacteria 34469
85 Ga0466957_0008628 3300044842 Bacteria 5801
86 Ga0466957_0053036 3300044842 Bacteria 2471
87 Ga0466957_0066224 3300044842 Bacteria 2226
88 Ga0466957_0089255 3300044842 Bacteria 1929
89 Ga0466959_0037845 3300045049 Bacteria 3565
90 Ga0466959_0112149 3300045049 Bacteria 1945
91 Ga0466958_0007110 3300045836 Bacteria 6130
92 Ga0466958_0024471 3300045836 Bacteria 3553
93 Ga0466967_0014585 3300045976 Bacteria 6128
94 Ga0495617_000001 3300046452 Bacteria 877032
95 Ga0495617_000080 3300046452 Bacteria 74677
96 Ga0495617_019547 3300046452 Bacteria 2291
97 Ga0495627_000213 3300046453 Bacteria 62885
98 Ga0495627_051350 3300046453 Bacteria 1239
99 Ga0495590_0000015 3300046457 Bacteria 241989
100 Ga0495590_0000597 3300046457 Bacteria 16992
101 Ga0495591_000033 3300046458 Bacteria 171402
102 Ga0495638_0004206 3300046460 Bacteria 10956
103 Ga0495653_0006375 3300046463 Bacteria 9673
104 Ga0495653_0040437 3300046463 Bacteria 3644
105 Ga0495650_0004541 3300046471 Bacteria 9480
106 Ga0495580_0035823 3300046472 Bacteria 3567
107 Ga0495582_0149092 3300046473 Bacteria 1327
108 Ga0495605_0000058 3300046474 Bacteria 150303
109 Ga0495605_0000227 3300046474 Bacteria 69646
110 Ga0495605_0005216 3300046474 Bacteria 7575
111 Ga0495605_0008371 3300046474 Bacteria 5850
112 Ga0495605_0017780 3300046474 Bacteria 3821
113 Ga0495605_0025304 3300046474 Bacteria 3094
114 Ga0495584_0000002 3300046491 Bacteria 512179
115 Ga0495584_0000090 3300046491 Bacteria 62655
116 Ga0495584_0000175 3300046491 Bacteria 45105
117 Ga0495584_0000287 3300046491 Bacteria 35639
118 Ga0495584_0001763 3300046491 Bacteria 12604
119 Ga0495584_0004952 3300046491 Bacteria 7099
120 Ga0495584_0006967 3300046491 Bacteria 5904
121 Ga0495584_0033889 3300046491 Bacteria 2584
122 Ga0495584_0037495 3300046491 Bacteria 2450
123 Ga0495584_0051260 3300046491 Bacteria 2078
124 Ga0495585_0000003 3300046492 Bacteria 406344
125 Ga0495585_0000039 3300046492 Bacteria 131202
126 Ga0495585_0000438 3300046492 Bacteria 39870
127 Ga0495585_0002941 3300046492 Bacteria 11784
128 Ga0495585_0003513 3300046492 Bacteria 10571
129 Ga0495585_0007899 3300046492 Bacteria 6469
130 Ga0495585_0014306 3300046492 Bacteria 4625
131 Ga0495585_0020197 3300046492 Bacteria 3832
132 Ga0495585_0106292 3300046492 Bacteria 1496
133 Ga0495594_0022661 3300046499 Bacteria 3359
134 Ga0495594_0045118 3300046499 Bacteria 2419
135 Ga0495594_0090403 3300046499 Bacteria 1715
136 Ga0495594_0096111 3300046499 Bacteria 1664
137 Ga0495596_0000044 3300046500 Bacteria 90299
138 Ga0495596_0002370 3300046500 Bacteria 10186
139 Ga0495596_0005140 3300046500 Bacteria 6230
140 Ga0495596_0009204 3300046500 Bacteria 4354
141 Ga0495596_0010664 3300046500 Bacteria 3993
142 Ga0495596_0011425 3300046500 Bacteria 3833
143 Ga0495596_0011658 3300046500 Bacteria 3783
144 Ga0495607_0000880 3300046501 Bacteria 28001
145 Ga0495607_0003837 3300046501 Bacteria 11339
146 Ga0495607_0005716 3300046501 Bacteria 8856
147 Ga0495607_0015817 3300046501 Bacteria 4881
148 Ga0495607_0031906 3300046501 Bacteria 3221
149 Ga0495607_0053335 3300046501 Bacteria 2337
150 Ga0495583_0000394 3300046506 Bacteria 66597
151 Ga0495583_0000617 3300046506 Bacteria 47939
152 Ga0495583_0000782 3300046506 Bacteria 39742
153 Ga0495583_0002294 3300046506 Bacteria 16694
154 Ga0495583_0011991 3300046506 Bacteria 4938
