F442010

General Info

Members Datasets Scaffolds Average Seq Length
429 270 842 286

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0122450|Ga0501037_0122450_453_1433
Length 326
Sequence MANRLTTRNASVLMRSKSPAVPVRAADATVNPTATGLMSQQISASLTAILDLEQLEINLFRGRSPKSTWPRVFGGQVIAQALYAACKTVEDRQPHSLHAYFLLPGDPEQPIVYEVDRLRDGRSFTTRRVLAIQKGEAIFAMSASFQVDEPGYEHQMPMPKVPMPEELPDREEMARSILPHMPDAVQAYYQRKRPIEIRPVELERYRTGGKMEPKFNVWIRAMEPLPDEPALHQSVLAYASDLMLLDSSLIAHGTTVFDQKIQGASLDHALWFHRPFRADDWLLYAQDSPSTSGARGFSRGLIFDRQGHLVASVAQEGLIRPRPDRA

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
67 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
122 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
128 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
129 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
132 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
222 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
223 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
233 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
234 2643221582 Rhizobium sp. Root651 Isolate Unclassified
235 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
236 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
237 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
238 2643221733 Bosea sp. Root381 Isolate Unclassified
239 2643221734 Bosea sp. Root670 Isolate Unclassified
240 2643221736 Bosea sp. Root483D1 Isolate Unclassified
241 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
242 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
243 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
244 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
245 2818991467 Bosea vestrisii 3192 Isolate Unclassified
246 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
247 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
248 2841760612 Bosea sp. Tri-49 Isolate Nodule
249 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
250 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
251 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
252 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
253 2844104063 Bosea sp. Tri-39 Isolate Nodule
254 2851182111 Bosea sp. Tri-44 Isolate Nodule
255 2851246043 Bosea sp. Tri-54 Isolate Nodule
256 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
257 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
258 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
259 2902330777 Methylobacterium sp. 2A Isolate Unclassified
260 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
261 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
262 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
263 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
264 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
265 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
266 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
267 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
268 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
269 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
270 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.38
Nodule 2.33
Rhizoplane 2.56
Rhizosphere 55.24
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0122450 3300049573 Bacteria 1869
2 SwRhRL2b_contig_3207873 2162886007 Bacteria 73231
3 JGI25152J39213_1012990 3300002773 Bacteria 1756
4 JGI25150J39212_1000932 3300002774 Bacteria 9468
5 JGI25151J46595_10000264 3300003187 Bacteria 60338
6 JGI25153J46596_10000261 3300003215 Bacteria 42248
7 JGI25153J46596_10028394 3300003215 Bacteria 1940
8 Ga0055526_1002184 3300003771 Bacteria 13409
9 Ga0055526_1002398 3300003771 Bacteria 12694
10 Ga0055526_1003104 3300003771 Bacteria 10780
11 Ga0055526_1025362 3300003771 Bacteria 1904
12 Ga0055537_1000890 3300003773 Bacteria 14167
13 Ga0055524_1000328 3300003775 Bacteria 44226
14 Ga0055530_10000624 3300003791 Bacteria 30595
15 Ga0055530_10010074 3300003791 Bacteria 3545
16 Ga0055531_10003659 3300003794 Bacteria 9694
17 Ga0058692_1002051 3300003856 Bacteria 6966
18 Ga0058692_1003508 3300003856 Bacteria 4836
19 Ga0055543_1008783 3300004625 Bacteria 2215
20 Ga0065165_1001146 3300005262 Bacteria 30997
21 Ga0065704_10070205 3300005289 Bacteria 83747
22 Ga0070658_10236001 3300005327 Bacteria 1549
23 Ga0070658_10347729 3300005327 Bacteria 1269
24 Ga0070683_100104678 3300005329 Bacteria 2667
25 Ga0070670_100098937 3300005331 Bacteria 2510
26 Ga0070670_100255530 3300005331 Bacteria 1527
27 Ga0068869_100096264 3300005334 Bacteria 2234
28 Ga0070680_100022277 3300005336 Bacteria 5043
29 Ga0070660_100290271 3300005339 Bacteria 1339
30 Ga0070668_100001123 3300005347 Bacteria 18826
