F442121

General Info

Members Datasets Scaffolds Average Seq Length
430 251 860 103

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10479713|Ga0105240_104797132
Length 124
Sequence VVTNRAVDIDELTYVSQPTGKIMIHVIATVELNPGTRDKFLAEFRKLIPDVKSEAGCIEYGPAIDAETDIPIQYKLGPDRVVVVEKWETVAALKAHGVAPHMQAYRARVKDYVKGMELRVLSPA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
163 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 4.42
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 21.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10479713 3300009093 Bacteria 1386
2 Ga0065707_10454769 3300005295 Unclassified 797
3 Ga0070658_10722525 3300005327 Bacteria 865
4 Ga0070676_10521337 3300005328 Bacteria 847
5 Ga0070676_10581404 3300005328 Unclassified 805
6 Ga0070690_100146968 3300005330 Bacteria 1605
7 Ga0070690_100168754 3300005330 Bacteria 1505
8 Ga0070670_100143056 3300005331 Bacteria 2068
9 Ga0068869_100021968 3300005334 Bacteria 4392
10 Ga0070680_100058853 3300005336 Bacteria 3143
11 Ga0070680_100257281 3300005336 Unclassified 1476
12 Ga0070680_100458417 3300005336 Bacteria 1089
13 Ga0070680_101410455 3300005336 Unclassified 603
14 Ga0070682_100736561 3300005337 Unclassified 794
15 Ga0068868_100176020 3300005338 Unclassified 1773
16 Ga0070689_100001664 3300005340 Bacteria 14184
17 Ga0070689_100101280 3300005340 Bacteria 2280
18 Ga0070691_10023886 3300005341 Bacteria 2839
19 Ga0070661_100433017 3300005344 Bacteria 1044
20 Ga0070692_10049587 3300005345 Bacteria 2178
21 Ga0070692_11225377 3300005345 Unclassified 535
22 Ga0070675_100708906 3300005354 Bacteria 917
23 Ga0070671_100372366 3300005355 Bacteria 1220
24 Ga0070671_101377812 3300005355 Bacteria 623
25 Ga0070674_100036024 3300005356 Bacteria 3318
26 Ga0070674_100188542 3300005356 Bacteria 1585
27 Ga0070673_101567751 3300005364 Unclassified 622
28 Ga0070688_100180273 3300005365 Unclassified 1465
29 Ga0070659_100836338 3300005366 Bacteria 802
30 Ga0070709_11276548 3300005434 Unclassified 592
31 Ga0070709_11331686 3300005434 Bacteria 580
32 Ga0070714_100033938 3300005435 Bacteria 4271
33 Ga0070714_101248772 3300005435 Bacteria 725
34 Ga0070714_101346022 3300005435 Bacteria 697
35 Ga0070713_100030521 3300005436 Bacteria 4281
36 Ga0070713_100459689 3300005436 Bacteria 1197
37 Ga0070713_101554667 3300005436 Bacteria 642
38 Ga0070710_10002314 3300005437 Bacteria 9009
39 Ga0070710_10481081 3300005437 Bacteria 847
40 Ga0070701_10005288 3300005438 Bacteria 5318
41 Ga0070711_100064307 3300005439 Unclassified 2563
42 Ga0070711_100173232 3300005439 Bacteria 1646
43 Ga0070711_100519516 3300005439 Bacteria 984
44 Ga0070711_101022680 3300005439 Bacteria 710
45 Ga0070711_101317286 3300005439 Bacteria 627
46 Ga0070705_100477943 3300005440 Unclassified 941
47 Ga0070700_100004213 3300005441 Bacteria 7505
48 Ga0070700_100012609 3300005441 Bacteria 4724
49 Ga0070700_101179646 3300005441 Bacteria 638
50 Ga0070694_100116702 3300005444 Bacteria 1909
51 Ga0070694_100192588 3300005444 Unclassified 1515
52 Ga0070708_100034755 3300005445 Bacteria 4387
53 Ga0070663_100131668 3300005455 Bacteria 1900
54 Ga0070663_100697461 3300005455 Bacteria 863
55 Ga0070678_100076380 3300005456 Bacteria 2523
56 Ga0070678_100110964 3300005456 Bacteria 2145
57 Ga0070678_100365647 3300005456 Bacteria 1244
58 Ga0070662_101930600 3300005457 Unclassified 510
59 Ga0070681_10037120 3300005458 Bacteria 4891
60 Ga0070681_10136994 3300005458 Bacteria 2378
61 Ga0068867_100017730 3300005459 Bacteria 5053
62 Ga0068867_100110611 3300005459 Unclassified 2111
63 Ga0068867_101331654 3300005459 Bacteria 664
64 Ga0068867_101410600 3300005459 Bacteria 646
65 Ga0068867_101932185 3300005459 Bacteria 557
66 Ga0070698_100016937 3300005471 Bacteria 7683
67 Ga0070699_100162459 3300005518 Bacteria 1977
68 Ga0070679_100065571 3300005530 Bacteria 3620
69 Ga0070679_100195417 3300005530 Bacteria 1991
70 Ga0070697_100489890 3300005536 Unclassified 1074