155 Ga0495583_0027855 3300046506 Bacteria 2784
156 Ga0495583_0027999 3300046506 Bacteria 2776
157 Ga0495583_0053201 3300046506 Bacteria 1838
158 Ga0495583_0133666 3300046506 Bacteria 1036
159 Ga0495606_0010621 3300046507 Bacteria 7619
160 Ga0495606_0010984 3300046507 Bacteria 7439
161 Ga0495606_0015433 3300046507 Bacteria 5884
162 Ga0495606_0018284 3300046507 Bacteria 5263
163 Ga0495606_0025105 3300046507 Bacteria 4276
164 Ga0495606_0046351 3300046507 Bacteria 2874
165 Ga0495606_0066187 3300046507 Bacteria 2293
166 Ga0495606_0173307 3300046507 Bacteria 1250
167 Ga0495606_0241149 3300046507 Bacteria 1008
168 Ga0495610_0016905 3300046512 Bacteria 4179
169 Ga0495616_0000123 3300046513 Bacteria 67114
170 Ga0495616_0000228 3300046513 Bacteria 46105
171 Ga0495616_0000604 3300046513 Bacteria 27112
172 Ga0495616_0003387 3300046513 Bacteria 10222
173 Ga0495616_0006006 3300046513 Bacteria 7401
174 Ga0495616_0006628 3300046513 Bacteria 6994
175 Ga0495616_0040322 3300046513 Bacteria 2386
176 Ga0495616_0129202 3300046513 Bacteria 1159
177 Ga0495620_0009735 3300046515 Bacteria 5101
178 Ga0495630_0018404 3300046517 Bacteria 5132
179 Ga0495631_0003746 3300046518 Bacteria 8280
180 Ga0495631_0004259 3300046518 Bacteria 7649
181 Ga0495631_0005736 3300046518 Bacteria 6476
182 Ga0495631_0006852 3300046518 Bacteria 5846
183 Ga0495631_0013763 3300046518 Bacteria 3920
184 Ga0495631_0082299 3300046518 Bacteria 1388
185 Ga0495631_0086546 3300046518 Bacteria 1349
186 Ga0495632_0000084 3300046519 Bacteria 96469
187 Ga0495632_0000221 3300046519 Bacteria 57926
188 Ga0495632_0000439 3300046519 Bacteria 39649
189 Ga0495632_0004935 3300046519 Bacteria 8940
190 Ga0495632_0031458 3300046519 Bacteria 2743
191 Ga0495637_0000002 3300046520 Bacteria 629280
192 Ga0495637_0026051 3300046520 Bacteria 2630
193 Ga0495643_0006329 3300046522 Bacteria 7823
194 Ga0495643_0011711 3300046522 Bacteria 5325
195 Ga0495643_0011790 3300046522 Bacteria 5302
196 Ga0495643_0030684 3300046522 Bacteria 2999
197 Ga0495644_0005448 3300046523 Bacteria 4972
198 Ga0495644_0013598 3300046523 Bacteria 3122
199 Ga0495644_0037122 3300046523 Bacteria 1838
200 Ga0495648_0000171 3300046524 Bacteria 74494
201 Ga0495648_0000753 3300046524 Bacteria 34596
202 Ga0495648_0010222 3300046524 Bacteria 7168
203 Ga0495648_0025615 3300046524 Bacteria 3989
204 Ga0495648_0059233 3300046524 Bacteria 2286
205 Ga0495648_0083842 3300046524 Bacteria 1805
206 Ga0495663_0031505 3300046525 Bacteria 1576
207 Ga0495666_0006726 3300046526 Bacteria 5781
208 Ga0495642_0000072 3300046528 Bacteria 59857
209 Ga0495642_0001034 3300046528 Bacteria 12922
210 Ga0495642_0001443 3300046528 Bacteria 10641
211 Ga0495642_0002405 3300046528 Bacteria 7621
212 Ga0495642_0002669 3300046528 Bacteria 7171
213 Ga0495642_0002851 3300046528 Bacteria 6897
214 Ga0495642_0017181 3300046528 Bacteria 2825
215 Ga0495642_0093354 3300046528 Bacteria 1275
216 Ga0495654_0059609 3300046530 Bacteria 1837
217 Ga0495640_0193811 3300046533 Bacteria 1291
218 Ga0495587_0002125 3300046536 Bacteria 13244
219 Ga0495587_0075060 3300046536 Bacteria 1963
220 Ga0495609_0000001 3300046538 Bacteria 1060094
221 Ga0495609_0000485 3300046538 Bacteria 31885
222 Ga0495609_0007145 3300046538 Bacteria 5612
223 Ga0495609_0008276 3300046538 Bacteria 5100
224 Ga0495609_0008325 3300046538 Bacteria 5084
225 Ga0495609_0023209 3300046538 Bacteria 2852