31 Ga0070668_100001638 3300005347 Bacteria 16225
32 Ga0070668_100011328 3300005347 Bacteria 6643
33 Ga0070668_100016921 3300005347 Bacteria 5455
34 Ga0070668_100023380 3300005347 Bacteria 4674
35 Ga0070668_100028886 3300005347 Bacteria 4209
36 Ga0070668_100108065 3300005347 Bacteria 2212
37 Ga0070669_100011517 3300005353 Bacteria 6277
38 Ga0070669_100092421 3300005353 Bacteria 2271
39 Ga0070671_100010197 3300005355 Bacteria 7541
40 Ga0070671_100042376 3300005355 Bacteria 3783
41 Ga0070671_100044683 3300005355 Bacteria 3682
42 Ga0070671_100362323 3300005355 Bacteria 1238
43 Ga0070667_100004349 3300005367 Bacteria 11952
44 Ga0070667_100079024 3300005367 Bacteria 2811
45 Ga0070667_100394819 3300005367 Bacteria 1258
46 Ga0070708_100173225 3300005445 Bacteria 2016
47 Ga0070663_100308920 3300005455 Bacteria 1268
48 Ga0070678_100248060 3300005456 Bacteria 1492
49 Ga0070681_10032793 3300005458 Bacteria 5215
50 Ga0070685_10006144 3300005466 Bacteria 6116
51 Ga0070707_100125467 3300005468 Bacteria 2494
52 Ga0070698_100164306 3300005471 Bacteria 2163
53 Ga0070665_100001892 3300005548 Bacteria 23690
54 Ga0070665_100089690 3300005548 Bacteria 3080
55 Ga0070665_100291362 3300005548 Bacteria 1635
56 Ga0068855_100074036 3300005563 Bacteria 3956
57 Ga0068855_100131124 3300005563 Bacteria 2863
58 Ga0068857_100035384 3300005577 Bacteria 4423
59 Ga0068859_100000658 3300005617 Bacteria 34599
60 Ga0068859_100014492 3300005617 Bacteria 7915
61 Ga0068861_100247332 3300005719 Bacteria 1520
62 Ga0068861_100494044 3300005719 Bacteria 1105
63 Ga0068863_100051897 3300005841 Bacteria 3886
64 Ga0068863_100097073 3300005841 Bacteria 2798
65 Ga0068863_100101908 3300005841 Bacteria 2730
66 Ga0068858_100007136 3300005842 Bacteria 10853
67 Ga0068858_100317700 3300005842 Bacteria 1488
68 Ga0068860_100000226 3300005843 Bacteria 87552
69 Ga0068860_100009333 3300005843 Bacteria 9746
70 Ga0068860_100032107 3300005843 Bacteria 5048
71 Ga0068860_100055160 3300005843 Bacteria 3777
72 Ga0068860_100118428 3300005843 Bacteria 2535
73 Ga0068860_100221370 3300005843 Bacteria 1838
74 Ga0068862_100019593 3300005844 Bacteria 5649
75 Ga0068862_100027834 3300005844 Bacteria 4761
76 Ga0068862_100039524 3300005844 Bacteria 4007
77 Ga0068862_100067167 3300005844 Unclassified 3091
78 Ga0068862_100070238 3300005844 Bacteria 3023
79 Ga0075365_10021515 3300006038 Bacteria 4025
80 Ga0075365_10029475 3300006038 Bacteria 3509
81 Ga0075368_10003848 3300006042 Bacteria 5049
82 Ga0075368_10019327 3300006042 Bacteria 2570
83 Ga0075363_100016141 3300006048 Bacteria 3684
84 Ga0075364_10009515 3300006051 Bacteria 5833
85 Ga0075364_10050178 3300006051 Bacteria 2723
86 Ga0075367_10022667 3300006178 Bacteria 3525
87 Ga0075367_10217264 3300006178 Bacteria 1196
88 Ga0075369_10048733 3300006186 Bacteria 1829
89 Ga0075366_10042544 3300006195 Bacteria 2689
90 Ga0075370_10094723 3300006353 Bacteria 1724
91 Ga0075431_100012031 3300006847 Bacteria 8732
92 Ga0097620_100000658 3300006931 Bacteria 34599
93 Ga0097620_100014493 3300006931 Bacteria 7915
94 Ga0079104_1005099 3300006946 Bacteria 5350
95 Ga0114129_10004544 3300009147 Bacteria 19590
96 Ga0105243_10006511 3300009148 Bacteria 9029
97 Ga0105248_10002412 3300009177 Bacteria 20747
98 Ga0105248_10009450 3300009177 Bacteria 10736
99 Ga0105248_10493752 3300009177 Bacteria 1380
100 Ga0105248_10501351 3300009177 Bacteria 1369
101 Ga0105238_10060879 3300009551 Bacteria 3779
102 Ga0105249_10114375 3300009553 Bacteria 2555
103 Ga0157373_10017034 3300013100 Bacteria 5291
104 Ga0157371_10000071 3300013102 Bacteria 164088
105 Ga0157370_10000469 3300013104 Bacteria 50288
106 Ga0157370_10064596 3300013104 Bacteria 3465
107 Ga0171462_1039 3300013250 Bacteria 76960
108 Ga0163162_10025487 3300013306 Bacteria 5843
109 Ga0163162_10057911 3300013306 Bacteria 3902
110 Ga0163162_10642822 3300013306 Bacteria 1185
111 Ga0163163_10000747 3300014325 Bacteria 27697
112 Ga0163163_10059174 3300014325 Bacteria 3789
113 Ga0163163_10382251 3300014325 Bacteria 1465
114 Ga0157379_10001591 3300014968 Bacteria 18725
115 Ga0213876_10027051 3300021384 Bacteria 3027
116 Ga0207425_1000026 3300025245 Bacteria 301303
117 Ga0209026_1019155 3300025250 Bacteria 1075
118 Ga0209129_1012684 3300025258 Bacteria 1911
119 Ga0209565_1000099 3300025263 Bacteria 131080
120 Ga0209455_1014554 3300025272 Bacteria 1775
121 Ga0209673_1008011 3300025273 Bacteria 4760
122 Ga0209675_1000542 3300025291 Bacteria 27681
123 Ga0209676_1012822 3300025292 Bacteria 3260
124 Ga0209025_1000357 3300025294 Bacteria 98040
125 Ga0209025_1000876 3300025294 Bacteria 47312
126 Ga0209025_1001416 3300025294 Bacteria 31774
127 Ga0209564_1000580 3300025295 Bacteria 58002