71 Ga0068853_100143173 3300005539 Bacteria 2147
72 Ga0070672_100001303 3300005543 Bacteria 15378
73 Ga0070672_100653831 3300005543 Unclassified 918
74 Ga0070686_100009259 3300005544 Bacteria 5528
75 Ga0070686_101633862 3300005544 Bacteria 546
76 Ga0070695_101455569 3300005545 Unclassified 569
77 Ga0070695_101731133 3300005545 Unclassified 524
78 Ga0070696_100015241 3300005546 Bacteria 5162
79 Ga0070696_100051746 3300005546 Unclassified 2857
80 Ga0070696_100152900 3300005546 Bacteria 1695
81 Ga0070693_100304730 3300005547 Bacteria 1075
82 Ga0070704_100484632 3300005549 Bacteria 1070
83 Ga0070704_101857552 3300005549 Bacteria 558
84 Ga0068855_100061976 3300005563 Bacteria 4368
85 Ga0068855_100196573 3300005563 Unclassified 2272
86 Ga0070664_100515033 3300005564 Bacteria 1104
87 Ga0068857_100209883 3300005577 Bacteria 1777
88 Ga0068854_100822411 3300005578 Unclassified 811
89 Ga0068856_100594580 3300005614 Bacteria 1128
90 Ga0068856_102152971 3300005614 Unclassified 567
91 Ga0070702_100000858 3300005615 Bacteria 11749
92 Ga0070702_100209480 3300005615 Bacteria 1296
93 Ga0068852_100270489 3300005616 Bacteria 1635
94 Ga0068859_100136457 3300005617 Bacteria 2526
95 Ga0068859_100519128 3300005617 Bacteria 1286
96 Ga0068859_101383019 3300005617 Bacteria 776
97 Ga0068859_102541138 3300005617 Unclassified 564
98 Ga0068864_100085546 3300005618 Bacteria 2773
99 Ga0068864_100449834 3300005618 Bacteria 1232
100 Ga0068864_101832883 3300005618 Bacteria 612
101 Ga0068866_10011953 3300005718 Bacteria 3773
102 Ga0068866_10590356 3300005718 Unclassified 748
103 Ga0068861_100000970 3300005719 Bacteria 17479
104 Ga0068863_100918840 3300005841 Bacteria 876
105 Ga0068863_101136842 3300005841 Bacteria 786
106 Ga0068863_101156160 3300005841 Bacteria 779
107 Ga0068858_100003501 3300005842 Bacteria 15567
108 Ga0068858_100326529 3300005842 Bacteria 1467
109 Ga0068858_101444853 3300005842 Bacteria 678
110 Ga0068860_100071474 3300005843 Bacteria 3298
111 Ga0068862_100067035 3300005844 Bacteria 3093
112 Ga0068862_100797493 3300005844 Unclassified 922
113 Ga0081540_1002454 3300005983 Bacteria 15098
114 Ga0070717_11123402 3300006028 Bacteria 716
115 Ga0075364_10343229 3300006051 Bacteria 1018
116 Ga0070712_100015173 3300006175 Bacteria 4955
117 Ga0070712_100053269 3300006175 Bacteria 2825
118 Ga0070712_101112952 3300006175 Bacteria 686
119 Ga0075362_10174185 3300006177 Bacteria 1040
120 Ga0075367_10998108 3300006178 Bacteria 535
121 Ga0075366_10571032 3300006195 Bacteria 701
122 Ga0097621_100284961 3300006237 Unclassified 1455
123 Ga0097621_100389064 3300006237 Bacteria 1247
124 Ga0097621_102058044 3300006237 Bacteria 546
125 Ga0097621_102113908 3300006237 Unclassified 538
126 Ga0068871_100011124 3300006358 Bacteria 6596
127 Ga0068871_100391829 3300006358 Bacteria 1236
128 Ga0068871_101516112 3300006358 Unclassified 634
129 Ga0068871_102054757 3300006358 Unclassified 544
130 Ga0075430_100499300 3300006846 Bacteria 1004
131 Ga0075431_100009631 3300006847 Bacteria 9703
132 Ga0075431_101709542 3300006847 Bacteria 586
133 Ga0075429_100173164 3300006880 Bacteria 1891
134 Ga0068865_100001909 3300006881 Bacteria 12250
135 Ga0068865_100083928 3300006881 Unclassified 2294
136 Ga0068865_100354806 3300006881 Bacteria 1189
137 Ga0075436_100013013 3300006914 Bacteria 5704
138 Ga0097620_100136446 3300006931 Bacteria 2526
139 Ga0097620_100519148 3300006931 Bacteria 1286
140 Ga0097620_101382918 3300006931 Bacteria 776
141 Ga0097620_102540740 3300006931 Unclassified 564
142 Ga0075435_101402723 3300007076 Bacteria 612
143 Ga0099795_10187285 3300007788 Bacteria 867
144 Ga0105240_12469236 3300009093 Unclassified 538
145 Ga0111539_10106621 3300009094 Bacteria 3287
146 Ga0111539_10499426 3300009094 Bacteria 1417
147 Ga0105245_10086056 3300009098 Bacteria 2882
148 Ga0105245_10824033 3300009098 Bacteria 967
149 Ga0105245_10851498 3300009098 Bacteria 952
150 Ga0105247_10146728 3300009101 Bacteria 1551
