F442048

General Info

Members Datasets Scaffolds Average Seq Length
430 241 430 273

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1009174|LJNas_10091741
Length 292
Sequence LVNKLDLSLSRKEIHLMRIKSLAIAVIALAGLAVPASANAITLIGSGSVAAQPVLQALFATYTKQVNKKVHFVYTANGGNAGVKDVQNGTSQFAGNARTPLPSDAGTTYIKMFMDGLCLDVNPKNKLNNITIQQAHDIYRGILTNWSQLPGSGLDTTIDPVGRDTNGGTYNFFLQAVLNNEAPASNVNALTADGLVVNAVKQDPNAIGYDGLAWQGPGQKALKVNGVPCTPSKISVEPLKYPLSRYLFIVLPGDGSTSPPALTKFIDWMRLSPLAGEVISKAGGVPAFNKKK

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
235 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
241 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0
Rhizoplane 12.33
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 4.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1009174 3300000546 Bacteria 1060
2 JGI24746J21847_1000135 3300001977 Bacteria 9073
3 JGI24740J21852_10011283 3300001979 Bacteria 3406
4 JGI25404J52841_10002306 3300003659 Unclassified 3590
5 Ga0070683_100011794 3300005329 Bacteria 7570
6 Ga0070683_100040550 3300005329 Bacteria 4282
7 Ga0070683_100106142 3300005329 Bacteria 2648
8 Ga0070683_100227072 3300005329 Bacteria 1775
9 Ga0070677_10000001 3300005333 Bacteria 118426
10 Ga0070666_10014197 3300005335 Bacteria 5069
11 Ga0070666_10034875 3300005335 Bacteria 3335
12 Ga0070666_10058477 3300005335 Bacteria 2607
13 Ga0070682_100000028 3300005337 Bacteria 185177
14 Ga0070682_100000049 3300005337 Bacteria 127229
15 Ga0070682_100074835 3300005337 Bacteria 2176
16 Ga0068868_100004032 3300005338 Bacteria 10238
17 Ga0068868_100028634 3300005338 Bacteria 4261
18 Ga0070691_10000001 3300005341 Bacteria 94744
19 Ga0070691_10001179 3300005341 Bacteria 10941
20 Ga0070661_100000226 3300005344 Bacteria 46716
21 Ga0070692_10058081 3300005345 Bacteria 2031
22 Ga0070668_100125406 3300005347 Bacteria 2056
23 Ga0070673_100002074 3300005364 Bacteria 12077
24 Ga0070688_100000345 3300005365 Bacteria 23573
25 Ga0070659_100003813 3300005366 Bacteria 10755
26 Ga0070667_100009366 3300005367 Bacteria 8119
27 Ga0070667_100125244 3300005367 Unclassified 2239
28 Ga0070667_100132341 3300005367 Bacteria 2178
29 Ga0070667_100177294 3300005367 Bacteria 1884
30 Ga0070713_100023462 3300005436 Bacteria 4788
31 Ga0070701_10035432 3300005438 Unclassified 2507
32 Ga0070711_100015025 3300005439 Bacteria 4893
33 Ga0070663_100364652 3300005455 Bacteria 1173
34 Ga0070678_100008325 3300005456 Bacteria 6210
35 Ga0070678_100297655 3300005456 Unclassified 1370
36 Ga0070678_100379934 3300005456 Bacteria 1222
37 Ga0068867_100000145 3300005459 Bacteria 45547
38 Ga0070685_10000025 3300005466 Bacteria 100621
39 Ga0070684_100041058 3300005535 Bacteria 3986
40 Ga0070684_100279341 3300005535 Bacteria 1530
41 Ga0068853_100006633 3300005539 Bacteria 9218
42 Ga0068853_100311008 3300005539 Bacteria 1458
43 Ga0070686_100012805 3300005544 Bacteria 4788
44 Ga0070693_100115453 3300005547 Bacteria 1658
45 Ga0070665_100000068 3300005548 Bacteria 204531
46 Ga0070665_100000783 3300005548 Bacteria 41826
47 Ga0070704_100009807 3300005549 Bacteria 5807
48 Ga0070664_100039062 3300005564 Bacteria 3998
49 Ga0068854_100000090 3300005578 Bacteria 64443
50 Ga0068854_100292551 3300005578 Bacteria 1315
51 Ga0068856_100019936 3300005614 Bacteria 6508
52 Ga0068852_100000006 3300005616 Bacteria 159569
53 Ga0068852_100055020 3300005616 Bacteria 3433
54 Ga0068859_100075357 3300005617 Unclassified 3414
55 Ga0068861_100057476 3300005719 Unclassified 2972
56 Ga0068851_10001723 3300005834 Bacteria 9553
57 Ga0068863_100000004 3300005841 Bacteria 272478
58 Ga0068863_100001412 3300005841 Bacteria 23785
59 Ga0068863_100110549 3300005841 Bacteria 2617
60 Ga0068858_100000012 3300005842 Bacteria 216931
61 Ga0068858_100000131 3300005842 Bacteria 77960
62 Ga0068860_100044417 3300005843 Bacteria 4236
63 Ga0068860_100388048 3300005843 Unclassified 1379
64 Ga0068862_100000510 3300005844 Bacteria 41329
65 Ga0068862_100653076 3300005844 Bacteria 1015
66 Ga0081455_10009098 3300005937 Bacteria 10247
67 Ga0081455_10010784 3300005937 Bacteria 9234
68 Ga0081540_1002647 3300005983 Bacteria 14560
69 Ga0081540_1034551 3300005983 Bacteria 2724
70 Ga0081539_10001945 3300005985 Bacteria 31608
71 Ga0075365_10037902 3300006038 Bacteria 3131
72 Ga0075363_100030798 3300006048 Bacteria 2779
73 Ga0075363_100070307 3300006048 Bacteria 1901
74 Ga0075363_100133519 3300006048 Bacteria 1393
75 Ga0075364_10027832 3300006051 Bacteria 3614
76 Ga0075364_10032364 3300006051 Bacteria 3361
77 Ga0075364_10085153 3300006051 Bacteria 2093
78 Ga0070716_100008089 3300006173 Bacteria 5207
79 Ga0070712_100007439 3300006175 Bacteria 6833
80 Ga0075367_10166509 3300006178 Bacteria 1372
81 Ga0075367_10169320 3300006178 Unclassified 1360
82 Ga0097621_100070615 3300006237 Bacteria 2884
83 Ga0097621_100125818 3300006237 Bacteria 2177
84 Ga0068871_100166741 3300006358 Unclassified 1886
85 Ga0068871_100322367 3300006358 Bacteria 1361
86 Ga0075430_100031555 3300006846 Bacteria 4498
87 Ga0075433_10085528 3300006852 Bacteria 2784
88 Ga0075434_100108172 3300006871 Bacteria 2791
89 Ga0068865_100000023 3300006881 Bacteria 100785
90 Ga0068865_100057124 3300006881 Bacteria 2721
91 Ga0097620_100075354 3300006931 Unclassified 3414
92 Ga0075435_100087153 3300007076 Bacteria 2572
93 Ga0105240_10230216 3300009093 Bacteria 2154
94 Ga0105240_10403504 3300009093 Bacteria 1539
95 Ga0105245_10000662 3300009098 Bacteria 31191
96 Ga0105245_10001882 3300009098 Bacteria 19040
97 Ga0105245_10006750 3300009098 Bacteria 10065
98 Ga0105245_10011756 3300009098 Bacteria 7616
99 Ga0105245_10023182 3300009098 Bacteria 5448
100 Ga0105247_10000185 3300009101 Bacteria 60656
101 Ga0105247_10030180 3300009101 Bacteria 3286
102 Ga0105247_10075535 3300009101 Bacteria 2115
103 Ga0105247_10102403 3300009101 Bacteria 1832
104 Ga0105243_10040943 3300009148 Bacteria 3622
105 Ga0105241_10036957 3300009174 Bacteria 3677
106 Ga0105242_10000051 3300009176 Bacteria 79661
107 Ga0105242_10001300 3300009176 Bacteria 19749
108 Ga0105242_10098758 3300009176 Bacteria 2470
109 Ga0105242_10315325 3300009176 Bacteria 1432
110 Ga0105242_10466247 3300009176 Bacteria 1194
111 Ga0105248_10000008 3300009177 Bacteria 403910
112 Ga0105248_10422581 3300009177 Bacteria 1501
113 Ga0105237_10251570 3300009545 Unclassified 1769