128 Ga0209564_1001189 3300025295 Bacteria 29952
129 Ga0209564_1002538 3300025295 Bacteria 14083
130 Ga0209564_1008684 3300025295 Bacteria 4964
131 Ga0209758_1000004 3300025297 Bacteria 1375322
132 Ga0209758_1001113 3300025297 Bacteria 34600
133 Ga0209050_1000001 3300025298 Bacteria 3563507
134 Ga0209050_1000053 3300025298 Bacteria 349521
135 Ga0209050_1012437 3300025298 Bacteria 3901
136 Ga0209256_1000504 3300025299 Bacteria 57416
137 Ga0209256_1002024 3300025299 Bacteria 18070
138 Ga0209051_1002580 3300025303 Bacteria 12756
139 Ga0209257_1000289 3300025304 Bacteria 110882
140 Ga0209257_1000886 3300025304 Bacteria 42023
141 Ga0209257_1000904 3300025304 Bacteria 41554
142 Ga0209257_1001380 3300025304 Bacteria 29130
143 Ga0209257_1033990 3300025304 Bacteria 1597
144 Ga0207705_10004115 3300025909 Bacteria 11025
145 Ga0207705_10269788 3300025909 Bacteria 1301
146 Ga0207707_10254534 3300025912 Bacteria 1525
147 Ga0207660_10023460 3300025917 Bacteria 4167
148 Ga0207657_10093930 3300025919 Bacteria 2498
149 Ga0207681_10007563 3300025923 Bacteria 6658
150 Ga0207694_10192346 3300025924 Bacteria 1658
151 Ga0207650_10069151 3300025925 Bacteria 2653
152 Ga0207650_10349404 3300025925 Bacteria 1216
153 Ga0207644_10004412 3300025931 Bacteria 9129
154 Ga0207711_10014358 3300025941 Bacteria 6577
155 Ga0207711_10072106 3300025941 Bacteria 2999
156 Ga0207689_10111738 3300025942 Bacteria 2246
157 Ga0207668_10000004 3300025972 Bacteria 201204
158 Ga0207668_10001481 3300025972 Bacteria 13761
159 Ga0207668_10002791 3300025972 Bacteria 10212
160 Ga0207668_10017842 3300025972 Bacteria 4454
161 Ga0207668_10023678 3300025972 Bacteria 3951
162 Ga0207658_10005362 3300025986 Bacteria 8807
163 Ga0207658_10005591 3300025986 Bacteria 8597
164 Ga0207658_10008874 3300025986 Bacteria 6823
165 Ga0207658_10256927 3300025986 Bacteria 1487
166 Ga0207658_10412573 3300025986 Bacteria 1189
167 Ga0207703_10004121 3300026035 Bacteria 12002
168 Ga0207703_10494420 3300026035 Bacteria 1147
169 Ga0207678_10261044 3300026067 Bacteria 1484
170 Ga0207641_10008426 3300026088 Bacteria 8522
171 Ga0207641_10238452 3300026088 Bacteria 1693
172 Ga0207674_10034116 3300026116 Bacteria 5322
173 Ga0207675_100094628 3300026118 Bacteria 2810
174 Ga0209813_10002297 3300027866 Bacteria 4373
175 Ga0268266_10001109 3300028379 Bacteria 33675
176 Ga0268266_10019125 3300028379 Bacteria 5833
177 Ga0268266_10057888 3300028379 Bacteria 3336
178 Ga0268266_10347101 3300028379 Bacteria 1394
179 Ga0268265_10001407 3300028380 Bacteria 20383
180 Ga0268265_10004953 3300028380 Bacteria 9153
181 Ga0268265_10005526 3300028380 Bacteria 8627
182 Ga0268265_10026703 3300028380 Bacteria 4110
183 Ga0268265_10070094 3300028380 Unclassified 2725
184 Ga0268264_10000110 3300028381 Bacteria 206663
185 Ga0268264_10018237 3300028381 Bacteria 5740
186 Ga0268264_10026710 3300028381 Bacteria 4717
187 Ga0268264_10027816 3300028381 Bacteria 4622
188 Ga0307517_10082791 3300028786 Bacteria 2720
189 Ga0316181_1224315 3300030744 Bacteria 1995
190 Ga0265330_10029002 3300031235 Bacteria 2490
191 Ga0265325_10036525 3300031241 Bacteria 2601
192 Ga0265340_10031391 3300031247 Bacteria 2657
193 Ga0265339_10017978 3300031249 Bacteria 4178
194 Ga0265316_10216922 3300031344 Bacteria 1413
195 Ga0307513_10107446 3300031456 Bacteria 2793
196 Ga0307408_100425565 3300031548 Bacteria 1146
197 Ga0316579_10142186 3300031691 Bacteria 1157
198 Ga0307516_10000144 3300031730 Bacteria 87138
199 Ga0307516_10034353 3300031730 Bacteria 5096
200 Ga0307405_10137665 3300031731 Bacteria 1697
201 Ga0307413_10018232 3300031824 Bacteria 3677
202 Ga0307413_10098871 3300031824 Bacteria 1922
203 Ga0307406_10068090 3300031901 Bacteria 2323
204 Ga0307406_10266415 3300031901 Bacteria 1299
205 Ga0307412_10038555 3300031911 Bacteria 3078
206 Ga0307412_10243965 3300031911 Bacteria 1391
207 Ga0307409_100005787 3300031995 Bacteria 7172
208 Ga0307416_100008416 3300032002 Bacteria 6655
209 Ga0307411_10287209 3300032005 Bacteria 1312
210 Ga0307415_100033785 3300032126 Bacteria 3322
211 Ga0316583_10010825 3300032133 Bacteria 3286
212 Ga0316582_0004977 3300036647 Bacteria 6792
213 Ga0316582_0093480 3300036647 Bacteria 1983
214 Ga0395899_0093276 3300037312 Bacteria 2179
215 Ga0395900_0370868 3300037418 Bacteria 1401
216 Ga0395898_0479166 3300037466 Bacteria 1184
217 Ga0395905_0553231 3300037471 Bacteria 1052
218 Ga0400490_05156 3300038726 Bacteria 1452
219 Ga0400485_06020 3300038735 Bacteria 6122
220 Ga0400485_06120 3300038735 Bacteria 2517
221 Ga0400486_02593 3300038742 Bacteria 1055
222 Ga0400486_17076 3300038742 Bacteria 1221
223 Ga0400483_031057 3300039062 Bacteria 31352
224 Ga0400483_050651 3300039062 Bacteria 141074