151 Ga0105247_11646089 3300009101 Unclassified 529
152 Ga0114129_10009531 3300009147 Bacteria 13852
153 Ga0105243_10000798 3300009148 Bacteria 30100
154 Ga0105243_10076343 3300009148 Bacteria 2722
155 Ga0105243_10163804 3300009148 Bacteria 1920
156 Ga0105241_10026169 3300009174 Bacteria 4339
157 Ga0105241_10530014 3300009174 Unclassified 1054
158 Ga0105242_11284471 3300009176 Unclassified 755
159 Ga0105242_12243808 3300009176 Bacteria 592
160 Ga0105248_12297976 3300009177 Unclassified 614
161 Ga0105237_10010747 3300009545 Bacteria 9713
162 Ga0105238_11403876 3300009551 Unclassified 725
163 Ga0105238_11789444 3300009551 Unclassified 646
164 Ga0105238_12252356 3300009551 Unclassified 580
165 Ga0105238_13054594 3300009551 Unclassified 502
166 Ga0105249_10065598 3300009553 Bacteria 3340
167 Ga0105249_10152804 3300009553 Bacteria 2224
168 Ga0105249_10209136 3300009553 Bacteria 1914
169 Ga0105249_12958189 3300009553 Bacteria 545
170 Ga0099796_10346470 3300010159 Bacteria 640
171 Ga0105239_10020365 3300010375 Bacteria 7317
172 Ga0105246_12302807 3300011119 Unclassified 526
173 Ga0157370_10133767 3300013104 Bacteria 2312
174 Ga0157369_10661686 3300013105 Bacteria 1077
175 Ga0157374_10206574 3300013296 Bacteria 1925
176 Ga0157374_11536562 3300013296 Unclassified 689
177 Ga0157378_10033692 3300013297 Bacteria 4530
178 Ga0157378_10116146 3300013297 Bacteria 2460
179 Ga0157378_11588033 3300013297 Bacteria 700
180 Ga0157378_13271092 3300013297 Unclassified 503
181 Ga0157375_10351789 3300013308 Bacteria 1639
182 Ga0157375_10352605 3300013308 Bacteria 1637
183 Ga0157375_10677541 3300013308 Bacteria 1186
184 Ga0157375_12355034 3300013308 Bacteria 635
185 Ga0163163_10065474 3300014325 Bacteria 3608
186 Ga0157380_10011865 3300014326 Bacteria 6300
187 Ga0157380_10208955 3300014326 Bacteria 1738
188 Ga0157380_11100612 3300014326 Unclassified 833
189 Ga0157379_10379899 3300014968 Bacteria 1296
190 Ga0157379_10753769 3300014968 Bacteria 917
191 Ga0157379_12374768 3300014968 Unclassified 529
192 Ga0157376_10508675 3300014969 Bacteria 1185
193 Ga0157376_10544109 3300014969 Bacteria 1148
194 Ga0157376_11358321 3300014969 Unclassified 741
195 Ga0184598_106064 3300019182 Bacteria 520
196 Ga0206352_11112191 3300020078 Bacteria 581
197 Ga0213873_10018038 3300021358 Bacteria 1618
198 Ga0213873_10039401 3300021358 Bacteria 1211
199 Ga0213874_10031653 3300021377 Bacteria 1532
200 Ga0213874_10144217 3300021377 Bacteria 826
201 Ga0213874_10150170 3300021377 Unclassified 812
202 Ga0213876_10101737 3300021384 Bacteria 1523
203 Ga0213875_10001235 3300021388 Bacteria 17262
204 Ga0213875_10032984 3300021388 Bacteria 2446
205 Ga0213871_10001506 3300021441 Bacteria 3938
206 Ga0213871_10089449 3300021441 Unclassified 891
207 Ga0207656_10283949 3300025321 Bacteria 817
208 Ga0207692_10064779 3300025898 Bacteria 1904
209 Ga0207692_10812775 3300025898 Bacteria 612
210 Ga0207642_10224200 3300025899 Bacteria 1052
211 Ga0207642_10949769 3300025899 Unclassified 552
212 Ga0207680_10818252 3300025903 Bacteria 668
213 Ga0207699_10297498 3300025906 Unclassified 1126
214 Ga0207645_10915201 3300025907 Bacteria 595
215 Ga0207684_10116738 3300025910 Unclassified 2287
216 Ga0207684_10983503 3300025910 Bacteria 706
217 Ga0207654_10451521 3300025911 Unclassified 901
218 Ga0207654_10601254 3300025911 Unclassified 785
219 Ga0207707_10032701 3300025912 Bacteria 4552
220 Ga0207707_10043419 3300025912 Bacteria 3922
221 Ga0207671_10008421 3300025914 Bacteria 8749
222 Ga0207693_10016096 3300025915 Bacteria 5985
223 Ga0207693_10117448 3300025915 Bacteria 2088
224 Ga0207693_10149245 3300025915 Bacteria 1838
225 Ga0207693_11355721 3300025915 Unclassified 530
226 Ga0207663_10151918 3300025916 Bacteria 1625
227 Ga0207663_10202992 3300025916 Bacteria 1431
228 Ga0207663_10302263 3300025916 Bacteria 1196
229 Ga0207663_10827514 3300025916 Bacteria 738
230 Ga0207663_11148041 3300025916 Bacteria 625