114 Ga0105238_10000023 3300009551 Bacteria 196844
115 Ga0105238_10133813 3300009551 Bacteria 2457
116 Ga0105249_10000074 3300009553 Bacteria 145235
117 Ga0105249_10030943 3300009553 Bacteria 4838
118 Ga0105239_10166211 3300010375 Bacteria 2467
119 Ga0105239_10202063 3300010375 Bacteria 2226
120 Ga0105239_10289356 3300010375 Bacteria 1845
121 Ga0157369_10000020 3300013105 Bacteria 241679
122 Ga0157374_10003040 3300013296 Bacteria 14068
123 Ga0157374_10098359 3300013296 Bacteria 2801
124 Ga0157374_10341398 3300013296 Unclassified 1487
125 Ga0157378_10027769 3300013297 Bacteria 4992
126 Ga0157378_10051316 3300013297 Bacteria 3670
127 Ga0157378_10063198 3300013297 Bacteria 3308
128 Ga0163162_10188471 3300013306 Bacteria 2190
129 Ga0157372_10000253 3300013307 Bacteria 59272
130 Ga0157375_10000109 3300013308 Bacteria 80349
131 Ga0157375_10236940 3300013308 Bacteria 1984
132 Ga0157375_10622210 3300013308 Unclassified 1238
133 Ga0163163_10049582 3300014325 Bacteria 4133
134 Ga0157380_10000037 3300014326 Bacteria 80856
135 Ga0157380_10000487 3300014326 Bacteria 24132
136 Ga0157379_10102284 3300014968 Bacteria 2572
137 Ga0157379_10161529 3300014968 Bacteria 2022
138 Ga0157376_10009684 3300014969 Bacteria 7012
139 Ga0157376_10243743 3300014969 Bacteria 1675
140 Ga0163161_10000013 3300017792 Bacteria 258747
141 Ga0163161_10031427 3300017792 Bacteria 3783
142 Ga0206356_10349974 3300020070 Bacteria 3028
143 Ga0206354_11205533 3300020081 Bacteria 944
144 Ga0154015_1575933 3300020610 Bacteria 1028
145 Ga0207656_10001124 3300025321 Bacteria 8785
146 Ga0207682_10000034 3300025893 Bacteria 56869
147 Ga0207642_10003589 3300025899 Bacteria 4920
148 Ga0207710_10000180 3300025900 Bacteria 63999
149 Ga0207680_10009271 3300025903 Bacteria 4875
150 Ga0207680_10041299 3300025903 Bacteria 2690
151 Ga0207693_10008635 3300025915 Bacteria 8334
152 Ga0207663_10001227 3300025916 Bacteria 11833
153 Ga0207649_10000009 3300025920 Bacteria 295544
154 Ga0207694_10000004 3300025924 Bacteria 967075
155 Ga0207694_10080596 3300025924 Bacteria 2555
156 Ga0207687_10000007 3300025927 Bacteria 604185
157 Ga0207687_10000026 3300025927 Bacteria 173968
158 Ga0207687_10000055 3300025927 Bacteria 88382
159 Ga0207687_10002371 3300025927 Bacteria 12795
160 Ga0207700_10016110 3300025928 Bacteria 4956
161 Ga0207690_10001511 3300025932 Bacteria 14543
162 Ga0207686_10000083 3300025934 Bacteria 79869
163 Ga0207686_10000770 3300025934 Bacteria 19710
164 Ga0207686_10306700 3300025934 Bacteria 1181
165 Ga0207709_10027465 3300025935 Unclassified 3279
166 Ga0207704_10000068 3300025938 Bacteria 65896
167 Ga0207665_10062396 3300025939 Bacteria 2529
168 Ga0207711_10000006 3300025941 Bacteria 792692
169 Ga0207711_10376499 3300025941 Bacteria 1317
170 Ga0207661_10000056 3300025944 Bacteria 85250
171 Ga0207661_10001306 3300025944 Bacteria 16659
172 Ga0207661_10002003 3300025944 Bacteria 14030
173 Ga0207679_10029725 3300025945 Bacteria 3807
174 Ga0207651_10042334 3300025960 Bacteria 3030
175 Ga0207712_10000007 3300025961 Bacteria 539589
176 Ga0207712_10006457 3300025961 Bacteria 7392
177 Ga0207668_10040159 3300025972 Bacteria 3155
178 Ga0207668_10266567 3300025972 Bacteria 1398
179 Ga0207640_10000178 3300025981 Bacteria 46342
180 Ga0207640_10160482 3300025981 Bacteria 1663
181 Ga0207658_10028847 3300025986 Bacteria 3912
182 Ga0207658_10084762 3300025986 Bacteria 2439
183 Ga0207658_10107616 3300025986 Bacteria 2197
184 Ga0207658_10130387 3300025986 Bacteria 2019
185 Ga0207677_10001380 3300026023 Bacteria 12957
186 Ga0207703_10000111 3300026035 Bacteria 96592
187 Ga0207703_10000310 3300026035 Bacteria 52770
188 Ga0207703_10056063 3300026035 Bacteria 3208
189 Ga0207703_10242204 3300026035 Bacteria 1622
190 Ga0207703_10518287 3300026035 Bacteria 1121
191 Ga0207639_10004273 3300026041 Bacteria 9633
192 Ga0207678_10289736 3300026067 Bacteria 1406
193 Ga0207678_10380786 3300026067 Bacteria 1220
194 Ga0207702_10015866 3300026078 Bacteria 6238
195 Ga0207641_10000170 3300026088 Bacteria 91128
196 Ga0207641_10001999 3300026088 Bacteria 19452
197 Ga0207648_10000573 3300026089 Bacteria 41295
198 Ga0207648_10561892 3300026089 Bacteria 1049
199 Ga0207674_10045249 3300026116 Bacteria 4528
200 Ga0207675_100073062 3300026118 Unclassified 3208
201 Ga0207683_10004904 3300026121 Bacteria 11518
202 Ga0207683_10006812 3300026121 Bacteria 9784
203 Ga0207698_10000013 3300026142 Bacteria 255414
204 Ga0207698_10431474 3300026142 Bacteria 1267
205 Ga0268266_10000020 3300028379 Bacteria 527065
206 Ga0268266_10000406 3300028379 Bacteria 65477
207 Ga0268266_10379795 3300028379 Bacteria 1332
208 Ga0268265_10004026 3300028380 Bacteria 10351
209 Ga0268264_10003178 3300028381 Bacteria 14229
210 Ga0268264_10027318 3300028381 Bacteria 4662
211 Ga0265337_1000309 3300028556 Bacteria 25924
212 Ga0265326_10000015 3300028558 Bacteria 159279
213 Ga0265319_1000020 3300028563 Bacteria 153921
214 Ga0265322_10000003 3300028654 Bacteria 468671
215 Ga0265336_10011463 3300028666 Unclassified 3013
216 Ga0265338_10000222 3300028800 Bacteria 105765
217 Ga0265324_10000375 3300029957 Bacteria 32371
218 Ga0265332_10013695 3300031238 Unclassified 3592
219 Ga0265320_10000001 3300031240 Bacteria 847191
220 Ga0265329_10002479 3300031242 Bacteria 8334
221 Ga0265331_10001146 3300031250 Bacteria 20207
222 Ga0265327_10000003 3300031251 Bacteria 852750
223 Ga0265316_10041688 3300031344 Unclassified 3672
224 Ga0265314_10000585 3300031711 Bacteria 45849
225 Ga0373955_0086064 3300035172 Bacteria 1785
226 Ga0373937_0103119 3300036401 Bacteria 2649
227 Ga0395900_0104577 3300037418 Bacteria 2909
228 Ga0395898_0711423 3300037466 Bacteria 946
229 Ga0395905_0476588 3300037471 Bacteria 1147
230 Ga0395901_0079520 3300038443 Bacteria 3424
231 Ga0436365_0901253 3300039437 Unclassified 1336
232 Ga0436360_0782477 3300039438 Unclassified 2520
233 Ga0451853_0459676 3300041512 Bacteria 5936
234 Ga0451853_1568077 3300041512 Bacteria 2719
235 Ga0466963_0000062 3300044694 Bacteria 36386
236 Ga0466957_0007837 3300044842 Bacteria 6054
237 Ga0466959_0000366 3300045049 Bacteria 26743
238 Ga0466967_0000015 3300045976 Bacteria 99105
239 Ga0466967_0258811 3300045976 Bacteria 1665
240 Ga0466967_0379855 3300045976 Bacteria 1371
241 Ga0495592_0068876 3300046454 Bacteria 2581
242 Ga0495592_0132784 3300046454 Unclassified 1740
