metagRoot

F442099

General Info

Members	Datasets	Scaffolds	Average Seq Length
430	327	379	206

Family's Representative Sequence

Representative Sequence	3300005937\|Ga0081455_10067543\|Ga0081455_100675432
Length	258
Sequence	LILDLWPHLLAAAQIIWINVILSGDNAVVIALACRGLPPKQRKWGMILGAGAAVLLRVFFTLIVVQLLATPFLKLVGGVLLLWIAVKLIGEDEGDAKEDSIKASDRLTRAVWTVTVADAVMSLDNVLAIAGIAQNNQAMLIFGLAVSIPLIVAGAGLIVTLLDRFPILVWAGAGLLGWVAAEMIVTDMILLQWLQANYPSWLKAVPPEVSAFGYVPIGLIKYSAATAGVLFVLAMGYWLKKSRGEPLVEEGHPEQEPR

Samples

	Sample ID	Description	Type	Environment
1	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
2	2513020051	Variovorax sp. CF313	Isolate	Rhizosphere
3	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
4	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
5	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
6	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
7	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
8	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
9	2643221658	Variovorax sp. Root411	Isolate	Unclassified
10	2643221672	Variovorax sp. Root434	Isolate	Unclassified
11	2643221683	Variovorax sp. Root473	Isolate	Unclassified
12	2738541277	Variovorax sp. GV051	Isolate	Unclassified
13	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
14	2738541307	Variovorax sp. GV008	Isolate	Unclassified
15	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
16	2738543019	Variovorax sp. GV040	Isolate	Unclassified
17	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
18	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
19	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
20	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
21	2818991446	Variovorax sp. 1180	Isolate	Unclassified
22	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
23	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
24	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
25	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
26	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
27	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
28	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
29	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
30	2885198086	Variovorax sp. 679	Isolate	Unclassified
31	2885211737	Variovorax sp. 553	Isolate	Unclassified
32	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
33	2899924645	Variovorax sp. 369	Isolate	Unclassified
34	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
35	2904456579	Variovorax sp. 2002	Isolate	Unclassified
36	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
37	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
38	2928037797	Variovorax sp. 1126	Isolate	Unclassified
39	2928044640	Variovorax sp. 1128	Isolate	Unclassified
40	2928051484	Variovorax sp. 1133	Isolate	Unclassified
41	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
42	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
43	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
44	2928115317	Pseudacidovorax sp. 1753	Isolate	Rhizosphere
45	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
46	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
47	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
48	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
49	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
50	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
51	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
52	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
53	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
54	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
55	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
56	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
57	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
58	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
59	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
60	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
61	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
62	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
63	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
64	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
65	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
66	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
67	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
68	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
69	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
70	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
71	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
72	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
73	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
74	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
75	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
76	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
77	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
78	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
79	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
80	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
81	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
82	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
83	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
84	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
85	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
86	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
87	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
88	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
89	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
90	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
91	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
92	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
93	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
94	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
95	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
96	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
97	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
98	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
99	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
100	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
101	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
102	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
103	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
104	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
105	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
106	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
107	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
108	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
109	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
110	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
111	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
112	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
113	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
114	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
115	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
116	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
117	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
118	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
119	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
120	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
121	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
122	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
123	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
124	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
125	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
126	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
127	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
128	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
130	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
132	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
133	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
134	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
135	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
136	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
137	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
138	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
139	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
140	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
141	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
142	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
143	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
144	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
145	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
146	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
147	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
148	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
149	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
150	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
151	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
152	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
157	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
158	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
159	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
160	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
161	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
162	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
163	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
164	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
165	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
166	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
169	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
207	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
208	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
209	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
210	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
211	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
212	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
213	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
214	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
215	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
216	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
217	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
218	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
219	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
220	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
221	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
222	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
223	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
224	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
225	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
226	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
227	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
228	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
229	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
230	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
231	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
232	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
233	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
234	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
235	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
236	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
237	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
238	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
239	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
240	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
241	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
242	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
243	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
244	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
245	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
246	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
247	3300042123	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228	Metagenome	Rhizosphere
248	3300042128	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123	Metagenome	Rhizosphere
249	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
250	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
251	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
252	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
253	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
254	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
255	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
256	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
257	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
258	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
259	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
260	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
261	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
262	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
263	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
264	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
265	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
266	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
267	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
268	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
269	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
270	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
271	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
272	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
273	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
274	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
275	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
276	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
277	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
278	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
279	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
280	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
281	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
282	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
283	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
284	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
285	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
286	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
287	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
288	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
289	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
290	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
291	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
292	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
293	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
294	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
295	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
296	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
297	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
298	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
299	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
300	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
301	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
302	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
303	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
304	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
305	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
306	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
307	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
308	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
309	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
310	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
311	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
312	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
313	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
314	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
315	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
316	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
317	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
318	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
319	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
320	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
321	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
322	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
323	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
324	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
325	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
326	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
327	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	87.91
Metatranscriptomes	0.23
Isolates	11.86

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	25.35
Nodule	0.93
Rhizoplane	3.02
Rhizosphere	60
Stem	0
Stem Tuber	0
Unclassified	10.7