231 Ga0207663_11223571 3300025916 Bacteria 605
232 Ga0207663_11274445 3300025916 Bacteria 592
233 Ga0207660_10065468 3300025917 Bacteria 2626
234 Ga0207660_10101686 3300025917 Bacteria 2148
235 Ga0207660_10402854 3300025917 Bacteria 1102
236 Ga0207660_11377510 3300025917 Unclassified 572
237 Ga0207649_11512545 3300025920 Unclassified 531
238 Ga0207652_10098023 3300025921 Bacteria 2585
239 Ga0207652_10439114 3300025921 Bacteria 1177
240 Ga0207694_11124135 3300025924 Unclassified 665
241 Ga0207650_10156470 3300025925 Bacteria 1802
242 Ga0207650_10963142 3300025925 Bacteria 725
243 Ga0207659_10075794 3300025926 Bacteria 2470
244 Ga0207687_11373299 3300025927 Unclassified 607
245 Ga0207664_10674862 3300025929 Bacteria 929
246 Ga0207664_11227401 3300025929 Unclassified 668
247 Ga0207644_10092689 3300025931 Bacteria 2254
248 Ga0207644_11662562 3300025931 Unclassified 535
249 Ga0207690_10719758 3300025932 Bacteria 821
250 Ga0207706_11586254 3300025933 Bacteria 531
251 Ga0207686_10418640 3300025934 Unclassified 1024
252 Ga0207709_10246708 3300025935 Unclassified 1302
253 Ga0207709_10530816 3300025935 Unclassified 923
254 Ga0207670_10068307 3300025936 Bacteria 2448
255 Ga0207670_10099149 3300025936 Bacteria 2078
256 Ga0207704_10007957 3300025938 Bacteria 5040
257 Ga0207704_11239602 3300025938 Bacteria 637
258 Ga0207704_11618810 3300025938 Unclassified 556
259 Ga0207665_10220191 3300025939 Unclassified 1391
260 Ga0207665_11190566 3300025939 Bacteria 608
261 Ga0207691_10016784 3300025940 Bacteria 6948
262 Ga0207691_10495091 3300025940 Unclassified 1038
263 Ga0207711_10462294 3300025941 Bacteria 1182
264 Ga0207689_10007096 3300025942 Bacteria 9847
265 Ga0207689_11607810 3300025942 Unclassified 540
266 Ga0207679_11095785 3300025945 Bacteria 731
267 Ga0207667_10155971 3300025949 Bacteria 2349
268 Ga0207667_10165527 3300025949 Bacteria 2273
269 Ga0207712_10102079 3300025961 Bacteria 2134
270 Ga0207712_10211133 3300025961 Bacteria 1546
271 Ga0207668_11120638 3300025972 Bacteria 706
272 Ga0207640_11733468 3300025981 Unclassified 564
273 Ga0207658_10642459 3300025986 Bacteria 956
274 Ga0207677_10098748 3300026023 Bacteria 2142
275 Ga0207703_10028240 3300026035 Bacteria 4421
276 Ga0207703_10327836 3300026035 Bacteria 1404
277 Ga0207703_11023803 3300026035 Bacteria 792
278 Ga0207639_11881426 3300026041 Unclassified 559
279 Ga0207678_10109137 3300026067 Bacteria 2360
280 Ga0207708_10000385 3300026075 Bacteria 34524
281 Ga0207708_10008430 3300026075 Bacteria 7626
282 Ga0207648_10001978 3300026089 Bacteria 22373
283 Ga0207648_10060508 3300026089 Unclassified 3303
284 Ga0207676_10354265 3300026095 Bacteria 1358
285 Ga0207676_11711001 3300026095 Bacteria 627
286 Ga0207674_10028785 3300026116 Bacteria 5858
287 Ga0207675_100002060 3300026118 Bacteria 20050
288 Ga0207683_10013001 3300026121 Bacteria 7105
289 Ga0268265_10471976 3300028380 Bacteria 1176
290 Ga0268265_10827495 3300028380 Unclassified 904
291 Ga0268264_10429820 3300028381 Bacteria 1275
292 Ga0268264_11299359 3300028381 Bacteria 738
293 Ga0307406_11866069 3300031901 Bacteria 535
294 Ga0307416_103759585 3300032002 Bacteria 508
295 Ga0373944_0157818 3300035089 Bacteria 803
296 Ga0373923_0675048 3300035111 Unclassified 512
297 Ga0373945_0093255 3300035116 Bacteria 1169
298 Ga0373945_0438786 3300035116 Unclassified 576
299 Ga0373953_0236777 3300035117 Bacteria 792
300 Ga0373956_0243967 3300035119 Bacteria 854
301 Ga0373946_0285514 3300035171 Bacteria 813
302 Ga0373931_0093659 3300035691 Bacteria 1678
303 Ga0373935_0099844 3300035692 Bacteria 1911
304 Ga0373927_0058330 3300035695 Bacteria 2497
305 Ga0373927_0099278 3300035695 Bacteria 1893
306 Ga0373927_0215799 3300035695 Bacteria 1260
307 Ga0373947_0468244 3300035725 Bacteria 854
308 Ga0373937_0081098 3300036401 Bacteria 3001
309 Ga0373925_0487022 3300037068 Bacteria 1012
310 Ga0373925_1297524 3300037068 Bacteria 597
311 Ga0395905_0104749 3300037471 Bacteria 2656