243 Ga0495592_0179037 3300046454 Bacteria 1445
244 Ga0495603_0001639 3300046455 Bacteria 13148
245 Ga0495629_0000919 3300046459 Bacteria 23655
246 Ga0495629_0007085 3300046459 Bacteria 8262
247 Ga0495629_0075131 3300046459 Bacteria 2360
248 Ga0495629_0115619 3300046459 Bacteria 1869
249 Ga0495641_0000003 3300046461 Bacteria 242879
250 Ga0495641_0029885 3300046461 Bacteria 2620
251 Ga0495641_0032085 3300046461 Bacteria 2503
252 Ga0495639_0198168 3300046475 Bacteria 982
253 Ga0495662_0000036 3300046476 Bacteria 44993
254 Ga0495585_0123785 3300046492 Bacteria 1366
255 Ga0495594_0000107 3300046499 Bacteria 38765
256 Ga0495606_0000072 3300046507 Bacteria 173678
257 Ga0495608_0000060 3300046511 Bacteria 88189
258 Ga0495608_0001570 3300046511 Bacteria 16326
259 Ga0495608_0070144 3300046511 Bacteria 2287
260 Ga0495618_0000053 3300046514 Bacteria 84115
261 Ga0495620_0000205 3300046515 Bacteria 44506
262 Ga0495628_0001375 3300046516 Bacteria 22311
263 Ga0495628_0001677 3300046516 Bacteria 20220
264 Ga0495628_0010707 3300046516 Bacteria 7767
265 Ga0495628_0080898 3300046516 Unclassified 2524
266 Ga0495628_0099481 3300046516 Bacteria 2246
267 Ga0495628_0154523 3300046516 Bacteria 1746
268 Ga0495628_0164842 3300046516 Bacteria 1683
269 Ga0495630_0000020 3300046517 Bacteria 176389
270 Ga0495630_0000560 3300046517 Bacteria 27056
271 Ga0495630_0002335 3300046517 Bacteria 13198
272 Ga0495630_0230774 3300046517 Unclassified 1414
273 Ga0495632_0203823 3300046519 Bacteria 900
274 Ga0495652_0000171 3300046529 Bacteria 74097
275 Ga0495652_0003006 3300046529 Bacteria 16917
276 Ga0495640_0082174 3300046533 Bacteria 2140
277 Ga0495586_0007568 3300046535 Bacteria 5794
278 Ga0495587_0000574 3300046536 Bacteria 25248
279 Ga0495587_0006816 3300046536 Bacteria 7436
280 Ga0495645_0085255 3300046543 Bacteria 2261
281 Ga0495622_0000259 3300046557 Bacteria 40357
282 Ga0495667_0000053 3300046559 Bacteria 105370
283 Ga0495656_0000290 3300046615 Bacteria 17454
284 Ga0495634_0000050 3300046642 Bacteria 94546
285 Ga0495634_0019295 3300046642 Bacteria 4845
286 Ga0495634_0025203 3300046642 Bacteria 4167
287 Ga0495625_0009780 3300046660 Bacteria 7978
288 Ga0495635_0000042 3300046663 Bacteria 84550
289 Ga0495588_0000134 3300046674 Bacteria 117581
290 Ga0495657_0000004 3300046675 Bacteria 266465
291 Ga0495599_0143743 3300046678 Unclassified 1479
292 Ga0495647_0000019 3300046681 Bacteria 78887
293 Ga0495647_0003004 3300046681 Bacteria 5368
294 Ga0495658_0006767 3300046683 Bacteria 5641
295 Ga0495669_0059269 3300046684 Unclassified 1728
296 Ga0495613_0000042 3300046689 Bacteria 130403
297 Ga0495613_0000197 3300046689 Bacteria 59091
298 Ga0495624_0000030 3300046690 Bacteria 91755
299 Ga0495624_0004937 3300046690 Bacteria 9675
300 Ga0495670_0002313 3300046691 Bacteria 9417
301 Ga0495649_0081874 3300046694 Bacteria 1725
302 Ga0495600_0298851 3300046809 Archaea 1016
303 Ga0495604_0000155 3300047317 Bacteria 60014
304 Ga0495604_0053094 3300047317 Bacteria 3135
305 Ga0495604_0245436 3300047317 Bacteria 1223
306 Ga0495674_0000029 3300047319 Bacteria 118854
307 Ga0495672_0047197 3300047320 Unclassified 2563
308 Ga0495676_0000903 3300047321 Bacteria 24846
309 Ga0495676_0007950 3300047321 Bacteria 9724
310 Ga0495676_0062916 3300047321 Bacteria 2895
311 Ga0495676_0074616 3300047321 Bacteria 2596
312 Ga0495680_0000196 3300047322 Bacteria 65437
313 Ga0495680_0001731 3300047322 Bacteria 23178
314 Ga0495680_0008124 3300047322 Bacteria 9564
315 Ga0495680_0159908 3300047322 Bacteria 1636
316 Ga0495675_0000040 3300047444 Bacteria 86266
317 Ga0495675_0061900 3300047444 Bacteria 2370
318 Ga0495686_0281820 3300047472 Bacteria 923
319 Ga0495593_0147095 3300047673 Bacteria 1192
320 Ga0495602_0000070 3300048088 Bacteria 100656
321 Ga0495602_0000533 3300048088 Bacteria 35335
322 Ga0495614_0122583 3300048089 Bacteria 1147
323 Ga0496100_0000005 3300048903 Bacteria 312112
324 Ga0496100_0000007 3300048903 Bacteria 261266
325 Ga0496100_0329412 3300048903 Bacteria 1149
326 Ga0496101_0000013 3300048904 Bacteria 261266
327 Ga0496101_0000022 3300048904 Bacteria 216728
328 Ga0496101_0074842 3300048904 Bacteria 2491
329 Ga0496101_0167412 3300048904 Unclassified 1688
330 Ga0496102_0000115 3300048905 Bacteria 114224
331 Ga0496102_0132503 3300048905 Bacteria 2334
332 Ga0496103_0000008 3300048906 Bacteria 340474
333 Ga0496103_0073181 3300048906 Bacteria 2147
334 Ga0496104_0000004 3300048907 Bacteria 641830
335 Ga0496104_0000013 3300048907 Bacteria 397163
336 Ga0496104_0000190 3300048907 Bacteria 55572
337 Ga0496104_0018778 3300048907 Bacteria 6314
338 Ga0496105_0000001 3300048908 Bacteria 1328178
339 Ga0496105_0000006 3300048908 Bacteria 393578
340 Ga0496105_0000197 3300048908 Bacteria 40456
341 Ga0496105_0038384 3300048908 Bacteria 3945
342 Ga0496106_0000006 3300048909 Bacteria 251855
343 Ga0496106_0000333 3300048909 Bacteria 33134
344 Ga0496106_0002378 3300048909 Bacteria 14008
345 Ga0496107_0000007 3300048910 Bacteria 257113
346 Ga0496107_0000011 3300048910 Bacteria 201631
347 Ga0496107_0003043 3300048910 Bacteria 11120
348 Ga0496107_0197555 3300048910 Unclassified 1495
349 Ga0496108_0000001 3300048911 Bacteria 919044
350 Ga0496108_0000133 3300048911 Bacteria 72253
351 Ga0496108_0000146 3300048911 Bacteria 67618
352 Ga0496109_0000006 3300048912 Bacteria 325513
353 Ga0496109_0000021 3300048912 Bacteria 189945
354 Ga0496109_0000060 3300048912 Bacteria 115800
355 Ga0496109_0283184 3300048912 Bacteria 1562
356 Ga0496109_0284911 3300048912 Unclassified 1557
357 Ga0496110_0000287 3300048913 Bacteria 33028
358 Ga0496110_0008835 3300048913 Bacteria 8117
359 Ga0496110_0008903 3300048913 Bacteria 8091
360 Ga0496110_0138704 3300048913 Unclassified 2198
361 Ga0496110_0183189 3300048913 Bacteria 1902
362 Ga0496111_0000077 3300048914 Bacteria 40767
363 Ga0496111_0001766 3300048914 Bacteria 12668
364 Ga0496111_0008123 3300048914 Bacteria 6932
365 Ga0496111_0026675 3300048914 Bacteria 4081
366 Ga0496112_0012069 3300048915 Bacteria 7926
367 Ga0496112_0053545 3300048915 Bacteria 3964
368 Ga0496113_0002589 3300048916 Bacteria 10564
369 Ga0496113_0123827 3300048916 Unclassified 2024
370 Ga0496114_0000088 3300048917 Bacteria 65300
371 Ga0496114_0062324 3300048917 Unclassified 3121
372 Ga0496114_0089830 3300048917 Bacteria 2607