226 Ga0495609_0024042 3300046538 Bacteria 2797
227 Ga0495609_0027128 3300046538 Bacteria 2619
228 Ga0495609_0077677 3300046538 Bacteria 1453
229 Ga0495597_0000255 3300046542 Bacteria 48539
230 Ga0495597_0001063 3300046542 Bacteria 20950
231 Ga0495597_0001273 3300046542 Bacteria 18580
232 Ga0495597_0003193 3300046542 Bacteria 9773
233 Ga0495597_0025117 3300046542 Bacteria 2744
234 Ga0495597_0027175 3300046542 Bacteria 2624
235 Ga0495597_0038704 3300046542 Bacteria 2137
236 Ga0495645_0276361 3300046543 Bacteria 1106
237 Ga0495622_0007401 3300046557 Bacteria 5094
238 Ga0495633_0001846 3300046558 Bacteria 15571
239 Ga0495633_0006128 3300046558 Bacteria 7198
240 Ga0495633_0016337 3300046558 Bacteria 3829
241 Ga0495633_0058399 3300046558 Bacteria 1811
242 Ga0495633_0096072 3300046558 Bacteria 1376
243 Ga0495656_0143964 3300046615 Bacteria 1145
244 Ga0495668_0000052 3300046616 Bacteria 212864
245 Ga0495668_0003481 3300046616 Bacteria 11751
246 Ga0495668_0004328 3300046616 Bacteria 10148
247 Ga0495668_0005023 3300046616 Bacteria 9122
248 Ga0495668_0017689 3300046616 Bacteria 4129
249 Ga0495668_0028070 3300046616 Bacteria 3184
250 Ga0495668_0131185 3300046616 Bacteria 1371
251 Ga0495634_0070365 3300046642 Bacteria 2307
252 Ga0495634_0099853 3300046642 Bacteria 1876
253 Ga0495611_0002096 3300046648 Bacteria 9370
254 Ga0495611_0009129 3300046648 Bacteria 4191
255 Ga0495611_0011522 3300046648 Bacteria 3749
256 Ga0495611_0032904 3300046648 Bacteria 2286
257 Ga0495611_0040204 3300046648 Bacteria 2084
258 Ga0495625_0035360 3300046660 Bacteria 3683
259 Ga0495625_0145029 3300046660 Bacteria 1599
260 Ga0495661_0000175 3300046665 Bacteria 73957
261 Ga0495661_0000260 3300046665 Bacteria 60822
262 Ga0495661_0001113 3300046665 Bacteria 23589
263 Ga0495661_0001774 3300046665 Bacteria 17351
264 Ga0495661_0003975 3300046665 Bacteria 10781
265 Ga0495661_0028935 3300046665 Bacteria 3540
266 Ga0495661_0038258 3300046665 Bacteria 2990
267 Ga0495661_0046854 3300046665 Bacteria 2636
268 Ga0495661_0063805 3300046665 Bacteria 2176
269 Ga0495661_0092576 3300046665 Bacteria 1717
270 Ga0495661_0093060 3300046665 Bacteria 1711
271 Ga0495661_0116664 3300046665 Bacteria 1480
272 Ga0495588_0000095 3300046674 Bacteria 175627
273 Ga0495588_0014468 3300046674 Bacteria 3777
274 Ga0495588_0029143 3300046674 Bacteria 2767
275 Ga0495588_0052814 3300046674 Bacteria 2095
276 Ga0495588_0067540 3300046674 Bacteria 1856
277 Ga0495588_0097592 3300046674 Bacteria 1542
278 Ga0495623_0005036 3300046679 Bacteria 8667
279 Ga0495623_0021425 3300046679 Bacteria 4172
280 Ga0495623_0045948 3300046679 Bacteria 2772
281 Ga0495669_0005439 3300046684 Bacteria 5316
282 Ga0495669_0006316 3300046684 Bacteria 4949
283 Ga0495669_0033259 3300046684 Bacteria 2269
284 Ga0495670_0011199 3300046691 Bacteria 4409
285 Ga0495670_0016275 3300046691 Bacteria 3654
286 Ga0495670_0052480 3300046691 Bacteria 2041
287 Ga0495671_0001183 3300046692 Bacteria 17854
288 Ga0495671_0008493 3300046692 Bacteria 5775
289 Ga0495671_0177716 3300046692 Bacteria 1034
290 Ga0495649_0000024 3300046694 Bacteria 175713
291 Ga0495649_0199769 3300046694 Bacteria 1038
292 Ga0495589_0000029 3300046794 Bacteria 173640
293 Ga0495589_0000412 3300046794 Bacteria 32186
294 Ga0495589_0010261 3300046794 Bacteria 4868
295 Ga0495589_0015247 3300046794 Bacteria 3955