312 Ga0436364_0905998 3300037853 Bacteria 1916
313 Ga0436364_1420692 3300037853 Bacteria 8891
314 Ga0436365_0310730 3300039437 Bacteria 540
315 Ga0436365_0383665 3300039437 Bacteria 643
316 Ga0436365_1360801 3300039437 Bacteria 3394
317 Ga0436360_0125134 3300039438 Unclassified 1009
318 Ga0436360_0153426 3300039438 Bacteria 729
319 Ga0436360_0203368 3300039438 Bacteria 574
320 Ga0436360_0442223 3300039438 Bacteria 1372
321 Ga0436360_0653311 3300039438 Bacteria 995
322 Ga0436360_0664960 3300039438 Bacteria 1151
323 Ga0436360_0705024 3300039438 Bacteria 668
324 Ga0436360_0761125 3300039438 Bacteria 1765
325 Ga0436360_1135695 3300039438 Unclassified 567
326 Ga0436360_1198800 3300039438 Bacteria 653
327 Ga0436360_1302070 3300039438 Bacteria 1093
328 Ga0436361_0144311 3300039447 Bacteria 702
329 Ga0436361_0295633 3300039447 Bacteria 2949
330 Ga0436361_0534918 3300039447 Unclassified 850
331 Ga0436363_0002125 3300039450 Bacteria 12690
332 Ga0436363_0432638 3300039450 Bacteria 1808
333 Ga0436363_0565357 3300039450 Unclassified 1042
334 Ga0436363_0796440 3300039450 Bacteria 906
335 Ga0436363_1392544 3300039450 Bacteria 1608
336 Ga0436363_1680540 3300039450 Bacteria 1091
337 Ga0436362_0747529 3300039453 Bacteria 1542
338 Ga0436362_1094717 3300039453 Bacteria 575
339 Ga0436362_1176420 3300039453 Bacteria 905
340 Ga0436362_1289551 3300039453 Bacteria 1440
341 Ga0439465_0235928 3300041413 Bacteria 674
342 Ga0451853_1169942 3300041512 Bacteria 510
343 Ga0439458_0226651 3300042157 Bacteria 516
344 Ga0466963_0844687 3300044694 Bacteria 646
345 Ga0453684_0009320 3300044712 Bacteria 17224
346 Ga0466957_0665163 3300044842 Bacteria 733
347 Ga0466958_1020831 3300045836 Bacteria 540
348 Ga0466967_0925519 3300045976 Bacteria 867
349 Ga0466967_2040951 3300045976 Unclassified 570
350 Ga0495651_0252154 3300046462 Bacteria 1205
351 Ga0495580_0087633 3300046472 Bacteria 2168
352 Ga0495582_0283198 3300046473 Unclassified 952
353 Ga0495618_0571481 3300046514 Bacteria 675
354 Ga0495640_0148923 3300046533 Bacteria 1505
355 Ga0495640_0286743 3300046533 Bacteria 1025
356 Ga0495640_0640402 3300046533 Bacteria 640
357 Ga0495586_0316995 3300046535 Bacteria 894
358 Ga0495667_0836513 3300046559 Unclassified 566
359 Ga0495635_0326604 3300046663 Bacteria 1026
360 Ga0495657_0216121 3300046675 Bacteria 1164
361 Ga0495647_0058579 3300046681 Bacteria 1514
362 Ga0495658_0032958 3300046683 Bacteria 2833
363 Ga0495658_0756348 3300046683 Bacteria 622
364 Ga0495613_0193872 3300046689 Bacteria 1435
365 Ga0495604_0491817 3300047317 Bacteria 797
366 Ga0495675_0800181 3300047444 Unclassified 522
367 Ga0495684_0402753 3300047471 Bacteria 960
368 Ga0495602_0764245 3300048088 Bacteria 651
369 Ga0496100_0081120 3300048903 Bacteria 2191
370 Ga0496101_1492597 3300048904 Unclassified 526
371 Ga0496102_0217965 3300048905 Bacteria 1799
372 Ga0496102_0513405 3300048905 Bacteria 1121
373 Ga0496104_0006459 3300048907 Bacteria 10306
374 Ga0496104_0701378 3300048907 Bacteria 920
375 Ga0496105_0069294 3300048908 Bacteria 2915
376 Ga0496106_0139670 3300048909 Bacteria 1905
377 Ga0496108_0359101 3300048911 Bacteria 1271
378 Ga0496109_0018529 3300048912 Bacteria 6115
379 Ga0496109_0518510 3300048912 Bacteria 1125
380 Ga0496110_0041716 3300048913 Bacteria 4005
381 Ga0496110_0098138 3300048913 Bacteria 2625
382 Ga0496111_0141286 3300048914 Bacteria 1784
383 Ga0496111_1285925 3300048914 Bacteria 516
384 Ga0496112_0092482 3300048915 Bacteria 2994
385 Ga0496113_0121716 3300048916 Bacteria 2041
386 Ga0496114_0073625 3300048917 Bacteria 2875
387 Ga0496115_0007003 3300048918 Bacteria 8283
388 Ga0496126_0840948 3300048929 Unclassified 701
389 Ga0501033_0871761 3300049570 Unclassified 606
390 Ga0501036_0286339 3300049572 Bacteria 1379
391 Ga0501039_0089840 3300049575 Unclassified 2394
392 Ga0501039_0368255 3300049575 Bacteria 1129
393 Ga0501042_1221532 3300049578 Unclassified 548