225 Ga0400483_130318 3300039062 Bacteria 2234
226 Ga0400483_158996 3300039062 Bacteria 61601
227 Ga0400483_258337 3300039062 Bacteria 4203
228 Ga0400487_50195 3300039110 Bacteria 1167
229 Ga0237816_01086 3300039145 Bacteria 2241
230 Ga0436365_1315004 3300039437 Bacteria 11359
231 Ga0436365_1893014 3300039437 Bacteria 2204
232 Ga0436360_0488300 3300039438 Bacteria 1001
233 Ga0436360_1178867 3300039438 Bacteria 1276
234 Ga0439432_061796 3300042006 Bacteria 1154
235 Ga0451577_0213778 3300042876 Bacteria 1742
236 Ga0466972_0152984 3300044658 Bacteria 1084
237 Ga0451576_0367502 3300045051 Bacteria 1507
238 Ga0495641_0111783 3300046461 Bacteria 1219
239 Ga0495596_0000042 3300046500 Bacteria 90746
240 Ga0495607_0090881 3300046501 Bacteria 1654
241 Ga0495583_0033521 3300046506 Bacteria 2470
242 Ga0495606_0028090 3300046507 Bacteria 3974
243 Ga0495610_0000300 3300046512 Bacteria 52078
244 Ga0495630_0427132 3300046517 Bacteria 1015
245 Ga0495632_0011036 3300046519 Bacteria 5294
246 Ga0495643_0000023 3300046522 Bacteria 288590
247 Ga0495643_0013294 3300046522 Bacteria 4931
248 Ga0495643_0102621 3300046522 Bacteria 1464
249 Ga0495648_0153807 3300046524 Bacteria 1197
250 Ga0495642_0002683 3300046528 Bacteria 7154
251 Ga0495609_0001629 3300046538 Bacteria 14639
252 Ga0495633_0057236 3300046558 Bacteria 1831
253 Ga0495633_0090044 3300046558 Bacteria 1426
254 Ga0495668_0048879 3300046616 Bacteria 2346
255 Ga0495625_0169899 3300046660 Bacteria 1456
256 Ga0495588_0001641 3300046674 Bacteria 9578
257 Ga0495658_0021130 3300046683 Bacteria 3428
258 Ga0495669_0033311 3300046684 Bacteria 2267
259 Ga0495672_0009946 3300047320 Bacteria 6829
260 Ga0495681_0003590 3300047470 Bacteria 10800
261 Ga0495686_0000179 3300047472 Bacteria 121257
262 Ga0496102_0384196 3300048905 Bacteria 1321
263 Ga0496104_0123140 3300048907 Bacteria 2489
264 Ga0496105_0014430 3300048908 Bacteria 6289
265 Ga0496106_0045582 3300048909 Bacteria 3294
266 Ga0496107_0062246 3300048910 Bacteria 2703
267 Ga0496108_0110855 3300048911 Bacteria 2346
268 Ga0496109_0002923 3300048912 Bacteria 14283
269 Ga0496111_0093404 3300048914 Bacteria 2205
270 Ga0496113_0002252 3300048916 Bacteria 11123
271 Ga0496113_0442484 3300048916 Unclassified 1044
272 Ga0496114_0230758 3300048917 Bacteria 1626
273 Ga0496116_0024666 3300048919 Bacteria 4440
274 Ga0496116_0043055 3300048919 Bacteria 3079
275 Ga0496116_0056726 3300048919 Bacteria 2565
276 Ga0496117_0000031 3300048920 Bacteria 381048
277 Ga0496117_0031629 3300048920 Bacteria 4036
278 Ga0496117_0066283 3300048920 Bacteria 2450
279 Ga0496117_0087933 3300048920 Bacteria 2012
280 Ga0496118_0003281 3300048921 Bacteria 20588
281 Ga0496118_0048853 3300048921 Bacteria 3263
282 Ga0496118_0057855 3300048921 Bacteria 2902
283 Ga0496118_0153806 3300048921 Bacteria 1435
284 Ga0496119_0015159 3300048922 Bacteria 5964
285 Ga0496119_0134549 3300048922 Bacteria 1342
286 Ga0496120_0001350 3300048923 Bacteria 30183
287 Ga0496121_0000034 3300048924 Bacteria 377095
288 Ga0496121_0002352 3300048924 Bacteria 29158
289 Ga0496122_0000023 3300048925 Bacteria 381035
290 Ga0496122_0027234 3300048925 Bacteria 4893
291 Ga0496122_0030428 3300048925 Bacteria 4522
292 Ga0496122_0069829 3300048925 Bacteria 2513
293 Ga0496123_0000027 3300048926 Bacteria 306773
294 Ga0496123_0050371 3300048926 Bacteria 2782
295 Ga0496123_0107129 3300048926 Bacteria 1608
296 Ga0496124_0001510 3300048927 Bacteria 33896
297 Ga0496124_0100339 3300048927 Bacteria 2347
298 Ga0496124_0163346 3300048927 Bacteria 1733
299 Ga0496125_0000030 3300048928 Bacteria 375023
300 Ga0496125_0077610 3300048928 Bacteria 2559
301 Ga0496125_0094202 3300048928 Bacteria 2232
302 Ga0496126_0010282 3300048929 Bacteria 9828
303 Ga0496126_0129714 3300048929 Bacteria 2179
304 Ga0496126_0132006 3300048929 Bacteria 2157
305 Ga0501031_0006029 3300049568 Bacteria 7910
306 Ga0501032_0000963 3300049569 Bacteria 23274
307 Ga0501032_0068818 3300049569 Bacteria 2362
308 Ga0501033_0020652 3300049570 Bacteria 4975
309 Ga0501033_0083359 3300049570 Unclassified 2344
310 Ga0501034_0072774 3300049571 Bacteria 3445
311 Ga0501036_0013264 3300049572 Bacteria 6841
312 Ga0501036_0081088 3300049572 Bacteria 2742
313 Ga0501036_0110096 3300049572 Unclassified 2327
314 Ga0501037_0003690 3300049573 Bacteria 11112
315 Ga0501039_0248614 3300049575 Bacteria 1398
316 Ga0501040_0003420 3300049576 Bacteria 10240
317 Ga0501041_0014887 3300049577 Bacteria 4618
318 Ga0501043_0007340 3300049579 Bacteria 8746
319 Ga0501046_0014955 3300049580 Bacteria 6530
320 Ga0501046_0142353 3300049580 Bacteria 1814
321 Ga0501047_0002080 3300049581 Bacteria 19159
322 Ga0501047_0002719 3300049581 Bacteria 16836
323 Ga0501047_0122485 3300049581 Bacteria 2481