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10004112	3300001979	Bacteria	6288
2	JGI24739J22299_10013399	3300001989	Bacteria	2994
3	JGI25152J39213_1001493	3300002773	Bacteria	9968
4	JGI25152J39213_1004128	3300002773	Bacteria	4689
5	JGI25150J39212_1003703	3300002774	Bacteria	3534
6	JGI25159J45721_1012615	3300002987	Bacteria	2006
7	JGI25151J46595_10007461	3300003187	Bacteria	5352
8	JGI25151J46595_10008176	3300003187	Bacteria	5056
9	JGI25153J46596_10008131	3300003215	Bacteria	5056
10	JGI25153J46596_10009112	3300003215	Bacteria	4657
11	JGI25160J50197_1020004	3300003354	Bacteria	2033
12	JGI25160J50197_1020336	3300003354	Bacteria	2006
13	JGI25161J50226_1003498	3300003374	Bacteria	3575
14	JGI25161J50226_1006815	3300003374	Bacteria	2006
15	Ga0006562J51391_1009735	3300003578	Bacteria	6420
16	Ga0055535_1000185	3300003761	Bacteria	66514
17	Ga0055542_1000003	3300003762	Bacteria	582721
18	Ga0055526_1024004	3300003771	Bacteria	2012
19	Ga0055526_1024093	3300003771	Bacteria	2006
20	Ga0055537_1000137	3300003773	Bacteria	54996
21	Ga0055537_1003114	3300003773	Bacteria	5209
22	Ga0055524_1023086	3300003775	Bacteria	2012
23	Ga0055524_1023173	3300003775	Bacteria	2006
24	Ga0055536_1002214	3300003781	Bacteria	11070
25	Ga0055536_1006668	3300003781	Bacteria	5315
26	Ga0055536_1016581	3300003781	Bacteria	2456
27	Ga0055534_1007847	3300003784	Bacteria	2487
28	Ga0055534_1010057	3300003784	Bacteria	2006
29	Ga0055528_1017360	3300003790	Bacteria	2499
30	Ga0055528_1021930	3300003790	Bacteria	2006
31	Ga0055530_10000417	3300003791	Bacteria	37918
32	Ga0055540_1002066	3300003792	Bacteria	11066
33	Ga0055540_1017365	3300003792	Bacteria	2012
34	Ga0055540_1019681	3300003792	Bacteria	1812
35	Ga0055531_10027231	3300003794	Bacteria	2012
36	Ga0055531_10027316	3300003794	Bacteria	2006
37	Ga0055543_1005467	3300004625	Bacteria	3234
38	Ga0055543_1006918	3300004625	Bacteria	2679
39	Ga0065165_1003839	3300005262	Bacteria	10006
40	Ga0065165_1008446	3300005262	Bacteria	4816
41	Ga0065714_10162126	3300005288	Bacteria	1046
42	Ga0065707_10214625	3300005295	Bacteria	1250
43	Ga0070658_10010518	3300005327	Bacteria	7414
44	Ga0070677_10076796	3300005333	Bacteria	1419
45	Ga0068868_100123629	3300005338	Bacteria	2112
46	Ga0070691_10061914	3300005341	Bacteria	1801
47	Ga0070668_100339466	3300005347	Bacteria	1269
48	Ga0070668_100393922	3300005347	Bacteria	1181
49	Ga0070669_100044613	3300005353	Bacteria	3230
50	Ga0070669_100304440	3300005353	Bacteria	1283
51	Ga0070675_100572159	3300005354	Bacteria	1023
52	Ga0070674_100063672	3300005356	Bacteria	2582
53	Ga0070674_100238703	3300005356	Bacteria	1422
54	Ga0070674_100458205	3300005356	Bacteria	1054
55	Ga0070673_100247467	3300005364	Bacteria	1552
56	Ga0070667_100771232	3300005367	Bacteria	892
57	Ga0070700_100012778	3300005441	Bacteria	4701
58	Ga0070663_100107193	3300005455	Bacteria	2094
59	Ga0070678_100019292	3300005456	Bacteria	4442
60	Ga0070678_100283481	3300005456	Bacteria	1402
61	Ga0070678_100315585	3300005456	Bacteria	1333
62	Ga0070681_10255608	3300005458	Bacteria	1664
63	Ga0070681_10333984	3300005458	Bacteria	1425
64	Ga0070681_10451041	3300005458	Bacteria	1198
65	Ga0068867_100001075	3300005459	Bacteria	18682
66	Ga0070679_100047658	3300005530	Bacteria	4270
67	Ga0070679_100750317	3300005530	Bacteria	919
68	Ga0070697_100469284	3300005536	Bacteria	1098
69	Ga0068853_100260776	3300005539	Bacteria	1593
70	Ga0068853_100646853	3300005539	Bacteria	1006
71	Ga0070672_100150856	3300005543	Bacteria	1923
72	Ga0070686_100136603	3300005544	Bacteria	1702
73	Ga0070665_100106854	3300005548	Bacteria	2801
74	Ga0070704_100154867	3300005549	Bacteria	1806
75	Ga0068855_100024587	3300005563	Bacteria	7206
76	Ga0068852_100497832	3300005616	Bacteria	1213
77	Ga0068859_100364697	3300005617	Bacteria	1540
78	Ga0068864_100123270	3300005618	Bacteria	2320
79	Ga0068866_10005806	3300005718	Bacteria	5122
80	Ga0068861_100002535	3300005719	Bacteria	11933
81	Ga0068851_10014707	3300005834	Bacteria	3719
82	Ga0068863_100037561	3300005841	Bacteria	4611
83	Ga0068860_100004588	3300005843	Bacteria	14099
84	Ga0068862_100016775	3300005844	Bacteria	6098
85	Ga0081455_10007375	3300005937	Bacteria	11595
86	Ga0081455_10067543	3300005937	Bacteria	2978
87	Ga0081540_1082175	3300005983	Bacteria	1446
88	Ga0075365_10066916	3300006038	Bacteria	2411
89	Ga0075363_100168286	3300006048	Bacteria	1243
90	Ga0075364_10021035	3300006051	Bacteria	4109
91	Ga0075364_10133845	3300006051	Bacteria	1665
92	Ga0075364_10393944	3300006051	Bacteria	945
93	Ga0075432_10027422	3300006058	Bacteria	1961
94	Ga0070716_100063579	3300006173	Bacteria	2143
95	Ga0075362_10012340	3300006177	Bacteria	3392
96	Ga0075362_10052320	3300006177	Bacteria	1830
97	Ga0075367_10024344	3300006178	Bacteria	3413
98	Ga0075369_10054101	3300006186	Bacteria	1743
99	Ga0075366_10011731	3300006195	Bacteria	4953
100	Ga0075366_10077489	3300006195	Bacteria	1984
101	Ga0075366_10146181	3300006195	Bacteria	1430
102	Ga0075366_10217227	3300006195	Bacteria	1165
103	Ga0075370_10003458	3300006353	Bacteria	7523
104	Ga0075370_10128075	3300006353	Bacteria	1480
105	Ga0075370_10169596	3300006353	Bacteria	1283
106	Ga0075370_10236080	3300006353	Bacteria	1082
107	Ga0075428_100163264	3300006844	Bacteria	2417
108	Ga0075431_100018872	3300006847	Bacteria	7025
109	Ga0068865_100001091	3300006881	Bacteria	15643
110	Ga0075436_100078144	3300006914	Bacteria	2293
111	Ga0097620_100364706	3300006931	Bacteria	1540
112	Ga0099794_10024591	3300007265	Bacteria	2766
113	Ga0105240_10054158	3300009093	Bacteria	5029
114	Ga0105240_10069183	3300009093	Bacteria	4370
115	Ga0111539_10189953	3300009094	Bacteria	2397
116	Ga0105245_10586635	3300009098	Bacteria	1140
117	Ga0114129_10148222	3300009147	Bacteria	3213
118	Ga0105243_10001538	3300009148	Bacteria	20170
119	Ga0105243_10234630	3300009148	Bacteria	1629
120	Ga0105243_10351801	3300009148	Bacteria	1353
121	Ga0105248_10132584	3300009177	Bacteria	2811
122	Ga0105238_10009243	3300009551	Bacteria	9864
123	Ga0105238_10876911	3300009551	Bacteria	915
124	Ga0099796_10059401	3300010159	Bacteria	1350
125	Ga0105239_10827030	3300010375	Bacteria	1061
126	Ga0105246_10082344	3300011119	Bacteria	2296
127	Ga0105246_10100467	3300011119	Bacteria	2105
128	Ga0105246_10236475	3300011119	Bacteria	1442
129	Ga0157373_10001092	3300013100	Bacteria	20868
130	Ga0157371_10075721	3300013102	Bacteria	2383
131	Ga0157370_10696741	3300013104	Bacteria	927
132	Ga0157369_10591083	3300013105	Bacteria	1146
133	Ga0157378_10025881	3300013297	Bacteria	5169
134	Ga0163162_10026647	3300013306	Bacteria	5714
135	Ga0157372_10062700	3300013307	Bacteria	4166
136	Ga0157380_10045379	3300014326	Bacteria	3449
137	Ga0157380_10073883	3300014326	Bacteria	2766
138	Ga0157380_10584256	3300014326	Bacteria	1102
139	Ga0182008_10037332	3300014497	Bacteria	2430
140	Ga0182008_10039797	3300014497	Bacteria	2349
141	Ga0182008_10040405	3300014497	Bacteria	2329
142	Ga0182008_10163409	3300014497	Bacteria	1121
143	Ga0157377_10276836	3300014745	Bacteria	1098
144	Ga0157379_10065957	3300014968	Bacteria	3236
145	Ga0182006_1068741	3300015261	Bacteria	1318
146	Ga0182007_10043365	3300015262	Bacteria	1495
147	Ga0182005_1025592	3300015265	Bacteria	1610
148	Ga0163161_10055200	3300017792	Bacteria	2883
149	Ga0163161_10069850	3300017792	Bacteria	2568
150	Ga0163161_10117966	3300017792	Bacteria	1991
151	Ga0163161_10119125	3300017792	Bacteria	1982