394 Ga0501047_1013695 3300049581 Bacteria 643
395 Ga0501048_0266301 3300049582 Unclassified 1218
396 Ga0501069_0235272 3300049585 Bacteria 1067
397 Ga0501070_1376343 3300049586 Bacteria 537
398 Ga0501073_0635609 3300049589 Bacteria 737
399 Ga0501076_1156999 3300049592 Bacteria 637
400 Ga0501077_0938398 3300049593 Unclassified 557
401 Ga0501079_0184672 3300049741 Bacteria 1628
402 Ga0501080_1144337 3300049742 Bacteria 671
403 Ga0501081_1116873 3300049743 Unclassified 597
404 Ga0501083_0031412 3300049744 Bacteria 3645
405 Ga0501044_0113264 3300049823 Bacteria 2720
406 Ga0501045_0987646 3300049824 Unclassified 617
407 nmdc:mga03683_342361_c1 3300050489 Bacteria 707
408 nmdc:mga00v17_792856_c1 3300050491 Bacteria 604
409 nmdc:mga0yw44_340444_c1 3300050492 Bacteria 1009
410 nmdc:mga0yw44_407167_c1 3300050492 Bacteria 920
411 nmdc:mga0k408_346249_c1 3300050493 Bacteria 886
412 nmdc:mga06z11_602593_c1 3300050494 Bacteria 668
413 nmdc:mga05p37_48828_c1 3300050507 Bacteria 5204
414 nmdc:mga09592_36296_c1 3300050508 Bacteria 4127
415 nmdc:mga0qj67_655731_c1 3300050509 Bacteria 837
416 nmdc:mga06r32_72497_c1 3300050510 Bacteria 3334
417 nmdc:mga08y16_119835_c1 3300050511 Bacteria 2739
418 nmdc:mga0n895_1672357_c1 3300050512 Bacteria 599
419 nmdc:mga0rr50_1721835_c1 3300050513 Bacteria 528
420 nmdc:mga08x19_15244_c1 3300050514 Unclassified 4674
421 Ga0495601_0147733 3300053077 Bacteria 1534
422 Ga0495601_0355080 3300053077 Bacteria 953
423 Ga0495612_0062710 3300053078 Bacteria 1541
424 Ga0495612_0438204 3300053078 Bacteria 596
425 Ga0495619_0018080 3300053085 Bacteria 4470
426 Ga0495619_0256695 3300053085 Bacteria 1211
427 Ga0495619_0567372 3300053085 Bacteria 778
428 Ga0501084_0490061 3300054114 Bacteria 1039
429 Ga0501084_0531860 3300054114 Bacteria 994
430 Ga0501084_0779482 3300054114 Bacteria 805
431 Ga0105240_10479713
432 Ga0065707_10454769
433 Ga0070658_10722525
434 Ga0070676_10521337
435 Ga0070676_10581404
436 Ga0070690_100146968
437 Ga0070690_100168754
438 Ga0070670_100143056
439 Ga0068869_100021968
440 Ga0070680_100058853
441 Ga0070680_100257281
442 Ga0070680_100458417
443 Ga0070680_101410455
444 Ga0070682_100736561
445 Ga0068868_100176020
446 Ga0070689_100001664
447 Ga0070689_100101280
448 Ga0070691_10023886
449 Ga0070661_100433017
450 Ga0070692_10049587
451 Ga0070692_11225377
452 Ga0070675_100708906
453 Ga0070671_100372366
454 Ga0070671_101377812
455 Ga0070674_100036024
456 Ga0070674_100188542
457 Ga0070673_101567751
458 Ga0070688_100180273
459 Ga0070659_100836338
460 Ga0070709_11276548
461 Ga0070709_11331686
462 Ga0070714_100033938
463 Ga0070714_101248772
464 Ga0070714_101346022
465 Ga0070713_100030521
466 Ga0070713_100459689
467 Ga0070713_101554667
468 Ga0070710_10002314
469 Ga0070710_10481081
470 Ga0070701_10005288
471 Ga0070711_100064307
472 Ga0070711_100173232
473 Ga0070711_100519516
474 Ga0070711_101022680
475 Ga0070711_101317286
476 Ga0070705_100477943
477 Ga0070700_100004213
478 Ga0070700_100012609
479 Ga0070700_101179646
480 Ga0070694_100116702
481 Ga0070694_100192588
482 Ga0070708_100034755
483 Ga0070663_100131668
484 Ga0070663_100697461
485 Ga0070678_100076380
486 Ga0070678_100110964
487 Ga0070678_100365647
488 Ga0070662_101930600
489 Ga0070681_10037120
490 Ga0070681_10136994
491 Ga0068867_100017730
492 Ga0068867_100110611
493 Ga0068867_101331654
494 Ga0068867_101410600
495 Ga0068867_101932185
496 Ga0070698_100016937
497 Ga0070699_100162459
498 Ga0070679_100065571
499 Ga0070679_100195417
500 Ga0070697_100489890
501 Ga0068853_100143173
502 Ga0070672_100001303
503 Ga0070672_100653831
504 Ga0070686_100009259
505 Ga0070686_101633862
506 Ga0070695_101455569
507 Ga0070695_101731133
508 Ga0070696_100015241
509 Ga0070696_100051746
510 Ga0070696_100152900
511 Ga0070693_100304730
512 Ga0070704_100484632
513 Ga0070704_101857552
514 Ga0068855_100061976
515 Ga0068855_100196573
516 Ga0070664_100515033
517 Ga0068857_100209883
518 Ga0068854_100822411