296 Ga0495589_0032159 3300046794 Bacteria 2638
297 Ga0495600_0007481 3300046809 Bacteria 6685
298 Ga0495660_0000033 3300046810 Bacteria 212425
299 Ga0495660_0001865 3300046810 Bacteria 13839
300 Ga0495660_0017664 3300046810 Bacteria 4104
301 Ga0495660_0046101 3300046810 Bacteria 2391
302 Ga0495660_0065410 3300046810 Bacteria 1941
303 Ga0495660_0085437 3300046810 Bacteria 1648
304 Ga0495581_0022805 3300047315 Bacteria 3625
305 Ga0495581_0058038 3300047315 Bacteria 2234
306 Ga0495604_0136700 3300047317 Bacteria 1755
307 Ga0495672_0000179 3300047320 Bacteria 91327
308 Ga0495672_0000195 3300047320 Bacteria 86608
309 Ga0495672_0001941 3300047320 Bacteria 19548
310 Ga0495672_0015802 3300047320 Bacteria 5112
311 Ga0495672_0035733 3300047320 Bacteria 3058
312 Ga0495683_0000007 3300047323 Bacteria 268546
313 Ga0495683_0000017 3300047323 Bacteria 189599
314 Ga0495683_0003971 3300047323 Bacteria 8504
315 Ga0495683_0006253 3300047323 Bacteria 6515
316 Ga0495683_0014237 3300047323 Bacteria 4143
317 Ga0495683_0030479 3300047323 Bacteria 2751
318 Ga0495687_000002 3300047443 Bacteria 1085770
319 Ga0495687_000003 3300047443 Bacteria 859509
320 Ga0495687_000092 3300047443 Bacteria 140313
321 Ga0495687_000647 3300047443 Bacteria 39948
322 Ga0495687_001278 3300047443 Bacteria 23689
323 Ga0495675_0026368 3300047444 Bacteria 3705
324 Ga0495675_0059834 3300047444 Bacteria 2415
325 Ga0495675_0105354 3300047444 Bacteria 1762
326 Ga0495677_0000001 3300047445 Bacteria 715000
327 Ga0495677_0000523 3300047445 Bacteria 16038
328 Ga0495677_0000864 3300047445 Bacteria 12246
329 Ga0495677_0002503 3300047445 Bacteria 7195
330 Ga0495677_0004784 3300047445 Bacteria 5159
331 Ga0495677_0025814 3300047445 Bacteria 2131
332 Ga0495677_0028202 3300047445 Bacteria 2038
333 Ga0495677_0032670 3300047445 Bacteria 1895
334 Ga0495677_0134236 3300047445 Bacteria 948
335 Ga0495679_005080 3300047446 Bacteria 5907
336 Ga0495679_009030 3300047446 Bacteria 4015
337 Ga0495681_0000149 3300047470 Bacteria 59126
338 Ga0495681_0001984 3300047470 Bacteria 14940
339 Ga0495681_0004934 3300047470 Bacteria 9006
340 Ga0495681_0005178 3300047470 Bacteria 8774
341 Ga0495681_0011303 3300047470 Bacteria 5326
342 Ga0495681_0039518 3300047470 Bacteria 2303
343 Ga0495681_0043102 3300047470 Bacteria 2178
344 Ga0495681_0055099 3300047470 Bacteria 1855
345 Ga0495686_0000015 3300047472 Bacteria 471703
346 Ga0495686_0000520 3300047472 Bacteria 55657
347 Ga0495686_0007096 3300047472 Bacteria 8445
348 Ga0495593_0005864 3300047673 Bacteria 7239
349 Ga0495593_0023575 3300047673 Bacteria 3419
350 Ga0495593_0163131 3300047673 Bacteria 1125
351 Ga0495602_0037354 3300048088 Bacteria 4509
352 Ga0495615_0056276 3300048090 Bacteria 1026
353 Ga0495626_0000018 3300048091 Bacteria 230153
354 Ga0495626_0000160 3300048091 Bacteria 83120
355 Ga0495626_0012305 3300048091 Bacteria 4490
356 Ga0495626_0016034 3300048091 Bacteria 3818
357 Ga0495626_0022369 3300048091 Bacteria 3124
358 Ga0495626_0025579 3300048091 Bacteria 2886
359 Ga0495626_0029762 3300048091 Bacteria 2639
360 Ga0495626_0049091 3300048091 Bacteria 1955
361 Ga0495626_0127802 3300048091 Bacteria 1087
362 Ga0496100_0024427 3300048903 Bacteria 3686
363 Ga0496102_0000077 3300048905 Bacteria 142501
364 Ga0496102_0019058 3300048905 Bacteria 6039
365 Ga0496103_0002309 3300048906 Bacteria 12053
366 Ga0496106_0005693 3300048909 Bacteria 9215