324 Ga0501047_0170344 3300049581 Bacteria 2046
325 Ga0501048_0037541 3300049582 Bacteria 3479
326 Ga0501048_0389361 3300049582 Bacteria 996
327 Ga0501067_0000195 3300049583 Bacteria 34241
328 Ga0501068_0004627 3300049584 Bacteria 7488
329 Ga0501070_0028965 3300049586 Bacteria 4643
330 Ga0501071_0213689 3300049587 Unclassified 1451
331 Ga0501072_0001451 3300049588 Bacteria 17775
332 Ga0501072_0042801 3300049588 Bacteria 3558
333 Ga0501073_0000006 3300049589 Bacteria 228761
334 Ga0501074_0139308 3300049590 Unclassified 1735
335 Ga0501076_0056177 3300049592 Bacteria 3123
336 Ga0501077_0001822 3300049593 Bacteria 12878
337 Ga0501079_0005626 3300049741 Bacteria 9353
338 Ga0501080_0000589 3300049742 Bacteria 28663
339 Ga0501080_0054835 3300049742 Bacteria 3712
340 Ga0501081_0009823 3300049743 Bacteria 6234
341 Ga0501083_0140753 3300049744 Bacteria 1580
342 Ga0501044_0033902 3300049823 Bacteria 5360
343 Ga0501044_0320382 3300049823 Bacteria 1475
344 nmdc:mga03683_137600_c1 3300050489 Bacteria 1096
345 nmdc:mga03683_55886_c1 3300050489 Bacteria 1659
346 nmdc:mga03n38_29133_c1 3300050490 Bacteria 2308
347 nmdc:mga00v17_114681_c1 3300050491 Bacteria 1712
348 nmdc:mga00v17_1583_c1 3300050491 Bacteria 11891
349 nmdc:mga00v17_237596_c1 3300050491 Bacteria 1181
350 nmdc:mga00v17_314072_c1 3300050491 Bacteria 1018
351 nmdc:mga00v17_545_c1 3300050491 Bacteria 21081
352 nmdc:mga0k408_71936_c1 3300050493 Bacteria 2019
353 nmdc:mga06z11_19439_c1 3300050494 Bacteria 3123
354 nmdc:mga06z11_259726_c1 3300050494 Bacteria 1025
355 nmdc:mga04h51_663_c1 3300050495 Bacteria 6114
356 nmdc:mga04h51_84992_c1 3300050495 Bacteria 1130
357 nmdc:mga07m45_129397_c1 3300050496 Bacteria 1461
358 nmdc:mga07m45_35298_c1 3300050496 Bacteria 2781
359 nmdc:mga05p37_147130_c1 3300050507 Bacteria 2883
360 nmdc:mga09592_39532_c1 3300050508 Bacteria 3962
361 nmdc:mga06r32_3405_c1 3300050510 Bacteria 14228
362 nmdc:mga0sz30_20411_c1 3300050516 Bacteria 2672
363 nmdc:mga0sz30_5256_c1 3300050516 Bacteria 3112
364 nmdc:mga0sz30_551_c1 3300050516 Bacteria 13992
365 Ga0500643_020974 3300053087 Bacteria 2125
366 Ga0500654_093594 3300053099 Bacteria 1323
367 Ga0500555_004927 3300053103 Bacteria 3786
368 Ga0500560_004380 3300053107 Bacteria 2995
369 Ga0500561_0000030 3300053137 Bacteria 29291
370 Ga0500568_0005085 3300053139 Bacteria 6878
371 Ga0500568_0122242 3300053139 Bacteria 970
372 Ga0500573_0003809 3300053140 Bacteria 7865
373 Ga0500573_0060399 3300053140 Bacteria 2171
374 Ga0500616_0099208 3300053153 Bacteria 1427
375 Ga0500624_005513 3300053157 Bacteria 1684
376 Ga0500634_0021833 3300053161 Bacteria 3470
377 Ga0500636_0000040 3300053177 Bacteria 69881
378 Ga0500636_0047646 3300053177 Bacteria 2524
379 Ga0501084_0123489 3300054114 Unclassified 2178
380 Ga0501084_0238344 3300054114 Unclassified 1535
381 Ga0501082_0392992 3300060353 Bacteria 1210
382 Ga0530510_0010711 3300061734 Bacteria 6432
383 2511130997 2510917021 Bacteria 5705459
384 2596372620 2595698237 Bacteria 6712432
385 2643921529 2643221582 Bacteria 5804683
386 2644087778 2643221614 Bacteria 4260023
387 2644345382 2643221661 Bacteria 4267604
388 2644367134 2643221666 Bacteria 4265935
389 2644730992 2643221733 Bacteria 5690728
390 2644734652 2643221734 Bacteria 5365412
391 2644746459 2643221736 Bacteria 6608466
392 2738747215 2738541281 Bacteria 5112672
393 2738947022 2738541317 Bacteria 5340176
394 2739356444 2738543032 Bacteria 5115625
395 2819561015 2818991439 Bacteria 6907412
396 2819722232 2818991467 Bacteria 5893227
397 2824666047 2824661429 Bacteria 9877870
398 2829748513 2829745981 Bacteria 5406054
399 2841765024 2841760612 Bacteria 6454112
400 2841850468 2841846520 Bacteria 5345850
401 2841912497 2841911363 Bacteria 6173697
402 2841918252 2841917233 Bacteria 6173500
403 2842129022 2842124991 Bacteria 5346824
404 2844105619 2844104063 Bacteria 6440972
405 2851183889 2851182111 Bacteria 6047226
406 2851249634 2851246043 Bacteria 6439203
407 2861692077 2861691609 Bacteria 5628931
408 2889308369 2889306138 Bacteria 6358934
409 2899849355 2899845264 Bacteria 5672268
410 2902331314 2902330777 Bacteria 6395352
411 2902410747 2902405164 Bacteria 6784948
412 2913312151 2913308742 Bacteria 5350706
413 2917703063 2917699015 Bacteria 7043791
414 2919118447 2919114240 Bacteria 5700270
415 2928127585 2928125067 Bacteria 5937560
416 8003573718 8003570095 Bacteria 5747666
417 8005660832 8005658619 Bacteria 4500593
418 8033233392 8033232454 Bacteria 3202805
419 8054306203 8054302542 Bacteria 5698134
420 8055435551 8055431914 Bacteria 4551896
421 8057532943 8057529695 Bacteria 6306553
422 Ga0501037_0122450
423 SwRhRL2b_contig_3207873