519 Ga0068856_100594580
520 Ga0068856_102152971
521 Ga0070702_100000858
522 Ga0070702_100209480
523 Ga0068852_100270489
524 Ga0068859_100136457
525 Ga0068859_100519128
526 Ga0068859_101383019
527 Ga0068859_102541138
528 Ga0068864_100085546
529 Ga0068864_100449834
530 Ga0068864_101832883
531 Ga0068866_10011953
532 Ga0068866_10590356
533 Ga0068861_100000970
534 Ga0068863_100918840
535 Ga0068863_101136842
536 Ga0068863_101156160
537 Ga0068858_100003501
538 Ga0068858_100326529
539 Ga0068858_101444853
540 Ga0068860_100071474
541 Ga0068862_100067035
542 Ga0068862_100797493
543 Ga0081540_1002454
544 Ga0070717_11123402
545 Ga0075364_10343229
546 Ga0070712_100015173
547 Ga0070712_100053269
548 Ga0070712_101112952
549 Ga0075362_10174185
550 Ga0075367_10998108
551 Ga0075366_10571032
552 Ga0097621_100284961
553 Ga0097621_100389064
554 Ga0097621_102058044
555 Ga0097621_102113908
556 Ga0068871_100011124
557 Ga0068871_100391829
558 Ga0068871_101516112
559 Ga0068871_102054757
560 Ga0075430_100499300
561 Ga0075431_100009631
562 Ga0075431_101709542
563 Ga0075429_100173164
564 Ga0068865_100001909
565 Ga0068865_100083928
566 Ga0068865_100354806
567 Ga0075436_100013013
568 Ga0097620_100136446
569 Ga0097620_100519148
570 Ga0097620_101382918
571 Ga0097620_102540740
572 Ga0075435_101402723
573 Ga0099795_10187285
574 Ga0105240_12469236
575 Ga0111539_10106621
576 Ga0111539_10499426
577 Ga0105245_10086056
578 Ga0105245_10824033
579 Ga0105245_10851498
580 Ga0105247_10146728
581 Ga0105247_11646089
582 Ga0114129_10009531
583 Ga0105243_10000798
584 Ga0105243_10076343
585 Ga0105243_10163804
586 Ga0105241_10026169
587 Ga0105241_10530014
588 Ga0105242_11284471
589 Ga0105242_12243808
590 Ga0105248_12297976
591 Ga0105237_10010747
592 Ga0105238_11403876
593 Ga0105238_11789444
594 Ga0105238_12252356
595 Ga0105238_13054594
596 Ga0105249_10065598
597 Ga0105249_10152804
598 Ga0105249_10209136
599 Ga0105249_12958189
600 Ga0099796_10346470
601 Ga0105239_10020365
602 Ga0105246_12302807
603 Ga0157370_10133767
604 Ga0157369_10661686
605 Ga0157374_10206574
606 Ga0157374_11536562
607 Ga0157378_10033692
608 Ga0157378_10116146
609 Ga0157378_11588033
610 Ga0157378_13271092
611 Ga0157375_10351789
612 Ga0157375_10352605
613 Ga0157375_10677541
614 Ga0157375_12355034
615 Ga0163163_10065474
616 Ga0157380_10011865
617 Ga0157380_10208955
618 Ga0157380_11100612
619 Ga0157379_10379899
620 Ga0157379_10753769
621 Ga0157379_12374768
622 Ga0157376_10508675
623 Ga0157376_10544109
624 Ga0157376_11358321
625 Ga0184598_106064
626 Ga0206352_11112191
627 Ga0213873_10018038
628 Ga0213873_10039401
629 Ga0213874_10031653
630 Ga0213874_10144217
631 Ga0213874_10150170
632 Ga0213876_10101737
633 Ga0213875_10001235
634 Ga0213875_10032984
635 Ga0213871_10001506
636 Ga0213871_10089449
637 Ga0207656_10283949
638 Ga0207692_10064779
639 Ga0207692_10812775
640 Ga0207642_10224200
641 Ga0207642_10949769
642 Ga0207680_10818252
643 Ga0207699_10297498
644 Ga0207645_10915201
645 Ga0207684_10116738
646 Ga0207684_10983503
647 Ga0207654_10451521
648 Ga0207654_10601254
649 Ga0207707_10032701
650 Ga0207707_10043419
651 Ga0207671_10008421
652 Ga0207693_10016096
653 Ga0207693_10117448
654 Ga0207693_10149245
655 Ga0207693_11355721
656 Ga0207663_10151918
657 Ga0207663_10202992
658 Ga0207663_10302263
659 Ga0207663_10827514
660 Ga0207663_11148041
661 Ga0207663_11223571
662 Ga0207663_11274445
663 Ga0207660_10065468
664 Ga0207660_10101686
665 Ga0207660_10402854
666 Ga0207660_11377510
667 Ga0207649_11512545
668 Ga0207652_10098023
669 Ga0207652_10439114
670 Ga0207694_11124135
671 Ga0207650_10156470
672 Ga0207650_10963142
673 Ga0207659_10075794
674 Ga0207687_11373299
675 Ga0207664_10674862
676 Ga0207664_11227401
677 Ga0207644_10092689
678 Ga0207644_11662562
679 Ga0207690_10719758
680 Ga0207706_11586254
681 Ga0207686_10418640
682 Ga0207709_10246708
683 Ga0207709_10530816
684 Ga0207670_10068307
685 Ga0207670_10099149
686 Ga0207704_10007957