367 Ga0496107_0069145 3300048910 Bacteria 2563
368 Ga0496109_0057231 3300048912 Bacteria 3558
369 Ga0496110_0000002 3300048913 Bacteria 166613
370 Ga0496110_0012271 3300048913 Bacteria 7041
371 Ga0496111_0014166 3300048914 Bacteria 5440
372 Ga0496112_0268258 3300048915 Bacteria 1655
373 Ga0496112_0569017 3300048915 Bacteria 1066
374 Ga0496113_0002160 3300048916 Bacteria 11355
375 Ga0496113_0013492 3300048916 Bacteria 5540
376 Ga0496113_0119289 3300048916 Bacteria 2061
377 Ga0496117_0020094 3300048920 Bacteria 5459
378 Ga0496122_0000626 3300048925 Bacteria 72235
379 Ga0496122_0003642 3300048925 Bacteria 20025
380 Ga0496122_0064838 3300048925 Bacteria 2654
381 Ga0496123_0001195 3300048926 Bacteria 38153
382 Ga0496124_0006185 3300048927 Bacteria 13118
383 Ga0496124_0026139 3300048927 Bacteria 5270
384 Ga0496124_0029240 3300048927 Bacteria 4914
385 Ga0496124_0051422 3300048927 Bacteria 3506
386 Ga0496124_0058875 3300048927 Bacteria 3229
387 Ga0496124_0114019 3300048927 Bacteria 2171
388 Ga0496125_0000959 3300048928 Bacteria 45332
389 Ga0496125_0083785 3300048928 Bacteria 2424
390 Ga0495678_000048 3300049459 Bacteria 165744
391 Ga0495682_0000136 3300049460 Bacteria 63989
392 Ga0495682_0014567 3300049460 Bacteria 2981
393 Ga0495682_0021559 3300049460 Bacteria 2413
394 Ga0501034_0289339 3300049571 Bacteria 1577
395 Ga0501036_0095234 3300049572 Bacteria 2517
396 Ga0501047_0146503 3300049581 Bacteria 2238
397 Ga0501241_006955 3300049758 Bacteria 2078
398 Ga0501035_0001065 3300049822 Bacteria 28753
399 Ga0501044_0348876 3300049823 Bacteria 1400
400 2513657856 2513237096 Bacteria 8722461
401 2513855556 2513237137 Bacteria 9558895
402 2513920051 2513237145 Bacteria 8979722
403 2517892101 2517572143 Bacteria 9484767
404 2524534186 2524023228 Bacteria 10118060
405 2643797486 2643221556 Bacteria 7251154
406 2644473972 2643221684 Bacteria 7145183
407 2671121861 2667528175 Bacteria 7532676
408 2738714599 2738541276 Bacteria 4690596
409 2793068814 2791355197 Bacteria 8420563
410 2809143450 2808606418 Bacteria 6724496
411 2885381706 2885374607 Bacteria 8927485
412 2903753483 2903748898 Bacteria 9972761
413 2904702223
414 2906617232
415 2906643379 2906635258 Bacteria 8601019
416 2906662490 2906660503 Bacteria 8595048
417 2908742381 2908739725 Bacteria 8628932
418 2922430597
419 2923527704 2923525760 Bacteria 4472324
420 2935631238 2935630451 Bacteria 8169952
421 2939572125 2939568625 Bacteria 4542555
422 2941509979 2941507105 Bacteria 8166816
423 2941518934 2941515067 Bacteria 8166720
424 2941525378 2941523033 Bacteria 8169134
425 3005480507 3005474847 Bacteria 9259049
426 8006940270 8006933436 Bacteria 10410654
427 8006980048 8006973647 Bacteria 10679141
428 8019556252 8019555841 Bacteria 9642137
429 8047679598 8047673197 Bacteria 7395230
430 Ga0495585_0028540
431 SwRhRL2b_contig_987987
432 rootH2_10092768
433 rootL2_10022850
434 rootH1_10009614
435 rootH1_10105594
436 Ga0070658_10136990
437 Ga0070658_10220618
438 Ga0070680_100036016
439 Ga0070660_100007896
440 Ga0070661_100003703
441 Ga0070659_100015833
442 Ga0070659_100019882
443 Ga0070659_100034790
444 Ga0070709_10022469
445 Ga0070662_100044540
446 Ga0070664_100027983
447 Ga0068856_100368122
448 Ga0105240_10422396
449 Ga0105238_10184024
450 Ga0105239_10375387
451 Ga0157369_10469536
452 Ga0209563_100003
453 Ga0209148_1000859
454 Ga0207705_10002033