152	Ga0209436_106044	3300025208	Bacteria	2701
153	Ga0209672_100279	3300025228	Bacteria	37019
154	Ga0209147_101718	3300025229	Bacteria	7099
155	Ga0209258_100015	3300025242	Bacteria	706310
156	Ga0207425_1000323	3300025245	Bacteria	34164
157	Ga0207425_1016459	3300025245	Bacteria	1639
158	Ga0209148_1000028	3300025254	Bacteria	582773
159	Ga0209129_1000160	3300025258	Bacteria	102457
160	Ga0209129_1000922	3300025258	Bacteria	17917
161	Ga0209565_1000762	3300025263	Bacteria	18882
162	Ga0209565_1001106	3300025263	Bacteria	13233
163	Ga0209673_1002146	3300025273	Bacteria	14645
164	Ga0209673_1002371	3300025273	Bacteria	13232
165	Ga0209130_1000730	3300025284	Bacteria	29014
166	Ga0209130_1001293	3300025284	Bacteria	17280
167	Ga0209675_1000322	3300025291	Bacteria	42911
168	Ga0209675_1005147	3300025291	Bacteria	5560
169	Ga0209675_1016608	3300025291	Bacteria	2134
170	Ga0209676_1000074	3300025292	Bacteria	305770
171	Ga0209676_1000303	3300025292	Bacteria	98589
172	Ga0209676_1023569	3300025292	Bacteria	2011
173	Ga0209676_1026736	3300025292	Bacteria	1827
174	Ga0209676_1043879	3300025292	Bacteria	1231
175	Ga0209025_1000656	3300025294	Bacteria	60251
176	Ga0209025_1002400	3300025294	Bacteria	19983
177	Ga0209025_1057457	3300025294	Bacteria	1487
178	Ga0209564_1000346	3300025295	Bacteria	87680
179	Ga0209564_1002089	3300025295	Bacteria	17116
180	Ga0209758_1000039	3300025297	Bacteria	428951
181	Ga0209758_1010404	3300025297	Bacteria	5571
182	Ga0209050_1000015	3300025298	Bacteria	759102
183	Ga0209050_1006108	3300025298	Bacteria	7266
184	Ga0209256_1000136	3300025299	Bacteria	159047
185	Ga0209256_1000382	3300025299	Bacteria	70823
186	Ga0207426_1000108	3300025302	Bacteria	242257
187	Ga0207426_1000130	3300025302	Bacteria	210271
188	Ga0207426_1001644	3300025302	Bacteria	17444
189	Ga0209051_1000010	3300025303	Bacteria	641298
190	Ga0209051_1000361	3300025303	Bacteria	66865
191	Ga0209051_1013082	3300025303	Bacteria	3969
192	Ga0209257_1000026	3300025304	Bacteria	723225
193	Ga0209257_1001232	3300025304	Bacteria	31783
194	Ga0209257_1025051	3300025304	Bacteria	2048
195	Ga0209257_1028391	3300025304	Bacteria	1842
196	Ga0207656_10010226	3300025321	Bacteria	3507
197	Ga0207682_10039859	3300025893	Bacteria	1911
198	Ga0207642_10258724	3300025899	Bacteria	991
199	Ga0207688_10100269	3300025901	Bacteria	1671
200	Ga0207643_10272280	3300025908	Bacteria	1048
201	Ga0207705_10069070	3300025909	Bacteria	2558
202	Ga0207707_10375344	3300025912	Bacteria	1223
203	Ga0207695_10072730	3300025913	Bacteria	3506
204	Ga0207695_10108110	3300025913	Bacteria	2766
205	Ga0207671_10518509	3300025914	Bacteria	950
206	Ga0207660_10062355	3300025917	Bacteria	2685
207	Ga0207652_10033948	3300025921	Bacteria	4298
208	Ga0207681_10019209	3300025923	Bacteria	4316
209	Ga0207709_10000290	3300025935	Bacteria	57108
210	Ga0207709_10241911	3300025935	Bacteria	1313
211	Ga0207709_10270511	3300025935	Bacteria	1250
212	Ga0207669_10064573	3300025937	Bacteria	2266
213	Ga0207669_10109832	3300025937	Bacteria	1845
214	Ga0207704_10003340	3300025938	Bacteria	7283
215	Ga0207665_10016819	3300025939	Bacteria	4804
216	Ga0207711_10045024	3300025941	Bacteria	3770
217	Ga0207667_10233806	3300025949	Bacteria	1881
218	Ga0207712_10295492	3300025961	Bacteria	1327
219	Ga0207668_10153290	3300025972	Bacteria	1787
220	Ga0207668_10361971	3300025972	Bacteria	1216
221	Ga0207639_10022407	3300026041	Bacteria	4550
222	Ga0207639_10544541	3300026041	Bacteria	1065
223	Ga0207708_10009857	3300026075	Bacteria	7091
224	Ga0207648_10001410	3300026089	Bacteria	26468
225	Ga0207676_10100740	3300026095	Bacteria	2394
226	Ga0207674_10064454	3300026116	Bacteria	3696
227	Ga0207674_10205444	3300026116	Bacteria	1919
228	Ga0207675_100005656	3300026118	Bacteria	11969
229	Ga0207675_100372242	3300026118	Bacteria	1403
230	Ga0207683_10011783	3300026121	Bacteria	7460
231	Ga0207683_10097201	3300026121	Bacteria	2626
232	Ga0207698_10192635	3300026142	Bacteria	1818
233	Ga0209179_1001059	3300027512	Bacteria	3181
234	Ga0209970_1000984	3300027614	Bacteria	5065
235	Ga0209974_10032178	3300027876	Bacteria	1738
236	Ga0268266_10098510	3300028379	Bacteria	2572
237	Ga0268266_10637948	3300028379	Bacteria	1025
238	Ga0268265_10011833	3300028380	Bacteria	5898
239	Ga0268264_10023842	3300028381	Bacteria	4991
240	Ga0307517_10135223	3300028786	Bacteria	1756
241	Ga0307515_10000034	3300028794	Bacteria	344640
242	Ga0307515_10168025	3300028794	Bacteria	2201
243	Ga0307515_10242136	3300028794	Bacteria	1572
244	Ga0265327_10244337	3300031251	Bacteria	801
245	Ga0307408_100404816	3300031548	Bacteria	1172
246	Ga0307514_10009224	3300031649	Bacteria	8318
247	Ga0307405_10061958	3300031731	Bacteria	2366
248	Ga0307410_10145716	3300031852	Bacteria	1757
249	Ga0307412_10126273	3300031911	Bacteria	1850
250	Ga0307416_100143902	3300032002	Bacteria	2173
251	Ga0307416_100153787	3300032002	Bacteria	2114
252	Ga0307411_10208803	3300032005	Bacteria	1506
253	Ga0307411_10469367	3300032005	Bacteria	1057
254	Ga0307415_100102633	3300032126	Bacteria	2102
255	Ga0373926_0005870	3300035083	Bacteria	4059
256	Ga0373934_0001186	3300035086	Bacteria	9472
257	Ga0373923_0000319	3300035111	Bacteria	10771
258	Ga0373936_0001528	3300035113	Bacteria	8425
259	Ga0373945_0020892	3300035116	Bacteria	2245
260	Ga0373953_0000725	3300035117	Bacteria	9108
261	Ga0373954_0000616	3300035118	Bacteria	13589
262	Ga0373957_0015484	3300035120	Bacteria	2625
263	Ga0373943_0151823	3300035170	Bacteria	1255
264	Ga0373955_0038006	3300035172	Bacteria	2562
265	Ga0373924_0001035	3300035410	Bacteria	8835
266	Ga0373935_0028030	3300035692	Bacteria	3481
267	Ga0373927_0039465	3300035695	Bacteria	3064
268	Ga0373933_0045282	3300035724	Bacteria	2608
269	Ga0373947_0040806	3300035725	Bacteria	2766
270	Ga0395899_0014970	3300037312	Bacteria	5916
271	Ga0395900_0016714	3300037418	Bacteria	7484
272	Ga0395898_0006110	3300037466	Bacteria	12911
273	Ga0395905_0040705	3300037471	Bacteria	4359
274	Ga0395905_0432493	3300037471	Bacteria	1213
275	Ga0395901_0206303	3300038443	Bacteria	2059
276	Ga0436361_0210618	3300039447	Bacteria	20699
277	Ga0439436_0005351	3300041404	Bacteria	3937
278	Ga0439439_0017775	3300041406	Bacteria	1752
279	Ga0439465_0077616	3300041413	Bacteria	1121
280	Ga0451791_1229168	3300041451	Bacteria	1300
281	Ga0451807_1052585	3300041486	Bacteria	840
282	Ga0451839_0682680	3300041496	Bacteria	1169
283	Ga0439442_031027	3300042002	Bacteria	1116
284	Ga0439452_008838	3300042010	Bacteria	3005
285	Ga0439462_0005671	3300042015	Bacteria	3082
286	Ga0450921_000349	3300042123	Bacteria	2093
287	Ga0450897_002515	3300042128	Bacteria	1384
288	Ga0450894_026581	3300042131	Bacteria	795
289	Ga0450906_012397	3300042145	Bacteria	1580
290	Ga0450908_006279	3300042184	Bacteria	2262
291	Ga0450909_005926	3300042185	Bacteria	1764
292	Ga0439434_0028817	3300042435	Bacteria	1683
293	Ga0450918_001517	3300042531	Bacteria	4585
294	Ga0466960_0442031	3300044901	Bacteria	755
295	Ga0495592_0000725	3300046454	Bacteria	23069
296	Ga0495592_0015662	3300046454	Bacteria	5753
297	Ga0495641_0015575	3300046461	Bacteria	4050
298	Ga0495651_0004590	3300046462	Bacteria	10558
299	Ga0495653_0002911	3300046463	Bacteria	13684
300	Ga0495650_0122266	3300046471	Bacteria	957
301	Ga0495580_0113223	3300046472	Bacteria	1884
302	Ga0495582_0007738	3300046473	Bacteria	5940
303	Ga0495639_0002815	3300046475	Bacteria	7569