373 Ga0496115_0000003 3300048918 Bacteria 354994
374 Ga0496115_0000119 3300048918 Bacteria 71710
375 Ga0496115_0040775 3300048918 Bacteria 3692
376 Ga0496116_0000441 3300048919 Bacteria 58149
377 Ga0496117_0024800 3300048920 Bacteria 4729
378 Ga0496118_0004781 3300048921 Bacteria 15826
379 Ga0496118_0124611 3300048921 Bacteria 1671
380 Ga0496118_0228524 3300048921 Bacteria 1076
381 Ga0496119_0001437 3300048922 Bacteria 28706
382 Ga0496119_0001484 3300048922 Bacteria 28124
383 Ga0496119_0053378 3300048922 Bacteria 2469
384 Ga0496119_0222229 3300048922 Unclassified 966
385 Ga0496121_0081748 3300048924 Unclassified 2556
386 Ga0496121_0159328 3300048924 Unclassified 1652
387 Ga0496121_0355915 3300048924 Bacteria 973
388 Ga0496121_0358271 3300048924 Unclassified 969
389 Ga0496124_0026726 3300048927 Bacteria 5200
390 Ga0496124_0358905 3300048927 Bacteria 1028
391 Ga0496125_0051349 3300048928 Unclassified 3402
392 Ga0496125_0055223 3300048928 Bacteria 3238
393 Ga0496126_0247243 3300048929 Bacteria 1487
394 Ga0501034_0390777 3300049571 Bacteria 1315
395 Ga0501042_0127701 3300049578 Bacteria 1831
396 Ga0501042_0424707 3300049578 Bacteria 963
397 Ga0501047_0101267 3300049581 Bacteria 2760
398 Ga0501047_0238226 3300049581 Bacteria 1671
399 Ga0501070_0014432 3300049586 Bacteria 6648
400 Ga0501074_0091195 3300049590 Bacteria 2182
401 Ga0501083_0002702 3300049744 Bacteria 12234
402 Ga0501044_0070014 3300049823 Bacteria 3570
403 Ga0501044_0257424 3300049823 Bacteria 1684
404 nmdc:mga03n38_17916_c1 3300050490 Unclassified 1376
405 nmdc:mga03n38_31894_c1 3300050490 Bacteria 2227
406 nmdc:mga00v17_12532_c1 3300050491 Bacteria 4681
407 nmdc:mga00v17_25355_c1 3300050491 Bacteria 3446
408 nmdc:mga00v17_95361_c1 3300050491 Bacteria 1873
409 nmdc:mga0yw44_235977_c1 3300050492 Unclassified 1215
410 nmdc:mga0qj67_42179_c1 3300050509 Bacteria 3591
411 nmdc:mga0n895_97164_c1 3300050512 Bacteria 2951
412 nmdc:mga0a205_8661_c1 3300050515 Bacteria 9261
413 Ga0495601_0000032 3300053077 Bacteria 102174
414 Ga0495601_0000045 3300053077 Bacteria 73391
415 Ga0495601_0030008 3300053077 Bacteria 3375
416 Ga0495601_0131993 3300053077 Bacteria 1627
417 Ga0495655_0000001 3300053083 Bacteria 419518
418 Ga0495655_0001621 3300053083 Bacteria 3475
419 Ga0495595_0000003 3300053084 Bacteria 266465
420 Ga0495595_0002731 3300053084 Bacteria 6925
421 Ga0495595_0049358 3300053084 Bacteria 1946
422 Ga0495619_0000032 3300053085 Bacteria 139067
423 Ga0495619_0000137 3300053085 Bacteria 54479
424 Ga0495619_0000404 3300053085 Bacteria 29419
425 Ga0495619_0165637 3300053085 Bacteria 1527
426 Ga0500566_0003977 3300053094 Bacteria 8824
427 Ga0500641_0001315 3300053096 Bacteria 8825
428 Ga0500595_030451 3300053119 Bacteria 1817
429 Ga0500614_000116 3300053123 Bacteria 19156
430 Ga0500628_000020 3300053129 Bacteria 81755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025939 Ga0207665_10062396 Ga0207665_100623963 235
2 3300046519 Ga0495632_0203823 Ga0495632_0203823_157_867 236
3 3300006038 Ga0075365_10037902 Ga0075365_100379022 252
4 3300006051 Ga0075364_10027832 Ga0075364_100278323 252
5 3300050491 nmdc:mga00v17_25355_c1 nmdc:mga00v17_25355_c1_1871_2689 252
6 3300006048 Ga0075363_100070307 Ga0075363_1000703072 253
7 3300050490 nmdc:mga03n38_31894_c1 nmdc:mga03n38_31894_c1_508_1326 253
8 3300046663 Ga0495635_0000042 Ga0495635_0000042_74564_75403 255
9 3300047321 Ga0495676_0074616 Ga0495676_0074616_772_1605 255
10 3300005985 Ga0081539_10001945 Ga0081539_100019452 258
11 3300014326 Ga0157380_10000487 Ga0157380_1000048712 258
12 3300045049 Ga0466959_0000366 Ga0466959_0000366_5075_5863 258
13 3300006846 Ga0075430_100031555 Ga0075430_1000315553 259
14 3300046535 Ga0495586_0007568 Ga0495586_0007568_2031_2864 259
15 3300049578 Ga0501042_0127701 Ga0501042_0127701_365_1195 259
16 3300050509 nmdc:mga0qj67_42179_c1 nmdc:mga0qj67_42179_c1_1160_1990 259
17 3300046684 Ga0495669_0059269 Ga0495669_0059269_94_924 260
18 3300047317 Ga0495604_0245436 Ga0495604_0245436_323_1156 260
19 3300050491 nmdc:mga00v17_12532_c1 nmdc:mga00v17_12532_c1_1968_2756 260
20 3300050491 nmdc:mga00v17_95361_c1 nmdc:mga00v17_95361_c1_938_1726 260
21 3300050492 nmdc:mga0yw44_235977_c1 nmdc:mga0yw44_235977_c1_281_1069 260
22 3300025899 Ga0207642_10003589 Ga0207642_100035892 261
23 3300025981 Ga0207640_10160482 Ga0207640_101604822 261
24 3300046454 Ga0495592_0179037 Ga0495592_0179037_31_825 261
25 3300046459 Ga0495629_0075131 Ga0495629_0075131_170_1000 261
26 3300039437 Ga0436365_0901253 Ga0436365_0901253_409_1227 262
27 3300046461 Ga0495641_0029885 Ga0495641_0029885_1812_2600 262
28 3300046517 Ga0495630_0000020 Ga0495630_0000020_156111_156899 262
29 3300003659 JGI25404J52841_10002306 JGI25404J52841_100023063 263
30 3300005364 Ga0070673_100002074 Ga0070673_1000020742 263
31 3300005983 Ga0081540_1002647 Ga0081540_100264716 263
32 3300006178 Ga0075367_10166509 Ga0075367_101665091 263
33 3300009101 Ga0105247_10000185 Ga0105247_1000018518 263
34 3300025916 Ga0207663_10001227 Ga0207663_1000122712 263
35 3300025960 Ga0207651_10042334 Ga0207651_100423344 263
36 3300013297 Ga0157378_10063198 Ga0157378_100631983 264
37 3300025900 Ga0207710_10000180 Ga0207710_1000018059 264
38 3300025934 Ga0207686_10000770 Ga0207686_100007703 264
39 3300048907 Ga0496104_0000004 Ga0496104_0000004_429521_430354 264
40 3300048908 Ga0496105_0000001 Ga0496105_0000001_211477_212310 264
41 3300048910 Ga0496107_0197555 Ga0496107_0197555_54_884 264
42 3300048912 Ga0496109_0283184 Ga0496109_0283184_101_931 264
43 3300048913 Ga0496110_0008835 Ga0496110_0008835_6394_7224 264
44 3300048914 Ga0496111_0001766 Ga0496111_0001766_5291_6121 264
45 3300048916 Ga0496113_0123827 Ga0496113_0123827_1115_1945 264
46 3300048918 Ga0496115_0000003 Ga0496115_0000003_54995_55825 264
47 3300048922 Ga0496119_0053378 Ga0496119_0053378_964_1797 264
48 3300049571 Ga0501034_0390777 Ga0501034_0390777_160_981 264
49 3300049578 Ga0501042_0424707 Ga0501042_0424707_31_858 264
50 3300049581 Ga0501047_0238226 Ga0501047_0238226_615_1436 264
51 3300049823 Ga0501044_0070014 Ga0501044_0070014_2558_3379 264
52 3300053096 Ga0500641_0001315 Ga0500641_0001315_1311_2141 264
53 3300001977 JGI24746J21847_1000135 JGI24746J21847_10001355 265
54 3300009176 Ga0105242_10001300 Ga0105242_1000130021 265