455 Ga0207657_10009858
456 Ga0207657_10018842
457 Ga0207657_10197950
458 Ga0207706_10037433
459 Ga0207709_10105316
460 Ga0207667_10049102
461 Ga0207667_10177156
462 Ga0207702_10483949
463 Ga0207698_10220466
464 Ga0209281_1001126
465 Ga0307408_100000493
466 Ga0307408_100503970
467 Ga0307406_10017568
468 Ga0315911_1000006
469 Ga0395899_0000012
470 Ga0395899_0011733
471 Ga0395899_0040278
472 Ga0395900_0000164
473 Ga0395900_0000177
474 Ga0395900_0003029
475 Ga0395900_0009624
476 Ga0395900_0015848
477 Ga0395900_0039749
478 Ga0395900_0118555
479 Ga0395900_0238699
480 Ga0395900_0480065
481 Ga0395898_0035402
482 Ga0395898_0039749
483 Ga0395898_0098783
484 Ga0395898_0101520
485 Ga0395898_0188220
486 Ga0395898_0412481
487 Ga0395905_0021984
488 Ga0395905_0035307
489 Ga0395905_0037497
490 Ga0395901_0000226
491 Ga0395901_0000263
492 Ga0395901_0023316
493 Ga0395901_0065308
494 Ga0395901_0135977
495 Ga0395901_0182157
496 Ga0439448_0025013
497 Ga0439448_0028023
498 Ga0439455_0042858
499 Ga0450891_001733
500 Ga0439458_0006760
501 Ga0466969_0029666
502 Ga0466965_0000437
503 Ga0466965_0018971
504 Ga0466966_0012849
505 Ga0466966_0087622
506 Ga0466961_0045293
507 Ga0466961_0156225
508 Ga0466963_0180371
509 Ga0466964_0021743
510 Ga0466964_0025109
511 Ga0466968_0001513
512 Ga0466970_0133864
513 Ga0466957_0000103
514 Ga0466957_0008628
515 Ga0466957_0053036
516 Ga0466957_0066224
517 Ga0466957_0089255
518 Ga0466959_0037845
519 Ga0466959_0112149
520 Ga0466958_0007110
521 Ga0466958_0024471
522 Ga0466967_0014585
523 Ga0495617_000001
524 Ga0495617_000080
525 Ga0495617_019547
526 Ga0495627_000213
527 Ga0495627_051350
528 Ga0495590_0000015
529 Ga0495590_0000597
530 Ga0495591_000033
531 Ga0495638_0004206
532 Ga0495653_0006375
533 Ga0495653_0040437
534 Ga0495650_0004541
535 Ga0495580_0035823
536 Ga0495582_0149092
537 Ga0495605_0000058
538 Ga0495605_0000227
539 Ga0495605_0005216
540 Ga0495605_0008371
541 Ga0495605_0017780
542 Ga0495605_0025304
543 Ga0495584_0000002
544 Ga0495584_0000090
545 Ga0495584_0000175
546 Ga0495584_0000287
547 Ga0495584_0001763
548 Ga0495584_0004952
549 Ga0495584_0006967
550 Ga0495584_0033889
551 Ga0495584_0037495
552 Ga0495584_0051260
553 Ga0495585_0000003
554 Ga0495585_0000039
555 Ga0495585_0000438
556 Ga0495585_0002941
557 Ga0495585_0003513
558 Ga0495585_0007899
559 Ga0495585_0014306
560 Ga0495585_0020197
561 Ga0495585_0106292
562 Ga0495594_0022661
563 Ga0495594_0045118
564 Ga0495594_0090403
565 Ga0495594_0096111
566 Ga0495596_0000044
567 Ga0495596_0002370
568 Ga0495596_0005140
569 Ga0495596_0009204
570 Ga0495596_0010664
571 Ga0495596_0011425
572 Ga0495596_0011658
573 Ga0495607_0000880
574 Ga0495607_0003837
575 Ga0495607_0005716
576 Ga0495607_0015817
577 Ga0495607_0031906
578 Ga0495607_0053335
579 Ga0495583_0000394
580 Ga0495583_0000617
581 Ga0495583_0000782
582 Ga0495583_0002294
583 Ga0495583_0011991
584 Ga0495583_0027855
585 Ga0495583_0027999
586 Ga0495583_0053201
587 Ga0495583_0133666
588 Ga0495606_0010621
589 Ga0495606_0010984
590 Ga0495606_0015433
591 Ga0495606_0018284
592 Ga0495606_0025105
593 Ga0495606_0046351
594 Ga0495606_0066187
595 Ga0495606_0173307
596 Ga0495606_0241149
597 Ga0495610_0016905
598 Ga0495616_0000123
599 Ga0495616_0000228
600 Ga0495616_0000604
601 Ga0495616_0003387
602 Ga0495616_0006006
603 Ga0495616_0006628
604 Ga0495616_0040322
605 Ga0495616_0129202