304	Ga0495639_0045042	3300046475	Bacteria	1995
305	Ga0495662_0039702	3300046476	Bacteria	2273
306	Ga0495664_0003815	3300046477	Bacteria	8220
307	Ga0495594_0006616	3300046499	Bacteria	5963
308	Ga0495618_0032298	3300046514	Bacteria	3278
309	Ga0495628_0009836	3300046516	Bacteria	8145
310	Ga0495637_0031484	3300046520	Bacteria	2345
311	Ga0495666_0001758	3300046526	Bacteria	10689
312	Ga0495652_0122661	3300046529	Bacteria	2069
313	Ga0495665_0004795	3300046531	Bacteria	7300
314	Ga0495640_0017584	3300046533	Bacteria	5322
315	Ga0495586_0003221	3300046535	Bacteria	8767
316	Ga0495587_0036424	3300046536	Bacteria	2959
317	Ga0495622_0016250	3300046557	Bacteria	3466
318	Ga0495667_0039083	3300046559	Bacteria	3157
319	Ga0495656_0007678	3300046615	Bacteria	3824
320	Ga0495656_0169952	3300046615	Bacteria	1065
321	Ga0495634_0005742	3300046642	Bacteria	9477
322	Ga0495625_0000098	3300046660	Bacteria	140987
323	Ga0495625_0438334	3300046660	Bacteria	809
324	Ga0495657_0003348	3300046675	Bacteria	13110
325	Ga0495599_0010584	3300046678	Bacteria	5644
326	Ga0495599_0122373	3300046678	Bacteria	1617
327	Ga0495658_0062507	3300046683	Bacteria	2140
328	Ga0495624_0012397	3300046690	Bacteria	5830
329	Ga0495624_0186418	3300046690	Bacteria	1263
330	Ga0495670_0036355	3300046691	Bacteria	2454
331	Ga0495600_0027837	3300046809	Bacteria	3654
332	Ga0495674_0004795	3300047319	Bacteria	13012
333	Ga0495680_0013508	3300047322	Bacteria	7121
334	Ga0495675_0003045	3300047444	Bacteria	10079
335	Ga0495684_0008344	3300047471	Bacteria	8030
336	Ga0495615_0006206	3300048090	Bacteria	2199
337	Ga0496100_0248729	3300048903	Bacteria	1314
338	Ga0496101_0855730	3300048904	Bacteria	716
339	Ga0496104_0076315	3300048907	Bacteria	3192
340	Ga0496105_0008359	3300048908	Bacteria	8042
341	Ga0496106_0193603	3300048909	Bacteria	1617
342	Ga0496108_0089397	3300048911	Bacteria	2618
343	Ga0496108_0533635	3300048911	Bacteria	1024
344	Ga0496109_0235957	3300048912	Bacteria	1721
345	Ga0496116_0151467	3300048919	Bacteria	1287
346	Ga0496117_0052630	3300048920	Bacteria	2866
347	Ga0496117_0257762	3300048920	Bacteria	947
348	Ga0496121_0071356	3300048924	Bacteria	2793
349	Ga0496122_0001296	3300048925	Bacteria	41334
350	Ga0496123_0001032	3300048926	Bacteria	42273
351	Ga0496124_0128902	3300048927	Bacteria	2012
352	Ga0496125_0064580	3300048928	Bacteria	2907
353	Ga0496125_0111152	3300048928	Bacteria	1984
354	Ga0501034_0009301	3300049571	Bacteria	10294
355	Ga0501038_0065481	3300049574	Bacteria	3096
356	Ga0501043_0058061	3300049579	Bacteria	3038
357	Ga0501046_0087706	3300049580	Bacteria	2397
358	Ga0501067_0168010	3300049583	Bacteria	1222
359	Ga0501080_0051994	3300049742	Bacteria	3813
360	Ga0501035_0157292	3300049822	Bacteria	1969
361	nmdc:mga03683_11860_c1	3300050489	Bacteria	3167
362	nmdc:mga03n38_148444_c1	3300050490	Bacteria	1178
363	nmdc:mga03n38_151243_c1	3300050490	Bacteria	1168
364	nmdc:mga00v17_144649_c1	3300050491	Bacteria	1526
365	nmdc:mga0k408_27355_c1	3300050493	Bacteria	3239
366	nmdc:mga0k408_88968_c1	3300050493	Bacteria	1448
367	nmdc:mga07m45_26137_c1	3300050496	Bacteria	3207
368	nmdc:mga05p37_108055_c1	3300050507	Bacteria	3422
369	nmdc:mga08x19_268_c1	3300050514	Bacteria	39485
370	nmdc:mga08x19_84763_c1	3300050514	Bacteria	2085
371	nmdc:mga0a205_212926_c1	3300050515	Bacteria	1820
372	nmdc:mga0sz30_116753_c1	3300050516	Bacteria	1171
373	Ga0495601_0000144	3300053077	Bacteria	40543
374	Ga0495601_0085267	3300053077	Bacteria	2029
375	Ga0495612_0084979	3300053078	Bacteria	1333
376	Ga0495595_0000771	3300053084	Bacteria	12152
377	Ga0495619_0021231	3300053085	Bacteria	4143
378	Ga0500607_000297	3300053121	Bacteria	47120
379	Ga0500608_011249	3300053122	Bacteria	3878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041413	Ga0439465_0077616	Ga0439465_0077616_398_1081	162
2	3300042185	Ga0450909_005926	Ga0450909_005926_371_1054	162
3	3300044901	Ga0466960_0442031	Ga0466960_0442031_38_706	167
4	3300025901	Ga0207688_10100269	Ga0207688_101002692	168
5	3300050515	nmdc:mga0a205_212926_c1	nmdc:mga0a205_212926_c1_821_1555	168
6	3300053121	Ga0500607_000297	Ga0500607_000297_1842_2528	168
7	3300037471	Ga0395905_0040705	Ga0395905_0040705_3641_4327	169
8	3300028794	Ga0307515_10242136	Ga0307515_102421362	170
9	3300046520	Ga0495637_0031484	Ga0495637_0031484_131_814	170
10	3300046660	Ga0495625_0438334	Ga0495625_0438334_40_723	170
11	3300046691	Ga0495670_0036355	Ga0495670_0036355_1750_2433	170
12	3300005295	Ga0065707_10214625	Ga0065707_102146251	172
13	3300005353	Ga0070669_100044613	Ga0070669_1000446132	172
14	3300005356	Ga0070674_100063672	Ga0070674_1000636723	172
15	3300005441	Ga0070700_100012778	Ga0070700_1000127784	172
16	3300005455	Ga0070663_100107193	Ga0070663_1001071933	172
17	3300005459	Ga0068867_100001075	Ga0068867_1000010757	172
18	3300005530	Ga0070679_100750317	Ga0070679_1007503171	172
19	3300005539	Ga0068853_100646853	Ga0068853_1006468532	172
20	3300005544	Ga0070686_100136603	Ga0070686_1001366031	172
21	3300005616	Ga0068852_100497832	Ga0068852_1004978322	172
22	3300005718	Ga0068866_10005806	Ga0068866_100058064	172
23	3300005719	Ga0068861_100002535	Ga0068861_1000025358	172
24	3300005843	Ga0068860_100004588	Ga0068860_1000045885	172
25	3300005844	Ga0068862_100016775	Ga0068862_1000167753	172
26	3300006195	Ga0075366_10077489	Ga0075366_100774892	172
27	3300006881	Ga0068865_100001091	Ga0068865_1000010915	172
28	3300009148	Ga0105243_10351801	Ga0105243_103518011	172
29	3300013297	Ga0157378_10025881	Ga0157378_100258817	172
30	3300013306	Ga0163162_10026647	Ga0163162_100266477	172
31	3300014326	Ga0157380_10045379	Ga0157380_100453793	172
32	3300014968	Ga0157379_10065957	Ga0157379_100659572	172
33	3300017792	Ga0163161_10055200	Ga0163161_100552002	172
34	3300025893	Ga0207682_10039859	Ga0207682_100398592	172
35	3300025899	Ga0207642_10258724	Ga0207642_102587241	172
36	3300025923	Ga0207681_10019209	Ga0207681_100192093	172
37	3300025935	Ga0207709_10241911	Ga0207709_102419111	172
38	3300025937	Ga0207669_10064573	Ga0207669_100645732	172
39	3300025938	Ga0207704_10003340	Ga0207704_100033408	172
40	3300025961	Ga0207712_10295492	Ga0207712_102954921	172
41	3300026075	Ga0207708_10009857	Ga0207708_100098575	172
42	3300026089	Ga0207648_10001410	Ga0207648_1000141015	172
43	3300026118	Ga0207675_100005656	Ga0207675_1000056567	172
44	3300026142	Ga0207698_10192635	Ga0207698_101926352	172
45	3300028380	Ga0268265_10011833	Ga0268265_100118335	172
46	3300028381	Ga0268264_10023842	Ga0268264_100238422	172
47	3300049571	Ga0501034_0009301	Ga0501034_0009301_461_1147	172
48	3300049574	Ga0501038_0065481	Ga0501038_0065481_16_702	172
49	3300049579	Ga0501043_0058061	Ga0501043_0058061_456_1142	172
50	3300049580	Ga0501046_0087706	Ga0501046_0087706_34_720	172
51	3300049742	Ga0501080_0051994	Ga0501080_0051994_2691_3377	172
52	3300049822	Ga0501035_0157292	Ga0501035_0157292_486_1172	172
53	3300050493	nmdc:mga0k408_88968_c1	nmdc:mga0k408_88968_c1_349_1038	172
54	3300049583	Ga0501067_0168010	Ga0501067_0168010_49_780	173
55	3300005617	Ga0068859_100364697	Ga0068859_1003646972	174
56	3300006051	Ga0075364_10133845	Ga0075364_101338452	174
57	3300006931	Ga0097620_100364706	Ga0097620_1003647062	174
58	3300026118	Ga0207675_100372242	Ga0207675_1003722422	176
59	3300014326	Ga0157380_10584256	Ga0157380_105842561	179
60	3300027614	Ga0209970_1000984	Ga0209970_10009844	180