424 JGI25152J39213_1012990
425 JGI25150J39212_1000932
426 JGI25151J46595_10000264
427 JGI25153J46596_10000261
428 JGI25153J46596_10028394
429 Ga0055526_1002184
430 Ga0055526_1002398
431 Ga0055526_1003104
432 Ga0055526_1025362
433 Ga0055537_1000890
434 Ga0055524_1000328
435 Ga0055530_10000624
436 Ga0055530_10010074
437 Ga0055531_10003659
438 Ga0058692_1002051
439 Ga0058692_1003508
440 Ga0055543_1008783
441 Ga0065165_1001146
442 Ga0065704_10070205
443 Ga0070658_10236001
444 Ga0070658_10347729
445 Ga0070683_100104678
446 Ga0070670_100098937
447 Ga0070670_100255530
448 Ga0068869_100096264
449 Ga0070680_100022277
450 Ga0070660_100290271
451 Ga0070668_100001123
452 Ga0070668_100001638
453 Ga0070668_100011328
454 Ga0070668_100016921
455 Ga0070668_100023380
456 Ga0070668_100028886
457 Ga0070668_100108065
458 Ga0070669_100011517
459 Ga0070669_100092421
460 Ga0070671_100010197
461 Ga0070671_100042376
462 Ga0070671_100044683
463 Ga0070671_100362323
464 Ga0070667_100004349
465 Ga0070667_100079024
466 Ga0070667_100394819
467 Ga0070708_100173225
468 Ga0070663_100308920
469 Ga0070678_100248060
470 Ga0070681_10032793
471 Ga0070685_10006144
472 Ga0070707_100125467
473 Ga0070698_100164306
474 Ga0070665_100001892
475 Ga0070665_100089690
476 Ga0070665_100291362
477 Ga0068855_100074036
478 Ga0068855_100131124
479 Ga0068857_100035384
480 Ga0068859_100000658
481 Ga0068859_100014492
482 Ga0068861_100247332
483 Ga0068861_100494044
484 Ga0068863_100051897
485 Ga0068863_100097073
486 Ga0068863_100101908
487 Ga0068858_100007136
488 Ga0068858_100317700
489 Ga0068860_100000226
490 Ga0068860_100009333
491 Ga0068860_100032107
492 Ga0068860_100055160
493 Ga0068860_100118428
494 Ga0068860_100221370
495 Ga0068862_100019593
496 Ga0068862_100027834
497 Ga0068862_100039524
498 Ga0068862_100067167
499 Ga0068862_100070238
500 Ga0075365_10021515
501 Ga0075365_10029475
502 Ga0075368_10003848
503 Ga0075368_10019327
504 Ga0075363_100016141
505 Ga0075364_10009515
506 Ga0075364_10050178
507 Ga0075367_10022667
508 Ga0075367_10217264
509 Ga0075369_10048733
510 Ga0075366_10042544
511 Ga0075370_10094723
512 Ga0075431_100012031
513 Ga0097620_100000658
514 Ga0097620_100014493
515 Ga0079104_1005099
516 Ga0114129_10004544
517 Ga0105243_10006511
518 Ga0105248_10002412
519 Ga0105248_10009450
520 Ga0105248_10493752
521 Ga0105248_10501351
522 Ga0105238_10060879
523 Ga0105249_10114375
524 Ga0157373_10017034
525 Ga0157371_10000071
526 Ga0157370_10000469
527 Ga0157370_10064596
528 Ga0171462_1039
529 Ga0163162_10025487
530 Ga0163162_10057911
531 Ga0163162_10642822
532 Ga0163163_10000747
533 Ga0163163_10059174
534 Ga0163163_10382251
535 Ga0157379_10001591
536 Ga0213876_10027051
537 Ga0207425_1000026
538 Ga0209026_1019155
539 Ga0209129_1012684
540 Ga0209565_1000099
541 Ga0209455_1014554
542 Ga0209673_1008011
543 Ga0209675_1000542
544 Ga0209676_1012822
545 Ga0209025_1000357
546 Ga0209025_1000876
547 Ga0209025_1001416
548 Ga0209564_1000580
549 Ga0209564_1001189
550 Ga0209564_1002538
551 Ga0209564_1008684
552 Ga0209758_1000004
553 Ga0209758_1001113
554 Ga0209050_1000001
555 Ga0209050_1000053
556 Ga0209050_1012437
557 Ga0209256_1000504
558 Ga0209256_1002024
559 Ga0209051_1002580
560 Ga0209257_1000289
561 Ga0209257_1000886
562 Ga0209257_1000904
563 Ga0209257_1001380
564 Ga0209257_1033990
565 Ga0207705_10004115
566 Ga0207705_10269788
567 Ga0207707_10254534
568 Ga0207660_10023460
569 Ga0207657_10093930
570 Ga0207681_10007563
571 Ga0207694_10192346
572 Ga0207650_10069151
573 Ga0207650_10349404
574 Ga0207644_10004412
575 Ga0207711_10014358
576 Ga0207711_10072106
577 Ga0207689_10111738
578 Ga0207668_10000004
579 Ga0207668_10001481
580 Ga0207668_10002791
581 Ga0207668_10017842
582 Ga0207668_10023678
583 Ga0207658_10005362
584 Ga0207658_10005591
585 Ga0207658_10008874
586 Ga0207658_10256927
587 Ga0207658_10412573
588 Ga0207703_10004121
589 Ga0207703_10494420
590 Ga0207678_10261044
591 Ga0207641_10008426
592 Ga0207641_10238452
593 Ga0207674_10034116
594 Ga0207675_100094628
595 Ga0209813_10002297
596 Ga0268266_10001109
597 Ga0268266_10019125
598 Ga0268266_10057888
599 Ga0268266_10347101
600 Ga0268265_10001407
601 Ga0268265_10004953
602 Ga0268265_10005526
603 Ga0268265_10026703
604 Ga0268265_10070094
605 Ga0268264_10000110
606 Ga0268264_10018237
607 Ga0268264_10026710
608 Ga0268264_10027816
609 Ga0307517_10082791
610 Ga0316181_1224315
611 Ga0265330_10029002
612 Ga0265325_10036525
613 Ga0265340_10031391
614 Ga0265339_10017978
615 Ga0265316_10216922
616 Ga0307513_10107446
617 Ga0307408_100425565
618 Ga0316579_10142186
619 Ga0307516_10000144
620 Ga0307516_10034353
621 Ga0307405_10137665
622 Ga0307413_10018232
623 Ga0307413_10098871
624 Ga0307406_10068090