55 3300046499 Ga0495594_0000107 Ga0495594_0000107_12720_13550 265
56 3300046516 Ga0495628_0164842 Ga0495628_0164842_740_1570 265
57 3300046529 Ga0495652_0003006 Ga0495652_0003006_797_1627 265
58 3300046543 Ga0495645_0085255 Ga0495645_0085255_30_860 265
59 3300046557 Ga0495622_0000259 Ga0495622_0000259_26100_26930 265
60 3300046691 Ga0495670_0002313 Ga0495670_0002313_484_1326 265
61 3300005367 Ga0070667_100132341 Ga0070667_1001323412 266
62 3300025986 Ga0207658_10130387 Ga0207658_101303872 266
63 3300046533 Ga0495640_0082174 Ga0495640_0082174_600_1430 266
64 3300047319 Ga0495674_0000029 Ga0495674_0000029_68839_69669 266
65 3300017792 Ga0163161_10031427 Ga0163161_100314274 267
66 3300005337 Ga0070682_100074835 Ga0070682_1000748353 268
67 3300017792 Ga0163161_10000013 Ga0163161_1000001328 268
68 3300046476 Ga0495662_0000036 Ga0495662_0000036_9328_10167 268
69 3300046511 Ga0495608_0001570 Ga0495608_0001570_869_1708 268
70 3300046516 Ga0495628_0001375 Ga0495628_0001375_13939_14775 268
71 3300046516 Ga0495628_0099481 Ga0495628_0099481_824_1663 268
72 3300046517 Ga0495630_0000560 Ga0495630_0000560_2730_3569 268
73 3300046809 Ga0495600_0298851 Ga0495600_0298851_112_948 268
74 3300047322 Ga0495680_0001731 Ga0495680_0001731_21570_22409 268
75 3300047472 Ga0495686_0281820 Ga0495686_0281820_77_907 268
76 3300048913 Ga0496110_0183189 Ga0496110_0183189_699_1529 268
77 3300005719 Ga0068861_100057476 Ga0068861_1000574763 269
78 3300006048 Ga0075363_100133519 Ga0075363_1001335192 269
79 3300006051 Ga0075364_10032364 Ga0075364_100323643 269
80 3300006051 Ga0075364_10085153 Ga0075364_100851532 269
81 3300006178 Ga0075367_10169320 Ga0075367_101693202 269
82 3300026118 Ga0207675_100073062 Ga0207675_1000730623 269
83 3300048913 Ga0496110_0000287 Ga0496110_0000287_7998_8825 269
84 3300048914 Ga0496111_0000077 Ga0496111_0000077_3085_3912 269
85 3300005329 Ga0070683_100040550 Ga0070683_1000405506 270
86 3300006048 Ga0075363_100030798 Ga0075363_1000307983 270
87 3300025944 Ga0207661_10002003 Ga0207661_1000200312 270
88 3300050490 nmdc:mga03n38_17916_c1 nmdc:mga03n38_17916_c1_462_1277 270
89 3300005338 Ga0068868_100028634 Ga0068868_1000286344 271
90 3300005439 Ga0070711_100015025 Ga0070711_1000150252 271
91 3300005456 Ga0070678_100379934 Ga0070678_1003799341 271
92 3300005544 Ga0070686_100012805 Ga0070686_1000128054 271
93 3300005547 Ga0070693_100115453 Ga0070693_1001154532 271
94 3300005549 Ga0070704_100009807 Ga0070704_1000098073 271
95 3300005617 Ga0068859_100075357 Ga0068859_1000753572 271
96 3300006173 Ga0070716_100008089 Ga0070716_1000080895 271
97 3300006175 Ga0070712_100007439 Ga0070712_1000074396 271
98 3300006237 Ga0097621_100125818 Ga0097621_1001258182 271
99 3300006871 Ga0075434_100108172 Ga0075434_1001081723 271
100 3300006881 Ga0068865_100057124 Ga0068865_1000571242 271
101 3300006931 Ga0097620_100075354 Ga0097620_1000753542 271
102 3300007076 Ga0075435_100087153 Ga0075435_1000871531 271
103 3300009098 Ga0105245_10011756 Ga0105245_100117562 271
104 3300009101 Ga0105247_10075535 Ga0105247_100755352 271
105 3300009176 Ga0105242_10315325 Ga0105242_103153252 271
106 3300009176 Ga0105242_10466247 Ga0105242_104662472 271
107 3300009177 Ga0105248_10422581 Ga0105248_104225812 271
108 3300010375 Ga0105239_10166211 Ga0105239_101662113 271
109 3300025915 Ga0207693_10008635 Ga0207693_100086356 271
110 3300026089 Ga0207648_10561892 Ga0207648_105618921 271
111 3300026121 Ga0207683_10004904 Ga0207683_1000490410 271
112 3300037418 Ga0395900_0104577 Ga0395900_0104577_1594_2412 271
113 3300038443 Ga0395901_0079520 Ga0395901_0079520_245_1063 271
114 3300048904 Ga0496101_0074842 Ga0496101_0074842_155_970 271
115 3300048910 Ga0496107_0003043 Ga0496107_0003043_2107_2922 271
116 3300048913 Ga0496110_0008903 Ga0496110_0008903_1296_2111 271
117 3300048914 Ga0496111_0008123 Ga0496111_0008123_1056_1871 271
118 3300048915 Ga0496112_0053545 Ga0496112_0053545_3072_3887 271
119 3300048917 Ga0496114_0089830 Ga0496114_0089830_736_1551 271
120 3300048918 Ga0496115_0040775 Ga0496115_0040775_156_971 271
121 3300050512 nmdc:mga0n895_97164_c1 nmdc:mga0n895_97164_c1_250_1065 271
122 3300005347 Ga0070668_100125406 Ga0070668_1001254063 272
123 3300005367 Ga0070667_100009366 Ga0070667_1000093669 272
124 3300005844 Ga0068862_100000510 Ga0068862_10000051027 272
125 3300006358 Ga0068871_100166741 Ga0068871_1001667412 272
126 3300009553 Ga0105249_10030943 Ga0105249_100309432 272
127 3300014968 Ga0157379_10161529 Ga0157379_101615292 272
128 3300025961 Ga0207712_10006457 Ga0207712_100064574 272
129 3300025972 Ga0207668_10040159 Ga0207668_100401593 272
130 3300025986 Ga0207658_10107616 Ga0207658_101076162 272
131 3300028380 Ga0268265_10004026 Ga0268265_100040262 272
132 3300028381 Ga0268264_10027318 Ga0268264_100273185 272
133 3300037466 Ga0395898_0711423 Ga0395898_0711423_45_884 272
134 3300037471 Ga0395905_0476588 Ga0395905_0476588_190_1032 272
135 3300046516 Ga0495628_0001677 Ga0495628_0001677_18123_18941 272
136 3300047320 Ga0495672_0047197 Ga0495672_0047197_301_1122 272
137 3300005335 Ga0070666_10034875 Ga0070666_100348753 273
138 3300005367 Ga0070667_100177294 Ga0070667_1001772942 273
139 3300005843 Ga0068860_100388048 Ga0068860_1003880481 273
140 3300005937 Ga0081455_10009098 Ga0081455_100090989 273
141 3300025986 Ga0207658_10084762 Ga0207658_100847622 273
142 3300026035 Ga0207703_10242204 Ga0207703_102422042 273
143 3300045976 Ga0466967_0379855 Ga0466967_0379855_299_1123 273
144 3300048903 Ga0496100_0329412 Ga0496100_0329412_53_874 273
145 3300048904 Ga0496101_0167412 Ga0496101_0167412_295_1116 273
146 3300048907 Ga0496104_0018778 Ga0496104_0018778_1130_1951 273
147 3300048908 Ga0496105_0038384 Ga0496105_0038384_3021_3842 273
148 3300048922 Ga0496119_0001484 Ga0496119_0001484_3563_4384 273
149 3300048924 Ga0496121_0081748 Ga0496121_0081748_688_1509 273
150 3300048928 Ga0496125_0051349 Ga0496125_0051349_1021_1842 273
151 3300048929 Ga0496126_0247243 Ga0496126_0247243_172_996 273
152 3300005329 Ga0070683_100106142 Ga0070683_1001061422 274
153 3300005335 Ga0070666_10058477 Ga0070666_100584772 274
154 3300005338 Ga0068868_100004032 Ga0068868_1000040325 274
155 3300005341 Ga0070691_10001179 Ga0070691_100011797 274
156 3300005344 Ga0070661_100000226 Ga0070661_10000022638 274
157 3300005345 Ga0070692_10058081 Ga0070692_100580812 274