61	3300027876	Ga0209974_10032178	Ga0209974_100321781	180
62	3300031548	Ga0307408_100404816	Ga0307408_1004048162	180
63	3300031731	Ga0307405_10061958	Ga0307405_100619581	180
64	3300031911	Ga0307412_10126273	Ga0307412_101262732	180
65	3300032002	Ga0307416_100153787	Ga0307416_1001537873	180
66	3300041404	Ga0439436_0005351	Ga0439436_0005351_2802_3485	180
67	3300042010	Ga0439452_008838	Ga0439452_008838_630_1313	180
68	3300042128	Ga0450897_002515	Ga0450897_002515_547_1230	180
69	3300042131	Ga0450894_026581	Ga0450894_026581_22_705	180
70	iso_pu_bacteria	2508501114	2509076897	180
71	iso_pu_bacteria	2773857925	2774868477	180
72	iso_pu_bacteria	2775506901	2776262687	180
73	iso_pu_bacteria	2835312727	2835313192	180
74	iso_pu_bacteria	2894232714	2894233199	180
75	3300041406	Ga0439439_0017775	Ga0439439_0017775_655_1338	181
76	3300041451	Ga0451791_1229168	Ga0451791_1229168_20_703	181
77	3300041486	Ga0451807_1052585	Ga0451807_1052585_13_696	181
78	3300042015	Ga0439462_0005671	Ga0439462_0005671_1000_1683	181
79	3300006177	Ga0075362_10052320	Ga0075362_100523202	183
80	3300017792	Ga0163161_10069850	Ga0163161_100698502	183
81	3300050490	nmdc:mga03n38_151243_c1	nmdc:mga03n38_151243_c1_277_966	183
82	3300005347	Ga0070668_100393922	Ga0070668_1003939221	184
83	3300005937	Ga0081455_10007375	Ga0081455_100073756	184
84	3300005983	Ga0081540_1082175	Ga0081540_10821752	184
85	3300006844	Ga0075428_100163264	Ga0075428_1001632643	184
86	3300006847	Ga0075431_100018872	Ga0075431_1000188722	184
87	3300009094	Ga0111539_10189953	Ga0111539_101899534	184
88	3300009147	Ga0114129_10148222	Ga0114129_101482223	184
89	3300011119	Ga0105246_10082344	Ga0105246_100823444	184
90	3300014326	Ga0157380_10073883	Ga0157380_100738833	184
91	3300025972	Ga0207668_10361971	Ga0207668_103619711	184
92	3300046615	Ga0495656_0169952	Ga0495656_0169952_124_852	184
93	3300050507	nmdc:mga05p37_108055_c1	nmdc:mga05p37_108055_c1_2220_2948	184
94	iso_pu_bacteria	2738541281	2738745968	184
95	iso_pu_bacteria	2738543032	2739355198	184
96	iso_pu_bacteria	2842698319	2842699490	184
97	iso_pu_bacteria	2939631187	2939634635	184
98	3300005367	Ga0070667_100771232	Ga0070667_1007712321	185
99	iso_pu_bacteria	2513020051	2513226883	185
100	iso_pu_bacteria	2599185214	2599621684	185
101	iso_pu_bacteria	2599185226	2599670632	185
102	iso_pu_bacteria	2599185227	2599679122	185
103	iso_pu_bacteria	2599185229	2599691195	185
104	iso_pu_bacteria	2643221658	2644327146	185
105	iso_pu_bacteria	2643221672	2644398950	185
106	iso_pu_bacteria	2643221683	2644465829	185
107	iso_pu_bacteria	2738541277	2738721753	185
108	iso_pu_bacteria	2738541307	2738881923	185
109	iso_pu_bacteria	2738543019	2739282117	185
110	iso_pu_bacteria	2885192300	2885194475	185
111	iso_pu_bacteria	2885198086	2885203997	185
112	iso_pu_bacteria	2885211737	2885217669	185
113	iso_pu_bacteria	2928070936	2928072347	185
114	iso_pu_bacteria	2928084124	2928085556	185
115	iso_pu_bacteria	2945909444	2945915118	185
116	iso_pu_bacteria	2945984333	2945989471	185
117	3300005333	Ga0070677_10076796	Ga0070677_100767961	186
118	3300005364	Ga0070673_100247467	Ga0070673_1002474672	186
119	3300005456	Ga0070678_100019292	Ga0070678_1000192923	186
120	3300005543	Ga0070672_100150856	Ga0070672_1001508561	186
121	3300005548	Ga0070665_100106854	Ga0070665_1001068544	186
122	3300009098	Ga0105245_10586635	Ga0105245_105866351	186
123	3300011119	Ga0105246_10236475	Ga0105246_102364752	186
124	3300014497	Ga0182008_10039797	Ga0182008_100397972	186
125	3300015262	Ga0182007_10043365	Ga0182007_100433652	186
126	3300015265	Ga0182005_1025592	Ga0182005_10255922	186
127	3300017792	Ga0163161_10117966	Ga0163161_101179662	186
128	3300026041	Ga0207639_10544541	Ga0207639_105445412	186
129	3300026121	Ga0207683_10011783	Ga0207683_100117832	186
130	3300037471	Ga0395905_0432493	Ga0395905_0432493_199_957	186
131	3300046475	Ga0495639_0045042	Ga0495639_0045042_1261_1941	186
132	3300048903	Ga0496100_0248729	Ga0496100_0248729_261_941	186
133	3300048907	Ga0496104_0076315	Ga0496104_0076315_2291_2971	186
134	3300048908	Ga0496105_0008359	Ga0496105_0008359_7022_7702	186
135	3300048909	Ga0496106_0193603	Ga0496106_0193603_649_1329	186
136	3300048911	Ga0496108_0089397	Ga0496108_0089397_999_1679	186
137	3300048912	Ga0496109_0235957	Ga0496109_0235957_754_1434	186
138	iso_pu_bacteria	2643221609	2644058213	186
139	iso_pu_bacteria	2643221628	2644163626	186
140	iso_pu_bacteria	2738543012	2739244443	186
141	iso_pu_bacteria	2816332133	2816469886	186
142	iso_pu_bacteria	2818991446	2819597860	186
143	iso_pu_bacteria	2831265667	2831268833	186
144	iso_pu_bacteria	2838054893	2838058259	186
145	iso_pu_bacteria	2842677519	2842678197	186
146	iso_pu_bacteria	2842733646	2842738713	186
147	iso_pu_bacteria	2842747753	2842750221	186
148	iso_pu_bacteria	2899924645	2899929276	186
149	iso_pu_bacteria	2904449895	2904451225	186
150	iso_pu_bacteria	2904456579	2904458087	186
151	iso_pu_bacteria	2904541872	2904542862	186
152	iso_pu_bacteria	2919462493	2919465576	186
153	iso_pu_bacteria	2928037797	2928040283	186
154	iso_pu_bacteria	2928044640	2928046968	186
155	iso_pu_bacteria	2928051484	2928057831	186
156	iso_pu_bacteria	2928064002	2928067794	186
157	iso_pu_bacteria	2928115317	2928120054	186
158	iso_pu_bacteria	2929160207	2929166278	186
159	iso_pu_bacteria	2929520902	2929526307	186
160	iso_pu_bacteria	2945945610	2945950862	186
161	iso_pu_bacteria	2945972063	2945974510	186
162	3300025291	Ga0209675_1016608	Ga0209675_10166083	187
163	3300025292	Ga0209676_1043879	Ga0209676_10438791	187
164	3300025294	Ga0209025_1057457	Ga0209025_10574572	187
165	3300025298	Ga0209050_1006108	Ga0209050_10061087	187
166	3300032002	Ga0307416_100143902	Ga0307416_1001439022	187
167	3300038443	Ga0395901_0206303	Ga0395901_0206303_841_1524	187
168	3300048904	Ga0496101_0855730	Ga0496101_0855730_22_705	187
169	3300048911	Ga0496108_0533635	Ga0496108_0533635_75_782	187
170	3300048919	Ga0496116_0151467	Ga0496116_0151467_416_1099	187
171	3300048920	Ga0496117_0257762	Ga0496117_0257762_183_866	187
172	3300048924	Ga0496121_0071356	Ga0496121_0071356_121_804	187
173	3300002774	JGI25150J39212_1003703	JGI25150J39212_10037032	188
174	3300002987	JGI25159J45721_1012615	JGI25159J45721_10126151	188
175	3300003187	JGI25151J46595_10008176	JGI25151J46595_100081761	188
176	3300003215	JGI25153J46596_10008131	JGI25153J46596_100081311	188
177	3300003354	JGI25160J50197_1020336	JGI25160J50197_10203361	188
178	3300003374	JGI25161J50226_1006815	JGI25161J50226_10068151	188
179	3300003771	Ga0055526_1024093	Ga0055526_10240931	188
180	3300003773	Ga0055537_1003114	Ga0055537_10031145	188
181	3300003775	Ga0055524_1023173	Ga0055524_10231731	188
182	3300003784	Ga0055534_1010057	Ga0055534_10100571	188
183	3300003790	Ga0055528_1021930	Ga0055528_10219301	188
184	3300003792	Ga0055540_1019681	Ga0055540_10196812	188
185	3300003794	Ga0055531_10027316	Ga0055531_100273161	188
186	3300004625	Ga0055543_1006918	Ga0055543_10069184	188
187	3300005262	Ga0065165_1003839	Ga0065165_10038391	188
188	3300005338	Ga0068868_100123629	Ga0068868_1001236291	188
189	3300005347	Ga0070668_100339466	Ga0070668_1003394661	188
190	3300005356	Ga0070674_100458205	Ga0070674_1004582051	188
191	3300005937	Ga0081455_10067543	Ga0081455_100675432	188
192	3300006353	Ga0075370_10003458	Ga0075370_100034586	188