606 Ga0495620_0009735
607 Ga0495630_0018404
608 Ga0495631_0003746
609 Ga0495631_0004259
610 Ga0495631_0005736
611 Ga0495631_0006852
612 Ga0495631_0013763
613 Ga0495631_0082299
614 Ga0495631_0086546
615 Ga0495632_0000084
616 Ga0495632_0000221
617 Ga0495632_0000439
618 Ga0495632_0004935
619 Ga0495632_0031458
620 Ga0495637_0000002
621 Ga0495637_0026051
622 Ga0495643_0006329
623 Ga0495643_0011711
624 Ga0495643_0011790
625 Ga0495643_0030684
626 Ga0495644_0005448
627 Ga0495644_0013598
628 Ga0495644_0037122
629 Ga0495648_0000171
630 Ga0495648_0000753
631 Ga0495648_0010222
632 Ga0495648_0025615
633 Ga0495648_0059233
634 Ga0495648_0083842
635 Ga0495663_0031505
636 Ga0495666_0006726
637 Ga0495642_0000072
638 Ga0495642_0001034
639 Ga0495642_0001443
640 Ga0495642_0002405
641 Ga0495642_0002669
642 Ga0495642_0002851
643 Ga0495642_0017181
644 Ga0495642_0093354
645 Ga0495654_0059609
646 Ga0495640_0193811
647 Ga0495587_0002125
648 Ga0495587_0075060
649 Ga0495609_0000001
650 Ga0495609_0000485
651 Ga0495609_0007145
652 Ga0495609_0008276
653 Ga0495609_0008325
654 Ga0495609_0023209
655 Ga0495609_0024042
656 Ga0495609_0027128
657 Ga0495609_0077677
658 Ga0495597_0000255
659 Ga0495597_0001063
660 Ga0495597_0001273
661 Ga0495597_0003193
662 Ga0495597_0025117
663 Ga0495597_0027175
664 Ga0495597_0038704
665 Ga0495645_0276361
666 Ga0495622_0007401
667 Ga0495633_0001846
668 Ga0495633_0006128
669 Ga0495633_0016337
670 Ga0495633_0058399
671 Ga0495633_0096072
672 Ga0495656_0143964
673 Ga0495668_0000052
674 Ga0495668_0003481
675 Ga0495668_0004328
676 Ga0495668_0005023
677 Ga0495668_0017689
678 Ga0495668_0028070
679 Ga0495668_0131185
680 Ga0495634_0070365
681 Ga0495634_0099853
682 Ga0495611_0002096
683 Ga0495611_0009129
684 Ga0495611_0011522
685 Ga0495611_0032904
686 Ga0495611_0040204
687 Ga0495625_0035360
688 Ga0495625_0145029
689 Ga0495661_0000175
690 Ga0495661_0000260
691 Ga0495661_0001113
692 Ga0495661_0001774
693 Ga0495661_0003975
694 Ga0495661_0028935
695 Ga0495661_0038258
696 Ga0495661_0046854
697 Ga0495661_0063805
698 Ga0495661_0092576
699 Ga0495661_0093060
700 Ga0495661_0116664
701 Ga0495588_0000095
702 Ga0495588_0014468
703 Ga0495588_0029143
704 Ga0495588_0052814
705 Ga0495588_0067540
706 Ga0495588_0097592
707 Ga0495623_0005036
708 Ga0495623_0021425
709 Ga0495623_0045948
710 Ga0495669_0005439
711 Ga0495669_0006316
712 Ga0495669_0033259
713 Ga0495670_0011199
714 Ga0495670_0016275
715 Ga0495670_0052480
716 Ga0495671_0001183
717 Ga0495671_0008493
718 Ga0495671_0177716
719 Ga0495649_0000024
720 Ga0495649_0199769
721 Ga0495589_0000029
722 Ga0495589_0000412
723 Ga0495589_0010261
724 Ga0495589_0015247
725 Ga0495589_0032159
726 Ga0495600_0007481
727 Ga0495660_0000033
728 Ga0495660_0001865
729 Ga0495660_0017664
730 Ga0495660_0046101
731 Ga0495660_0065410
732 Ga0495660_0085437
733 Ga0495581_0022805
734 Ga0495581_0058038
735 Ga0495604_0136700
736 Ga0495672_0000179
737 Ga0495672_0000195
738 Ga0495672_0001941
739 Ga0495672_0015802
740 Ga0495672_0035733
741 Ga0495683_0000007
742 Ga0495683_0000017
743 Ga0495683_0003971
744 Ga0495683_0006253
745 Ga0495683_0014237
746 Ga0495683_0030479
747 Ga0495687_000002
748 Ga0495687_000003
749 Ga0495687_000092
750 Ga0495687_000647
751 Ga0495687_001278
752 Ga0495675_0026368
753 Ga0495675_0059834
754 Ga0495675_0105354
755 Ga0495677_0000001
756 Ga0495677_0000523
757 Ga0495677_0000864