158 3300005367 Ga0070667_100125244 Ga0070667_1001252441 274
159 3300005455 Ga0070663_100364652 Ga0070663_1003646521 274
160 3300005456 Ga0070678_100008325 Ga0070678_1000083253 274
161 3300005564 Ga0070664_100039062 Ga0070664_1000390622 274
162 3300005841 Ga0068863_100000004 Ga0068863_100000004173 274
163 3300005841 Ga0068863_100110549 Ga0068863_1001105492 274
164 3300005842 Ga0068858_100000131 Ga0068858_10000013168 274
165 3300005937 Ga0081455_10010784 Ga0081455_100107844 274
166 3300006237 Ga0097621_100070615 Ga0097621_1000706152 274
167 3300009093 Ga0105240_10230216 Ga0105240_102302162 274
168 3300009101 Ga0105247_10102403 Ga0105247_101024032 274
169 3300009148 Ga0105243_10040943 Ga0105243_100409435 274
170 3300009176 Ga0105242_10098758 Ga0105242_100987582 274
171 3300009545 Ga0105237_10251570 Ga0105237_102515702 274
172 3300009551 Ga0105238_10133813 Ga0105238_101338133 274
173 3300013296 Ga0157374_10003040 Ga0157374_100030408 274
174 3300013296 Ga0157374_10341398 Ga0157374_103413982 274
175 3300013308 Ga0157375_10000109 Ga0157375_100001094 274
176 3300013308 Ga0157375_10236940 Ga0157375_102369403 274
177 3300013308 Ga0157375_10622210 Ga0157375_106222102 274
178 3300014325 Ga0163163_10049582 Ga0163163_100495823 274
179 3300014969 Ga0157376_10009684 Ga0157376_100096844 274
180 3300020070 Ga0206356_10349974 Ga0206356_103499741 274
181 3300025903 Ga0207680_10041299 Ga0207680_100412993 274
182 3300025920 Ga0207649_10000009 Ga0207649_10000009140 274
183 3300025924 Ga0207694_10080596 Ga0207694_100805962 274
184 3300025934 Ga0207686_10306700 Ga0207686_103067001 274
185 3300025935 Ga0207709_10027465 Ga0207709_100274654 274
186 3300025945 Ga0207679_10029725 Ga0207679_100297254 274
187 3300025972 Ga0207668_10266567 Ga0207668_102665672 274
188 3300025986 Ga0207658_10028847 Ga0207658_100288472 274
189 3300026023 Ga0207677_10001380 Ga0207677_100013809 274
190 3300026035 Ga0207703_10000111 Ga0207703_1000011110 274
191 3300026035 Ga0207703_10518287 Ga0207703_105182871 274
192 3300026067 Ga0207678_10289736 Ga0207678_102897362 274
193 3300026067 Ga0207678_10380786 Ga0207678_103807862 274
194 3300026088 Ga0207641_10000170 Ga0207641_1000017024 274
195 3300026121 Ga0207683_10006812 Ga0207683_100068129 274
196 3300028379 Ga0268266_10000406 Ga0268266_1000040634 274
197 3300028379 Ga0268266_10379795 Ga0268266_103797952 274
198 3300028556 Ga0265337_1000309 Ga0265337_100030913 274
199 3300028558 Ga0265326_10000015 Ga0265326_10000015139 274
200 3300028563 Ga0265319_1000020 Ga0265319_100002066 274
201 3300028654 Ga0265322_10000003 Ga0265322_1000000340 274
202 3300028666 Ga0265336_10011463 Ga0265336_100114633 274
203 3300028800 Ga0265338_10000222 Ga0265338_1000022256 274
204 3300029957 Ga0265324_10000375 Ga0265324_1000037529 274
205 3300031238 Ga0265332_10013695 Ga0265332_100136952 274
206 3300031240 Ga0265320_10000001 Ga0265320_1000000140 274
207 3300031242 Ga0265329_10002479 Ga0265329_100024793 274
208 3300031250 Ga0265331_10001146 Ga0265331_1000114612 274
209 3300031251 Ga0265327_10000003 Ga0265327_1000000340 274
210 3300031344 Ga0265316_10041688 Ga0265316_100416883 274
211 3300031711 Ga0265314_10000585 Ga0265314_1000058540 274
212 3300045976 Ga0466967_0258811 Ga0466967_0258811_132_956 274
213 3300046454 Ga0495592_0132784 Ga0495592_0132784_873_1703 274
214 3300046459 Ga0495629_0007085 Ga0495629_0007085_806_1630 274
215 3300046475 Ga0495639_0198168 Ga0495639_0198168_71_901 274
216 3300046507 Ga0495606_0000072 Ga0495606_0000072_73652_74476 274
217 3300046511 Ga0495608_0070144 Ga0495608_0070144_620_1444 274
218 3300046516 Ga0495628_0080898 Ga0495628_0080898_1560_2384 274
219 3300046517 Ga0495630_0002335 Ga0495630_0002335_5488_6315 274
220 3300046517 Ga0495630_0230774 Ga0495630_0230774_362_1189 274
221 3300046529 Ga0495652_0000171 Ga0495652_0000171_27306_28142 274
222 3300046536 Ga0495587_0000574 Ga0495587_0000574_17986_18816 274
223 3300046559 Ga0495667_0000053 Ga0495667_0000053_124_954 274
224 3300046615 Ga0495656_0000290 Ga0495656_0000290_8588_9418 274
225 3300046642 Ga0495634_0000050 Ga0495634_0000050_864_1688 274
226 3300046642 Ga0495634_0019295 Ga0495634_0019295_3319_4158 274
227 3300046642 Ga0495634_0025203 Ga0495634_0025203_30_860 274
228 3300046681 Ga0495647_0000019 Ga0495647_0000019_40724_41557 274
229 3300046690 Ga0495624_0000030 Ga0495624_0000030_64085_64918 274
230 3300047321 Ga0495676_0062916 Ga0495676_0062916_105_929 274
231 3300047322 Ga0495680_0008124 Ga0495680_0008124_42_872 274
232 3300048089 Ga0495614_0122583 Ga0495614_0122583_149_973 274
233 3300048909 Ga0496106_0002378 Ga0496106_0002378_9147_9980 274
234 3300048911 Ga0496108_0000133 Ga0496108_0000133_36592_37416 274
235 3300048912 Ga0496109_0000021 Ga0496109_0000021_149138_149962 274
236 3300048913 Ga0496110_0138704 Ga0496110_0138704_1033_1857 274
237 3300048914 Ga0496111_0026675 Ga0496111_0026675_3091_3915 274
238 3300048917 Ga0496114_0062324 Ga0496114_0062324_760_1584 274
239 3300048919 Ga0496116_0000441 Ga0496116_0000441_31671_32498 274
240 3300048920 Ga0496117_0024800 Ga0496117_0024800_139_966 274
241 3300048921 Ga0496118_0004781 Ga0496118_0004781_14216_15043 274
242 3300048921 Ga0496118_0124611 Ga0496118_0124611_81_908 274
243 3300048922 Ga0496119_0001437 Ga0496119_0001437_2174_3001 274
244 3300048922 Ga0496119_0222229 Ga0496119_0222229_84_908 274
245 3300048924 Ga0496121_0159328 Ga0496121_0159328_694_1521 274
246 3300048924 Ga0496121_0355915 Ga0496121_0355915_96_923 274
247 3300048924 Ga0496121_0358271 Ga0496121_0358271_96_920 274
248 3300048927 Ga0496124_0026726 Ga0496124_0026726_3090_3914 274
249 3300048927 Ga0496124_0358905 Ga0496124_0358905_79_906 274
250 3300048928 Ga0496125_0055223 Ga0496125_0055223_2014_2841 274
251 3300049581 Ga0501047_0101267 Ga0501047_0101267_994_1821 274
252 3300049586 Ga0501070_0014432 Ga0501070_0014432_384_1217 274
253 3300049590 Ga0501074_0091195 Ga0501074_0091195_1220_2050 274
254 3300049744 Ga0501083_0002702 Ga0501083_0002702_5918_6745 274
255 3300049823 Ga0501044_0257424 Ga0501044_0257424_754_1581 274
256 3300053077 Ga0495601_0030008 Ga0495601_0030008_1220_2047 274
257 3300053077 Ga0495601_0131993 Ga0495601_0131993_481_1317 274
258 3300053085 Ga0495619_0000032 Ga0495619_0000032_89705_90529 274
259 3300053085 Ga0495619_0165637 Ga0495619_0165637_408_1235 274