193	3300009551	Ga0105238_10876911	Ga0105238_108769111	188
194	3300010375	Ga0105239_10827030	Ga0105239_108270301	188
195	3300014497	Ga0182008_10040405	Ga0182008_100404053	188
196	3300017792	Ga0163161_10119125	Ga0163161_101191252	188
197	3300025208	Ga0209436_106044	Ga0209436_1060442	188
198	3300025245	Ga0207425_1000323	Ga0207425_100032321	188
199	3300025258	Ga0209129_1000160	Ga0209129_100016072	188
200	3300025284	Ga0209130_1000730	Ga0209130_10007302	188
201	3300025291	Ga0209675_1000322	Ga0209675_100032238	188
202	3300025292	Ga0209676_1023569	Ga0209676_10235693	188
203	3300025294	Ga0209025_1000656	Ga0209025_100065649	188
204	3300025295	Ga0209564_1000346	Ga0209564_100034673	188
205	3300025297	Ga0209758_1000039	Ga0209758_1000039338	188
206	3300025299	Ga0209256_1000382	Ga0209256_100038258	188
207	3300025302	Ga0207426_1000108	Ga0207426_100010876	188
208	3300025303	Ga0209051_1013082	Ga0209051_10130824	188
209	3300025304	Ga0209257_1001232	Ga0209257_100123229	188
210	3300025972	Ga0207668_10153290	Ga0207668_101532902	188
211	3300028379	Ga0268266_10637948	Ga0268266_106379482	188
212	3300028786	Ga0307517_10135223	Ga0307517_101352233	188
213	3300028794	Ga0307515_10168025	Ga0307515_101680252	188
214	3300031251	Ga0265327_10244337	Ga0265327_102443371	188
215	3300041496	Ga0451839_0682680	Ga0451839_0682680_198_887	188
216	3300046471	Ga0495650_0122266	Ga0495650_0122266_31_714	188
217	3300046615	Ga0495656_0007678	Ga0495656_0007678_2767_3447	188
218	3300048090	Ga0495615_0006206	Ga0495615_0006206_326_1006	188
219	3300050496	nmdc:mga07m45_26137_c1	nmdc:mga07m45_26137_c1_511_1194	188
220	3300002773	JGI25152J39213_1001493	JGI25152J39213_10014931	189
221	3300003781	Ga0055536_1002214	Ga0055536_10022142	189
222	3300003781	Ga0055536_1016581	Ga0055536_10165812	189
223	3300003792	Ga0055540_1002066	Ga0055540_10020662	189
224	3300005327	Ga0070658_10010518	Ga0070658_100105182	189
225	3300005341	Ga0070691_10061914	Ga0070691_100619142	189
226	3300005353	Ga0070669_100304440	Ga0070669_1003044402	189
227	3300005354	Ga0070675_100572159	Ga0070675_1005721591	189
228	3300005356	Ga0070674_100238703	Ga0070674_1002387032	189
229	3300005456	Ga0070678_100283481	Ga0070678_1002834812	189
230	3300005458	Ga0070681_10255608	Ga0070681_102556081	189
231	3300005458	Ga0070681_10333984	Ga0070681_103339842	189
232	3300005458	Ga0070681_10451041	Ga0070681_104510412	189
233	3300005530	Ga0070679_100047658	Ga0070679_1000476583	189
234	3300005536	Ga0070697_100469284	Ga0070697_1004692842	189
235	3300005549	Ga0070704_100154867	Ga0070704_1001548672	189
236	3300005563	Ga0068855_100024587	Ga0068855_1000245877	189
237	3300005618	Ga0068864_100123270	Ga0068864_1001232703	189
238	3300005841	Ga0068863_100037561	Ga0068863_1000375613	189
239	3300006173	Ga0070716_100063579	Ga0070716_1000635792	189
240	3300006914	Ga0075436_100078144	Ga0075436_1000781442	189
241	3300007265	Ga0099794_10024591	Ga0099794_100245912	189
242	3300009093	Ga0105240_10069183	Ga0105240_100691832	189
243	3300009148	Ga0105243_10001538	Ga0105243_100015382	189
244	3300009177	Ga0105248_10132584	Ga0105248_101325842	189
245	3300009551	Ga0105238_10009243	Ga0105238_100092437	189
246	3300010159	Ga0099796_10059401	Ga0099796_100594011	189
247	3300014497	Ga0182008_10163409	Ga0182008_101634092	189
248	3300025292	Ga0209676_1000303	Ga0209676_100030312	189
249	3300025303	Ga0209051_1000361	Ga0209051_100036156	189
250	3300025304	Ga0209257_1028391	Ga0209257_10283912	189
251	3300025909	Ga0207705_10069070	Ga0207705_100690703	189
252	3300025912	Ga0207707_10375344	Ga0207707_103753441	189
253	3300025913	Ga0207695_10108110	Ga0207695_101081102	189
254	3300025917	Ga0207660_10062355	Ga0207660_100623552	189
255	3300025921	Ga0207652_10033948	Ga0207652_100339482	189
256	3300025935	Ga0207709_10000290	Ga0207709_1000029049	189
257	3300025937	Ga0207669_10109832	Ga0207669_101098322	189
258	3300025939	Ga0207665_10016819	Ga0207665_100168194	189
259	3300025941	Ga0207711_10045024	Ga0207711_100450242	189
260	3300025949	Ga0207667_10233806	Ga0207667_102338062	189
261	3300026095	Ga0207676_10100740	Ga0207676_101007403	189
262	3300026116	Ga0207674_10064454	Ga0207674_100644543	189
263	3300026121	Ga0207683_10097201	Ga0207683_100972012	189
264	3300027512	Ga0209179_1001059	Ga0209179_10010591	189
265	3300028379	Ga0268266_10098510	Ga0268266_100985103	189
266	3300028794	Ga0307515_10000034	Ga0307515_10000034166	189
267	3300031852	Ga0307410_10145716	Ga0307410_101457162	189
268	3300032005	Ga0307411_10208803	Ga0307411_102088032	189
269	3300032005	Ga0307411_10469367	Ga0307411_104693672	189
270	3300032126	Ga0307415_100102633	Ga0307415_1001026331	189
271	3300035083	Ga0373926_0005870	Ga0373926_0005870_1239_1943	189
272	3300035086	Ga0373934_0001186	Ga0373934_0001186_8603_9307	189
273	3300035111	Ga0373923_0000319	Ga0373923_0000319_8451_9155	189
274	3300035113	Ga0373936_0001528	Ga0373936_0001528_6191_6895	189
275	3300035116	Ga0373945_0020892	Ga0373945_0020892_644_1348	189
276	3300035117	Ga0373953_0000725	Ga0373953_0000725_335_1039	189
277	3300035118	Ga0373954_0000616	Ga0373954_0000616_9151_9864	189
278	3300035120	Ga0373957_0015484	Ga0373957_0015484_1589_2293	189
279	3300035170	Ga0373943_0151823	Ga0373943_0151823_367_1071	189
280	3300035172	Ga0373955_0038006	Ga0373955_0038006_1567_2271	189
281	3300035410	Ga0373924_0001035	Ga0373924_0001035_5103_5807	189
282	3300035692	Ga0373935_0028030	Ga0373935_0028030_1435_2139	189
283	3300035695	Ga0373927_0039465	Ga0373927_0039465_831_1535	189
284	3300035724	Ga0373933_0045282	Ga0373933_0045282_1570_2274	189
285	3300035725	Ga0373947_0040806	Ga0373947_0040806_586_1290	189
286	3300037312	Ga0395899_0014970	Ga0395899_0014970_685_1371	189
287	3300037418	Ga0395900_0016714	Ga0395900_0016714_261_947	189
288	3300037466	Ga0395898_0006110	Ga0395898_0006110_12182_12868	189
289	3300046454	Ga0495592_0000725	Ga0495592_0000725_18833_19537	189
290	3300046454	Ga0495592_0015662	Ga0495592_0015662_4214_4930	189
291	3300046461	Ga0495641_0015575	Ga0495641_0015575_2465_3169	189
292	3300046462	Ga0495651_0004590	Ga0495651_0004590_8177_8881	189
293	3300046463	Ga0495653_0002911	Ga0495653_0002911_9444_10148	189
294	3300046472	Ga0495580_0113223	Ga0495580_0113223_1074_1778	189
295	3300046473	Ga0495582_0007738	Ga0495582_0007738_589_1293	189
296	3300046475	Ga0495639_0002815	Ga0495639_0002815_573_1277	189
297	3300046476	Ga0495662_0039702	Ga0495662_0039702_113_817	189
298	3300046477	Ga0495664_0003815	Ga0495664_0003815_1374_2078	189
299	3300046499	Ga0495594_0006616	Ga0495594_0006616_333_1037	189
300	3300046514	Ga0495618_0032298	Ga0495618_0032298_654_1358	189
301	3300046516	Ga0495628_0009836	Ga0495628_0009836_1270_1986	189
302	3300046526	Ga0495666_0001758	Ga0495666_0001758_1875_2579	189
303	3300046529	Ga0495652_0122661	Ga0495652_0122661_1241_1945	189
304	3300046531	Ga0495665_0004795	Ga0495665_0004795_2530_3234	189
305	3300046533	Ga0495640_0017584	Ga0495640_0017584_3386_4090	189
306	3300046535	Ga0495586_0003221	Ga0495586_0003221_1921_2625	189
307	3300046536	Ga0495587_0036424	Ga0495587_0036424_1921_2625	189
308	3300046557	Ga0495622_0016250	Ga0495622_0016250_236_940	189
309	3300046559	Ga0495667_0039083	Ga0495667_0039083_884_1588	189
310	3300046642	Ga0495634_0005742	Ga0495634_0005742_5612_6316	189
311	3300046660	Ga0495625_0000098	Ga0495625_0000098_140060_140746	189
312	3300046675	Ga0495657_0003348	Ga0495657_0003348_1074_1778	189