625 Ga0307406_10266415
626 Ga0307412_10038555
627 Ga0307412_10243965
628 Ga0307409_100005787
629 Ga0307416_100008416
630 Ga0307411_10287209
631 Ga0307415_100033785
632 Ga0316583_10010825
633 Ga0316582_0004977
634 Ga0316582_0093480
635 Ga0395899_0093276
636 Ga0395900_0370868
637 Ga0395898_0479166
638 Ga0395905_0553231
639 Ga0400490_05156
640 Ga0400485_06020
641 Ga0400485_06120
642 Ga0400486_02593
643 Ga0400486_17076
644 Ga0400483_031057
645 Ga0400483_050651
646 Ga0400483_130318
647 Ga0400483_158996
648 Ga0400483_258337
649 Ga0400487_50195
650 Ga0237816_01086
651 Ga0436365_1315004
652 Ga0436365_1893014
653 Ga0436360_0488300
654 Ga0436360_1178867
655 Ga0439432_061796
656 Ga0451577_0213778
657 Ga0466972_0152984
658 Ga0451576_0367502
659 Ga0495641_0111783
660 Ga0495596_0000042
661 Ga0495607_0090881
662 Ga0495583_0033521
663 Ga0495606_0028090
664 Ga0495610_0000300
665 Ga0495630_0427132
666 Ga0495632_0011036
667 Ga0495643_0000023
668 Ga0495643_0013294
669 Ga0495643_0102621
670 Ga0495648_0153807
671 Ga0495642_0002683
672 Ga0495609_0001629
673 Ga0495633_0057236
674 Ga0495633_0090044
675 Ga0495668_0048879
676 Ga0495625_0169899
677 Ga0495588_0001641
678 Ga0495658_0021130
679 Ga0495669_0033311
680 Ga0495672_0009946
681 Ga0495681_0003590
682 Ga0495686_0000179
683 Ga0496102_0384196
684 Ga0496104_0123140
685 Ga0496105_0014430
686 Ga0496106_0045582
687 Ga0496107_0062246
688 Ga0496108_0110855
689 Ga0496109_0002923
690 Ga0496111_0093404
691 Ga0496113_0002252
692 Ga0496113_0442484
693 Ga0496114_0230758
694 Ga0496116_0024666
695 Ga0496116_0043055
696 Ga0496116_0056726
697 Ga0496117_0000031
698 Ga0496117_0031629
699 Ga0496117_0066283
700 Ga0496117_0087933
701 Ga0496118_0003281
702 Ga0496118_0048853
703 Ga0496118_0057855
704 Ga0496118_0153806
705 Ga0496119_0015159
706 Ga0496119_0134549
707 Ga0496120_0001350
708 Ga0496121_0000034
709 Ga0496121_0002352
710 Ga0496122_0000023
711 Ga0496122_0027234
712 Ga0496122_0030428
713 Ga0496122_0069829
714 Ga0496123_0000027
715 Ga0496123_0050371
716 Ga0496123_0107129
717 Ga0496124_0001510
718 Ga0496124_0100339
719 Ga0496124_0163346
720 Ga0496125_0000030
721 Ga0496125_0077610
722 Ga0496125_0094202
723 Ga0496126_0010282
724 Ga0496126_0129714
725 Ga0496126_0132006
726 Ga0501031_0006029
727 Ga0501032_0000963
728 Ga0501032_0068818
729 Ga0501033_0020652
730 Ga0501033_0083359
731 Ga0501034_0072774
732 Ga0501036_0013264
733 Ga0501036_0081088
734 Ga0501036_0110096
735 Ga0501037_0003690
736 Ga0501039_0248614
737 Ga0501040_0003420
738 Ga0501041_0014887
739 Ga0501043_0007340
740 Ga0501046_0014955
741 Ga0501046_0142353
742 Ga0501047_0002080
743 Ga0501047_0002719
744 Ga0501047_0122485
745 Ga0501047_0170344
746 Ga0501048_0037541
747 Ga0501048_0389361
748 Ga0501067_0000195
749 Ga0501068_0004627
750 Ga0501070_0028965
751 Ga0501071_0213689
752 Ga0501072_0001451
753 Ga0501072_0042801
754 Ga0501073_0000006
755 Ga0501074_0139308
756 Ga0501076_0056177
757 Ga0501077_0001822
758 Ga0501079_0005626
759 Ga0501080_0000589
760 Ga0501080_0054835
761 Ga0501081_0009823
762 Ga0501083_0140753
763 Ga0501044_0033902
764 Ga0501044_0320382
765 nmdc:mga03683_137600_c1
766 nmdc:mga03683_55886_c1
767 nmdc:mga03n38_29133_c1
768 nmdc:mga00v17_114681_c1
769 nmdc:mga00v17_1583_c1
770 nmdc:mga00v17_237596_c1
771 nmdc:mga00v17_314072_c1
772 nmdc:mga00v17_545_c1
773 nmdc:mga0k408_71936_c1
774 nmdc:mga06z11_19439_c1
775 nmdc:mga06z11_259726_c1
776 nmdc:mga04h51_663_c1
777 nmdc:mga04h51_84992_c1
778 nmdc:mga07m45_129397_c1
779 nmdc:mga07m45_35298_c1
780 nmdc:mga05p37_147130_c1
781 nmdc:mga09592_39532_c1
782 nmdc:mga06r32_3405_c1
783 nmdc:mga0sz30_20411_c1
784 nmdc:mga0sz30_5256_c1
785 nmdc:mga0sz30_551_c1
786 Ga0500643_020974
787 Ga0500654_093594
788 Ga0500555_004927
789 Ga0500560_004380
790 Ga0500561_0000030
791 Ga0500568_0005085
792 Ga0500568_0122242
793 Ga0500573_0003809
794 Ga0500573_0060399
795 Ga0500616_0099208
796 Ga0500624_005513
797 Ga0500634_0021833
798 Ga0500636_0000040
799 Ga0500636_0047646
800 Ga0501084_0123489
801 Ga0501084_0238344
802 Ga0501082_0392992
803 Ga0530510_0010711
804 2511130997
805 2596372620
806 2643921529
807 2644087778
808 2644345382
809 2644367134
810 2644730992
811 2644734652
812 2644746459
813 2738747215
814 2738947022
815 2739356444
816 2819561015
817 2819722232
818 2824666047
819 2829748513
820 2841765024
821 2841850468
822 2841912497
823 2841918252
824 2842129022
825 2844105619
826 2851183889
827 2851249634
828 2861692077
829 2889308369
830 2899849355
831 2902331314
832 2902410747
833 2913312151
834 2917703063
835 2919118447
836 2928127585
837 8003573718
838 8005660832
839 8033233392
840 8054306203
841 8055435551
842 8057532943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