260 3300053119 Ga0500595_030451 Ga0500595_030451_814_1641 274
261 3300005329 Ga0070683_100011794 Ga0070683_1000117942 275
262 3300005329 Ga0070683_100227072 Ga0070683_1002270722 275
263 3300005335 Ga0070666_10014197 Ga0070666_100141976 275
264 3300005337 Ga0070682_100000049 Ga0070682_100000049115 275
265 3300005365 Ga0070688_100000345 Ga0070688_1000003453 275
266 3300005366 Ga0070659_100003813 Ga0070659_1000038135 275
267 3300005436 Ga0070713_100023462 Ga0070713_1000234623 275
268 3300005438 Ga0070701_10035432 Ga0070701_100354322 275
269 3300005459 Ga0068867_100000145 Ga0068867_10000014537 275
270 3300005466 Ga0070685_10000025 Ga0070685_10000025104 275
271 3300005535 Ga0070684_100041058 Ga0070684_1000410585 275
272 3300005548 Ga0070665_100000783 Ga0070665_10000078342 275
273 3300005578 Ga0068854_100000090 Ga0068854_10000009038 275
274 3300005578 Ga0068854_100292551 Ga0068854_1002925512 275
275 3300005614 Ga0068856_100019936 Ga0068856_1000199364 275
276 3300005616 Ga0068852_100000006 Ga0068852_10000000678 275
277 3300005616 Ga0068852_100055020 Ga0068852_1000550202 275
278 3300005834 Ga0068851_10001723 Ga0068851_100017238 275
279 3300006358 Ga0068871_100322367 Ga0068871_1003223671 275
280 3300006852 Ga0075433_10085528 Ga0075433_100855283 275
281 3300006881 Ga0068865_100000023 Ga0068865_10000002320 275
282 3300009098 Ga0105245_10000662 Ga0105245_1000066220 275
283 3300009098 Ga0105245_10006750 Ga0105245_1000675010 275
284 3300009174 Ga0105241_10036957 Ga0105241_100369572 275
285 3300009177 Ga0105248_10000008 Ga0105248_10000008241 275
286 3300010375 Ga0105239_10202063 Ga0105239_102020632 275
287 3300010375 Ga0105239_10289356 Ga0105239_102893562 275
288 3300013105 Ga0157369_10000020 Ga0157369_10000020116 275
289 3300013297 Ga0157378_10027769 Ga0157378_100277696 275
290 3300013297 Ga0157378_10051316 Ga0157378_100513162 275
291 3300013307 Ga0157372_10000253 Ga0157372_1000025323 275
292 3300014326 Ga0157380_10000037 Ga0157380_1000003721 275
293 3300014969 Ga0157376_10243743 Ga0157376_102437432 275
294 3300020081 Ga0206354_11205533 Ga0206354_112055331 275
295 3300020610 Ga0154015_1575933 Ga0154015_15759331 275
296 3300025321 Ga0207656_10001124 Ga0207656_100011246 275
297 3300025903 Ga0207680_10009271 Ga0207680_100092716 275
298 3300025927 Ga0207687_10000007 Ga0207687_10000007503 275
299 3300025927 Ga0207687_10002371 Ga0207687_100023717 275
300 3300025928 Ga0207700_10016110 Ga0207700_100161102 275
301 3300025932 Ga0207690_10001511 Ga0207690_100015119 275
302 3300025938 Ga0207704_10000068 Ga0207704_1000006856 275
303 3300025941 Ga0207711_10000006 Ga0207711_10000006635 275
304 3300025941 Ga0207711_10376499 Ga0207711_103764991 275
305 3300025944 Ga0207661_10000056 Ga0207661_1000005617 275
306 3300025944 Ga0207661_10001306 Ga0207661_1000130614 275
307 3300025981 Ga0207640_10000178 Ga0207640_1000017828 275
308 3300026078 Ga0207702_10015866 Ga0207702_100158665 275
309 3300026089 Ga0207648_10000573 Ga0207648_1000057336 275
310 3300026116 Ga0207674_10045249 Ga0207674_100452496 275
311 3300026142 Ga0207698_10000013 Ga0207698_10000013111 275
312 3300026142 Ga0207698_10431474 Ga0207698_104314742 275
313 3300045976 Ga0466967_0000015 Ga0466967_0000015_50911_51738 275
314 3300046461 Ga0495641_0032085 Ga0495641_0032085_901_1728 275
315 3300046492 Ga0495585_0123785 Ga0495585_0123785_102_929 275
316 3300046511 Ga0495608_0000060 Ga0495608_0000060_42098_42925 275
317 3300046660 Ga0495625_0009780 Ga0495625_0009780_6283_7113 275
318 3300046674 Ga0495588_0000134 Ga0495588_0000134_73663_74490 275
319 3300046675 Ga0495657_0000004 Ga0495657_0000004_220374_221201 275
320 3300046681 Ga0495647_0003004 Ga0495647_0003004_904_1731 275
321 3300046683 Ga0495658_0006767 Ga0495658_0006767_3067_3894 275
322 3300046689 Ga0495613_0000197 Ga0495613_0000197_39411_40238 275
323 3300046690 Ga0495624_0004937 Ga0495624_0004937_7489_8316 275
324 3300047317 Ga0495604_0000155 Ga0495604_0000155_10814_11641 275
325 3300047317 Ga0495604_0053094 Ga0495604_0053094_1971_2798 275
326 3300047444 Ga0495675_0000040 Ga0495675_0000040_40194_41021 275
327 3300047444 Ga0495675_0061900 Ga0495675_0061900_637_1467 275
328 3300047673 Ga0495593_0147095 Ga0495593_0147095_42_869 275
329 3300048088 Ga0495602_0000070 Ga0495602_0000070_48447_49274 275
330 3300048911 Ga0496108_0000146 Ga0496108_0000146_8043_8870 275
331 3300048912 Ga0496109_0000060 Ga0496109_0000060_106578_107405 275
332 3300048915 Ga0496112_0012069 Ga0496112_0012069_6826_7653 275
333 3300048916 Ga0496113_0002589 Ga0496113_0002589_8012_8839 275
334 3300050515 nmdc:mga0a205_8661_c1 nmdc:mga0a205_8661_c1_2012_2839 275
335 3300053077 Ga0495601_0000032 Ga0495601_0000032_27115_27942 275
336 3300053083 Ga0495655_0001621 Ga0495655_0001621_1232_2059 275
337 3300053084 Ga0495595_0000003 Ga0495595_0000003_220374_221201 275
338 3300053084 Ga0495595_0049358 Ga0495595_0049358_270_1097 275
339 3300053085 Ga0495619_0000137 Ga0495619_0000137_8389_9216 275
340 3300053085 Ga0495619_0000404 Ga0495619_0000404_25711_26538 275
341 3300001979 JGI24740J21852_10011283 JGI24740J21852_100112833 276
342 3300005333 Ga0070677_10000001 Ga0070677_1000000185 276
343 3300005337 Ga0070682_100000028 Ga0070682_10000002878 276
344 3300005341 Ga0070691_10000001 Ga0070691_1000000197 276
345 3300005456 Ga0070678_100297655 Ga0070678_1002976552 276
346 3300005535 Ga0070684_100279341 Ga0070684_1002793412 276
347 3300005539 Ga0068853_100006633 Ga0068853_1000066332 276
348 3300005539 Ga0068853_100311008 Ga0068853_1003110082 276
349 3300005548 Ga0070665_100000068 Ga0070665_100000068199 276
350 3300005841 Ga0068863_100001412 Ga0068863_1000014123 276
351 3300005842 Ga0068858_100000012 Ga0068858_10000001249 276
352 3300005843 Ga0068860_100044417 Ga0068860_1000444174 276
353 3300005844 Ga0068862_100653076 Ga0068862_1006530761 276
354 3300005983 Ga0081540_1034551 Ga0081540_10345512 276
355 3300009093 Ga0105240_10403504 Ga0105240_104035042 276
356 3300009098 Ga0105245_10001882 Ga0105245_100018825 276
357 3300009098 Ga0105245_10023182 Ga0105245_100231824 276
358 3300009101 Ga0105247_10030180 Ga0105247_100301804 276
359 3300009176 Ga0105242_10000051 Ga0105242_1000005133 276
360 3300009551 Ga0105238_10000023 Ga0105238_1000002374 276
361 3300009553 Ga0105249_10000074 Ga0105249_1000007449 276