313	3300046678	Ga0495599_0010584	Ga0495599_0010584_882_1586	189
314	3300046678	Ga0495599_0122373	Ga0495599_0122373_595_1311	189
315	3300046683	Ga0495658_0062507	Ga0495658_0062507_1202_1906	189
316	3300046690	Ga0495624_0012397	Ga0495624_0012397_5014_5718	189
317	3300046690	Ga0495624_0186418	Ga0495624_0186418_38_754	189
318	3300046809	Ga0495600_0027837	Ga0495600_0027837_2067_2771	189
319	3300047319	Ga0495674_0004795	Ga0495674_0004795_9446_10150	189
320	3300047322	Ga0495680_0013508	Ga0495680_0013508_1202_1906	189
321	3300047444	Ga0495675_0003045	Ga0495675_0003045_8175_8879	189
322	3300047471	Ga0495684_0008344	Ga0495684_0008344_6668_7372	189
323	3300048925	Ga0496122_0001296	Ga0496122_0001296_429_1115	189
324	3300048926	Ga0496123_0001032	Ga0496123_0001032_1374_2060	189
325	3300048927	Ga0496124_0128902	Ga0496124_0128902_532_1218	189
326	3300048928	Ga0496125_0111152	Ga0496125_0111152_599_1282	189
327	3300050514	nmdc:mga08x19_268_c1	nmdc:mga08x19_268_c1_3851_4579	189
328	3300050514	nmdc:mga08x19_84763_c1	nmdc:mga08x19_84763_c1_981_1712	189
329	3300050516	nmdc:mga0sz30_116753_c1	nmdc:mga0sz30_116753_c1_434_1117	189
330	3300053077	Ga0495601_0000144	Ga0495601_0000144_39817_40533	189
331	3300053077	Ga0495601_0085267	Ga0495601_0085267_336_1040	189
332	3300053078	Ga0495612_0084979	Ga0495612_0084979_258_962	189
333	3300053084	Ga0495595_0000771	Ga0495595_0000771_2781_3485	189
334	3300053085	Ga0495619_0021231	Ga0495619_0021231_3107_3811	189
335	3300053122	Ga0500608_011249	Ga0500608_011249_12_695	189
336	3300001979	JGI24740J21852_10004112	JGI24740J21852_100041124	190
337	3300001989	JGI24739J22299_10013399	JGI24739J22299_100133993	190
338	3300002773	JGI25152J39213_1004128	JGI25152J39213_10041281	190
339	3300003187	JGI25151J46595_10007461	JGI25151J46595_100074612	190
340	3300003215	JGI25153J46596_10009112	JGI25153J46596_100091124	190
341	3300003354	JGI25160J50197_1020004	JGI25160J50197_10200043	190
342	3300003374	JGI25161J50226_1003498	JGI25161J50226_10034981	190
343	3300003578	Ga0006562J51391_1009735	Ga0006562J51391_10097356	190
344	3300003761	Ga0055535_1000185	Ga0055535_100018569	190
345	3300003762	Ga0055542_1000003	Ga0055542_1000003219	190
346	3300003771	Ga0055526_1024004	Ga0055526_10240043	190
347	3300003773	Ga0055537_1000137	Ga0055537_10001373	190
348	3300003775	Ga0055524_1023086	Ga0055524_10230861	190
349	3300003781	Ga0055536_1006668	Ga0055536_10066682	190
350	3300003784	Ga0055534_1007847	Ga0055534_10078473	190
351	3300003790	Ga0055528_1017360	Ga0055528_10173603	190
352	3300003791	Ga0055530_10000417	Ga0055530_100004172	190
353	3300003792	Ga0055540_1017365	Ga0055540_10173651	190
354	3300003794	Ga0055531_10027231	Ga0055531_100272311	190
355	3300004625	Ga0055543_1005467	Ga0055543_10054671	190
356	3300005262	Ga0065165_1008446	Ga0065165_10084464	190
357	3300005288	Ga0065714_10162126	Ga0065714_101621262	190
358	3300005456	Ga0070678_100315585	Ga0070678_1003155851	190
359	3300005539	Ga0068853_100260776	Ga0068853_1002607762	190
360	3300005834	Ga0068851_10014707	Ga0068851_100147073	190
361	3300006038	Ga0075365_10066916	Ga0075365_100669162	190
362	3300006048	Ga0075363_100168286	Ga0075363_1001682862	190
363	3300006051	Ga0075364_10021035	Ga0075364_100210352	190
364	3300006051	Ga0075364_10393944	Ga0075364_103939441	190
365	3300006058	Ga0075432_10027422	Ga0075432_100274221	190
366	3300006177	Ga0075362_10012340	Ga0075362_100123402	190
367	3300006178	Ga0075367_10024344	Ga0075367_100243443	190
368	3300006186	Ga0075369_10054101	Ga0075369_100541012	190
369	3300006195	Ga0075366_10011731	Ga0075366_100117314	190
370	3300006195	Ga0075366_10146181	Ga0075366_101461812	190
371	3300006195	Ga0075366_10217227	Ga0075366_102172272	190
372	3300006353	Ga0075370_10128075	Ga0075370_101280751	190
373	3300006353	Ga0075370_10169596	Ga0075370_101695962	190
374	3300006353	Ga0075370_10236080	Ga0075370_102360802	190
375	3300009093	Ga0105240_10054158	Ga0105240_100541583	190
376	3300009148	Ga0105243_10234630	Ga0105243_102346302	190
377	3300011119	Ga0105246_10100467	Ga0105246_101004672	190
378	3300013100	Ga0157373_10001092	Ga0157373_100010922	190
379	3300013102	Ga0157371_10075721	Ga0157371_100757212	190
380	3300013104	Ga0157370_10696741	Ga0157370_106967411	190
381	3300013105	Ga0157369_10591083	Ga0157369_105910832	190
382	3300013307	Ga0157372_10062700	Ga0157372_100627004	190
383	3300014497	Ga0182008_10037332	Ga0182008_100373322	190
384	3300014745	Ga0157377_10276836	Ga0157377_102768362	190
385	3300015261	Ga0182006_1068741	Ga0182006_10687412	190
386	3300025228	Ga0209672_100279	Ga0209672_10027923	190
387	3300025229	Ga0209147_101718	Ga0209147_1017185	190
388	3300025242	Ga0209258_100015	Ga0209258_100015338	190
389	3300025245	Ga0207425_1016459	Ga0207425_10164592	190
390	3300025254	Ga0209148_1000028	Ga0209148_1000028331	190
391	3300025258	Ga0209129_1000922	Ga0209129_100092215	190
392	3300025263	Ga0209565_1000762	Ga0209565_100076216	190
393	3300025263	Ga0209565_1001106	Ga0209565_100110612	190
394	3300025273	Ga0209673_1002146	Ga0209673_100214612	190
395	3300025273	Ga0209673_1002371	Ga0209673_10023715	190
396	3300025284	Ga0209130_1001293	Ga0209130_100129313	190
397	3300025291	Ga0209675_1005147	Ga0209675_10051472	190
398	3300025292	Ga0209676_1000074	Ga0209676_1000074121	190
399	3300025292	Ga0209676_1026736	Ga0209676_10267362	190
400	3300025294	Ga0209025_1002400	Ga0209025_10024002	190
401	3300025295	Ga0209564_1002089	Ga0209564_10020892	190
402	3300025297	Ga0209758_1010404	Ga0209758_10104041	190
403	3300025298	Ga0209050_1000015	Ga0209050_1000015349	190
404	3300025299	Ga0209256_1000136	Ga0209256_100013690	190
405	3300025302	Ga0207426_1000130	Ga0207426_100013052	190
406	3300025302	Ga0207426_1001644	Ga0207426_100164415	190
407	3300025303	Ga0209051_1000010	Ga0209051_1000010349	190
408	3300025304	Ga0209257_1000026	Ga0209257_1000026328	190
409	3300025304	Ga0209257_1025051	Ga0209257_10250511	190
410	3300025321	Ga0207656_10010226	Ga0207656_100102263	190
411	3300025908	Ga0207643_10272280	Ga0207643_102722801	190
412	3300025913	Ga0207695_10072730	Ga0207695_100727304	190
413	3300025914	Ga0207671_10518509	Ga0207671_105185092	190
414	3300025935	Ga0207709_10270511	Ga0207709_102705112	190
415	3300026041	Ga0207639_10022407	Ga0207639_100224074	190
416	3300026116	Ga0207674_10205444	Ga0207674_102054442	190
417	3300031649	Ga0307514_10009224	Ga0307514_100092244	190
418	3300039447	Ga0436361_0210618	Ga0436361_0210618_1690_2379	190
419	3300042002	Ga0439442_031027	Ga0439442_031027_318_1004	190
420	3300042123	Ga0450921_000349	Ga0450921_000349_1117_1803	190
421	3300042145	Ga0450906_012397	Ga0450906_012397_599_1285	190
422	3300042184	Ga0450908_006279	Ga0450908_006279_1154_1840	190
423	3300042435	Ga0439434_0028817	Ga0439434_0028817_671_1357	190
424	3300042531	Ga0450918_001517	Ga0450918_001517_416_1102	190
425	3300048920	Ga0496117_0052630	Ga0496117_0052630_1583_2269	190
426	3300048928	Ga0496125_0064580	Ga0496125_0064580_474_1160	190
427	3300050489	nmdc:mga03683_11860_c1	nmdc:mga03683_11860_c1_2449_3135	190
428	3300050490	nmdc:mga03n38_148444_c1	nmdc:mga03n38_148444_c1_349_1035	190
429	3300050491	nmdc:mga00v17_144649_c1	nmdc:mga00v17_144649_c1_620_1306	190
430	3300050493	nmdc:mga0k408_27355_c1	nmdc:mga0k408_27355_c1_2192_2878	190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