758 Ga0495677_0002503
759 Ga0495677_0004784
760 Ga0495677_0025814
761 Ga0495677_0028202
762 Ga0495677_0032670
763 Ga0495677_0134236
764 Ga0495679_005080
765 Ga0495679_009030
766 Ga0495681_0000149
767 Ga0495681_0001984
768 Ga0495681_0004934
769 Ga0495681_0005178
770 Ga0495681_0011303
771 Ga0495681_0039518
772 Ga0495681_0043102
773 Ga0495681_0055099
774 Ga0495686_0000015
775 Ga0495686_0000520
776 Ga0495686_0007096
777 Ga0495593_0005864
778 Ga0495593_0023575
779 Ga0495593_0163131
780 Ga0495602_0037354
781 Ga0495615_0056276
782 Ga0495626_0000018
783 Ga0495626_0000160
784 Ga0495626_0012305
785 Ga0495626_0016034
786 Ga0495626_0022369
787 Ga0495626_0025579
788 Ga0495626_0029762
789 Ga0495626_0049091
790 Ga0495626_0127802
791 Ga0496100_0024427
792 Ga0496102_0000077
793 Ga0496102_0019058
794 Ga0496103_0002309
795 Ga0496106_0005693
796 Ga0496107_0069145
797 Ga0496109_0057231
798 Ga0496110_0000002
799 Ga0496110_0012271
800 Ga0496111_0014166
801 Ga0496112_0268258
802 Ga0496112_0569017
803 Ga0496113_0002160
804 Ga0496113_0013492
805 Ga0496113_0119289
806 Ga0496117_0020094
807 Ga0496122_0000626
808 Ga0496122_0003642
809 Ga0496122_0064838
810 Ga0496123_0001195
811 Ga0496124_0006185
812 Ga0496124_0026139
813 Ga0496124_0029240
814 Ga0496124_0051422
815 Ga0496124_0058875
816 Ga0496124_0114019
817 Ga0496125_0000959
818 Ga0496125_0083785
819 Ga0495678_000048
820 Ga0495682_0000136
821 Ga0495682_0014567
822 Ga0495682_0021559
823 Ga0501034_0289339
824 Ga0501036_0095234
825 Ga0501047_0146503
826 Ga0501241_006955
827 Ga0501035_0001065
828 Ga0501044_0348876
829 2513657856
830 2513855556
831 2513920051
832 2517892101
833 2524534186
834 2643797486
835 2644473972
836 2671121861
837 2738714599
838 2793068814
839 2809143450
840 2885381706
841 2903753483
842 2904702223
843 2906617232
844 2906643379
845 2906662490
846 2908742381
847 2922430597
848 2923527704
849 2935631238
850 2939572125
851 2941509979
852 2941518934
853 2941525378
854 3005480507
855 8006940270
856 8006980048
857 8019556252
858 8047679598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

52

354

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9701 3 299
8iwl-assembly1.cif.gz_A a.baumannii uncharacterized sugar kinase ydjh 0.9682 6 298
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.9656 2 298
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9605 3 299
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.956 2 298
ID Description Score Start End Superfamily
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9435 2 296 3.40.1190.20
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9371 2 296 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.904 2 286 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8678 1 295 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8627 2 286 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A659S5G4-F1-model_v4 Ketodeoxygluconokinase 0.9976 1 212 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A447N253-F1-model_v4 2-dehydro-3-deoxygluconokinase (EC 2.7.1.92) 0.9974 80 228 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
GO:0047590
AF-A0A358L9A9-F1-model_v4 Ketodeoxygluconokinase 0.9953 2 133 GO:0016301
AF-A0A659S5G4-F1-model_v4 Ketodeoxygluconokinase 0.9882 1 212 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A4Q3KCD4-F1-model_v4 deleted 0.9852 2 238

Map