185

318

0.95

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

65

146

0.95

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

161

319

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r9z-assembly1.cif.gz_B mycobacterium avium subs paratuberculosis tesb protein map1729c 0.9494 11 283
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.9434 19 118
4r9z-assembly1.cif.gz_B mycobacterium avium subs paratuberculosis tesb protein map1729c 0.9384 11 283
3u0a-assembly1.cif.gz_B crystal structure of an acyl-coa thioesterase ii tesb2 from mycobacterium marinum 0.9328 14 287
4r4u-assembly2.cif.gz_C crystal structure of acyl-coa thioesterase tesb from yersinia pestis in complex with coenzyme a 0.9303 11 285
ID Description Score Start End Superfamily
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9776 10 123 3.10.129.10
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.961 10 123 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9434 19 118 3.10.129.10
4gwhA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9278 12 285 2.40.160.210
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9246 19 118 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A376ZMF1-F1-model_v4 Acyl-CoA thioesterase (EC 3.1.2.-) 0.9808 181 285 GO:0005829
GO:0006637
GO:0009062
GO:0047617
AF-A0A3D2S1K8-F1-model_v4 Acyl-CoA thioesterase II 0.9773 207 285 GO:0005829
GO:0006637
GO:0009062
GO:0047617
AF-A0A1C4SF76-F1-model_v4 Acyl-CoA thioesterase-2 0.9741 9 110 GO:0006637
GO:0009062
GO:0047617
AF-A0A1S8XPV3-F1-model_v4 Acyl-CoA thioesterase II 0.9669 9 133 GO:0006637
GO:0009062
GO:0047617
AF-A0A7W1SUA0-F1-model_v4 Thioesterase family protein 0.9579 9 148 GO:0006637
GO:0009062
GO:0047617

Map