13

187

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7cgp-assembly1.cif.gz_A	cryo-em structure of the human mitochondrial translocase tim22 complex at 3.7 angstrom.	0.3753	56	183
6fl0-assembly2.cif.gz_K-4	crystal structure of the membrane attack complex assembly inhibitor bga71 from lyme disease agent borreliella bavariensis	0.3277	12	127
8e12-assembly1.cif.gz_C	homotrimeric variant of tctrp9, bgl14	0.3143	5	177
8e12-assembly1.cif.gz_C	homotrimeric variant of tctrp9, bgl14	0.3105	5	177
7cgp-assembly1.cif.gz_A	cryo-em structure of the human mitochondrial translocase tim22 complex at 3.7 angstrom.	0.3099	56	183

ID	Description	Score	Start	End	Superfamily
af_Q18936_71_349_1.20.1070.10	Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins	0.3945	15	160	1.20.1070.10
af_A4HU35_25_141_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.3519	69	176	1.10.10.1740
af_P33527_937_1274_1.20.1560.10	Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain	0.3414	9	180	1.20.1560.10
af_A4HU35_25_141_1.10.10.1740	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like	0.3278	69	176	1.10.10.1740
2a0lB00	Mainly Alpha;Orthogonal Bundle;Helix Hairpins;	0.3262	11	185	1.10.287.70

ID	Description	Score	Start	End	GO Terms
AF-A0A0B0HUR5-F1-model_v4	deleted	0.8746	30	189
AF-A0A6N7D279-F1-model_v4	Membrane protein YjbE	0.8353	30	190	GO:0016020
AF-A0A4U3APH2-F1-model_v4	deleted	0.8348	30	188
AF-A0A0B0HUR5-F1-model_v4	deleted	0.8231	30	189
AF-A0A6N7D279-F1-model_v4	Membrane protein YjbE	0.8041	30	190	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
66.28	0.55	Medium

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442099

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03741

TerC

Integral membrane protein TerC family

13

187

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map