362 3300013296 Ga0157374_10098359 Ga0157374_100983593 276
363 3300013306 Ga0163162_10188471 Ga0163162_101884712 276
364 3300014968 Ga0157379_10102284 Ga0157379_101022843 276
365 3300025893 Ga0207682_10000034 Ga0207682_1000003437 276
366 3300025924 Ga0207694_10000004 Ga0207694_10000004762 276
367 3300025927 Ga0207687_10000026 Ga0207687_1000002647 276
368 3300025927 Ga0207687_10000055 Ga0207687_1000005582 276
369 3300025934 Ga0207686_10000083 Ga0207686_1000008358 276
370 3300025961 Ga0207712_10000007 Ga0207712_1000000751 276
371 3300026035 Ga0207703_10000310 Ga0207703_1000031037 276
372 3300026035 Ga0207703_10056063 Ga0207703_100560634 276
373 3300026041 Ga0207639_10004273 Ga0207639_100042734 276
374 3300026088 Ga0207641_10001999 Ga0207641_1000199914 276
375 3300028379 Ga0268266_10000020 Ga0268266_10000020206 276
376 3300028381 Ga0268264_10003178 Ga0268264_1000317813 276
377 3300035172 Ga0373955_0086064 Ga0373955_0086064_860_1702 276
378 3300036401 Ga0373937_0103119 Ga0373937_0103119_49_888 276
379 3300041512 Ga0451853_0459676 Ga0451853_0459676_2640_3479 276
380 3300041512 Ga0451853_1568077 Ga0451853_1568077_396_1226 276
381 3300044694 Ga0466963_0000062 Ga0466963_0000062_20103_20942 276
382 3300044842 Ga0466957_0007837 Ga0466957_0007837_4758_5588 276
383 3300046454 Ga0495592_0068876 Ga0495592_0068876_851_1687 276
384 3300046455 Ga0495603_0001639 Ga0495603_0001639_830_1669 276
385 3300046459 Ga0495629_0000919 Ga0495629_0000919_4349_5179 276
386 3300046459 Ga0495629_0115619 Ga0495629_0115619_1008_1841 276
387 3300046461 Ga0495641_0000003 Ga0495641_0000003_62410_63252 276
388 3300046514 Ga0495618_0000053 Ga0495618_0000053_31865_32704 276
389 3300046515 Ga0495620_0000205 Ga0495620_0000205_40515_41354 276
390 3300046516 Ga0495628_0154523 Ga0495628_0154523_776_1615 276
391 3300046678 Ga0495599_0143743 Ga0495599_0143743_63_902 276
392 3300046689 Ga0495613_0000042 Ga0495613_0000042_64377_65216 276
393 3300046694 Ga0495649_0081874 Ga0495649_0081874_806_1645 276
394 3300047321 Ga0495676_0000903 Ga0495676_0000903_14275_15117 276
395 3300047321 Ga0495676_0007950 Ga0495676_0007950_6247_7080 276
396 3300047322 Ga0495680_0000196 Ga0495680_0000196_63754_64593 276
397 3300047322 Ga0495680_0159908 Ga0495680_0159908_679_1512 276
398 3300048903 Ga0496100_0000005 Ga0496100_0000005_227193_228032 276
399 3300048903 Ga0496100_0000007 Ga0496100_0000007_5929_6768 276
400 3300048904 Ga0496101_0000013 Ga0496101_0000013_5929_6768 276
401 3300048904 Ga0496101_0000022 Ga0496101_0000022_13654_14493 276
402 3300048905 Ga0496102_0000115 Ga0496102_0000115_48089_48922 276
403 3300048905 Ga0496102_0132503 Ga0496102_0132503_1428_2261 276
404 3300048906 Ga0496103_0000008 Ga0496103_0000008_55114_55947 276
405 3300048906 Ga0496103_0073181 Ga0496103_0073181_1030_1863 276
406 3300048907 Ga0496104_0000013 Ga0496104_0000013_282045_282884 276
407 3300048907 Ga0496104_0000190 Ga0496104_0000190_16796_17632 276
408 3300048908 Ga0496105_0000006 Ga0496105_0000006_114280_115119 276
409 3300048908 Ga0496105_0000197 Ga0496105_0000197_25286_26122 276
410 3300048909 Ga0496106_0000006 Ga0496106_0000006_68_907 276
411 3300048909 Ga0496106_0000333 Ga0496106_0000333_6697_7536 276
412 3300048910 Ga0496107_0000007 Ga0496107_0000007_70_909 276
413 3300048910 Ga0496107_0000011 Ga0496107_0000011_83851_84690 276
414 3300048911 Ga0496108_0000001 Ga0496108_0000001_324579_325415 276
415 3300048912 Ga0496109_0000006 Ga0496109_0000006_324579_325415 276
416 3300048912 Ga0496109_0284911 Ga0496109_0284911_227_1060 276
417 3300048917 Ga0496114_0000088 Ga0496114_0000088_64426_65256 276
418 3300048918 Ga0496115_0000119 Ga0496115_0000119_6455_7285 276
419 3300048921 Ga0496118_0228524 Ga0496118_0228524_109_942 276
420 3300053077 Ga0495601_0000045 Ga0495601_0000045_10264_11103 276
421 3300053083 Ga0495655_0000001 Ga0495655_0000001_349565_350398 276
422 3300053084 Ga0495595_0002731 Ga0495595_0002731_5245_6084 276
423 3300053094 Ga0500566_0003977 Ga0500566_0003977_6258_7088 276
424 3300053123 Ga0500614_000116 Ga0500614_000116_10346_11188 276
425 3300053129 Ga0500628_000020 Ga0500628_000020_38908_39741 276
426 3300046536 Ga0495587_0006816 Ga0495587_0006816_3908_4783 278
427 3300039438 Ga0436360_0782477 Ga0436360_0782477_1480_2376 284
428 3300046516 Ga0495628_0010707 Ga0495628_0010707_3879_4754 287
429 3300048088 Ga0495602_0000533 Ga0495602_0000533_24488_25363 287
430 3300000546 LJNas_1009174 LJNas_10091741 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

33

272

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gd5-assembly1.cif.gz_A x-ray crystal structure of a putative phosphate abc transporter substrate-binding protein with bound phosphate from clostridium perfringens 0.9451 42 287
4gd5-assembly1.cif.gz_A x-ray crystal structure of a putative phosphate abc transporter substrate-binding protein with bound phosphate from clostridium perfringens 0.9338 42 287
4ecf-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport system, periplasmic component (lvis_0633) from lactobacillus brevis atcc 367 at 1.55 a resolution 0.892 40 286
4omb-assembly4.cif.gz_D phosphate binding protein 0.886 36 287
4pqj-assembly1.cif.gz_A crystal structure of a phosphate binding protein 0.8856 40 287
ID Description Score Start End Superfamily
4ecfA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9403 115 230 3.40.190.10
4q8rA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9393 116 245 3.40.190.10
4pqjA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9378 117 226 3.40.190.10
4exlD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9378 116 237 3.40.190.10
4q8rA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9322 116 245 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A842KMQ3-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.957 38 287 GO:0016020
GO:0042301
AF-A0A7C2FL66-F1-model_v4 Phosphate ABC transporter substrate-binding protein 0.9533 40 287
AF-A0A347AGD3-F1-model_v4 Phosphate-binding protein 0.9509 40 292 GO:0016020
GO:0042301
AF-A0A212KAQ7-F1-model_v4 Phosphate-binding protein 0.9505 40 287 GO:0005886
GO:0006817
GO:0042301
AF-A0A0S8CHM3-F1-model_v4 Phosphate-binding protein 0.9504 42 227 GO:0006817
GO:0042301

Feature Viewer

pLDDT pTM Quality
86.98 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map