687 Ga0207704_11239602
688 Ga0207704_11618810
689 Ga0207665_10220191
690 Ga0207665_11190566
691 Ga0207691_10016784
692 Ga0207691_10495091
693 Ga0207711_10462294
694 Ga0207689_10007096
695 Ga0207689_11607810
696 Ga0207679_11095785
697 Ga0207667_10155971
698 Ga0207667_10165527
699 Ga0207712_10102079
700 Ga0207712_10211133
701 Ga0207668_11120638
702 Ga0207640_11733468
703 Ga0207658_10642459
704 Ga0207677_10098748
705 Ga0207703_10028240
706 Ga0207703_10327836
707 Ga0207703_11023803
708 Ga0207639_11881426
709 Ga0207678_10109137
710 Ga0207708_10000385
711 Ga0207708_10008430
712 Ga0207648_10001978
713 Ga0207648_10060508
714 Ga0207676_10354265
715 Ga0207676_11711001
716 Ga0207674_10028785
717 Ga0207675_100002060
718 Ga0207683_10013001
719 Ga0268265_10471976
720 Ga0268265_10827495
721 Ga0268264_10429820
722 Ga0268264_11299359
723 Ga0307406_11866069
724 Ga0307416_103759585
725 Ga0373944_0157818
726 Ga0373923_0675048
727 Ga0373945_0093255
728 Ga0373945_0438786
729 Ga0373953_0236777
730 Ga0373956_0243967
731 Ga0373946_0285514
732 Ga0373931_0093659
733 Ga0373935_0099844
734 Ga0373927_0058330
735 Ga0373927_0099278
736 Ga0373927_0215799
737 Ga0373947_0468244
738 Ga0373937_0081098
739 Ga0373925_0487022
740 Ga0373925_1297524
741 Ga0395905_0104749
742 Ga0436364_0905998
743 Ga0436364_1420692
744 Ga0436365_0310730
745 Ga0436365_0383665
746 Ga0436365_1360801
747 Ga0436360_0125134
748 Ga0436360_0153426
749 Ga0436360_0203368
750 Ga0436360_0442223
751 Ga0436360_0653311
752 Ga0436360_0664960
753 Ga0436360_0705024
754 Ga0436360_0761125
755 Ga0436360_1135695
756 Ga0436360_1198800
757 Ga0436360_1302070
758 Ga0436361_0144311
759 Ga0436361_0295633
760 Ga0436361_0534918
761 Ga0436363_0002125
762 Ga0436363_0432638
763 Ga0436363_0565357
764 Ga0436363_0796440
765 Ga0436363_1392544
766 Ga0436363_1680540
767 Ga0436362_0747529
768 Ga0436362_1094717
769 Ga0436362_1176420
770 Ga0436362_1289551
771 Ga0439465_0235928
772 Ga0451853_1169942
773 Ga0439458_0226651
774 Ga0466963_0844687
775 Ga0453684_0009320
776 Ga0466957_0665163
777 Ga0466958_1020831
778 Ga0466967_0925519
779 Ga0466967_2040951
780 Ga0495651_0252154
781 Ga0495580_0087633
782 Ga0495582_0283198
783 Ga0495618_0571481
784 Ga0495640_0148923
785 Ga0495640_0286743
786 Ga0495640_0640402
787 Ga0495586_0316995
788 Ga0495667_0836513
789 Ga0495635_0326604
790 Ga0495657_0216121
791 Ga0495647_0058579
792 Ga0495658_0032958
793 Ga0495658_0756348
794 Ga0495613_0193872
795 Ga0495604_0491817
796 Ga0495675_0800181
797 Ga0495684_0402753
798 Ga0495602_0764245
799 Ga0496100_0081120
800 Ga0496101_1492597
801 Ga0496102_0217965
802 Ga0496102_0513405
803 Ga0496104_0006459
804 Ga0496104_0701378
805 Ga0496105_0069294
806 Ga0496106_0139670
807 Ga0496108_0359101
808 Ga0496109_0018529
809 Ga0496109_0518510
810 Ga0496110_0041716
811 Ga0496110_0098138
812 Ga0496111_0141286
813 Ga0496111_1285925
814 Ga0496112_0092482
815 Ga0496113_0121716
816 Ga0496114_0073625
817 Ga0496115_0007003
818 Ga0496126_0840948
819 Ga0501033_0871761
820 Ga0501036_0286339
821 Ga0501039_0089840
822 Ga0501039_0368255
823 Ga0501042_1221532
824 Ga0501047_1013695
825 Ga0501048_0266301
826 Ga0501069_0235272
827 Ga0501070_1376343
828 Ga0501073_0635609
829 Ga0501076_1156999
830 Ga0501077_0938398
831 Ga0501079_0184672
832 Ga0501080_1144337
833 Ga0501081_1116873
834 Ga0501083_0031412
835 Ga0501044_0113264
836 Ga0501045_0987646
837 nmdc:mga03683_342361_c1
838 nmdc:mga00v17_792856_c1
839 nmdc:mga0yw44_340444_c1
840 nmdc:mga0yw44_407167_c1
841 nmdc:mga0k408_346249_c1
842 nmdc:mga06z11_602593_c1
843 nmdc:mga05p37_48828_c1
844 nmdc:mga09592_36296_c1
845 nmdc:mga0qj67_655731_c1
846 nmdc:mga06r32_72497_c1
847 nmdc:mga08y16_119835_c1
848 nmdc:mga0n895_1672357_c1
849 nmdc:mga0rr50_1721835_c1
850 nmdc:mga08x19_15244_c1
851 Ga0495601_0147733
852 Ga0495601_0355080
853 Ga0495612_0062710
854 Ga0495612_0438204
855 Ga0495619_0018080
856 Ga0495619_0256695
857 Ga0495619_0567372
858 Ga0501084_0490061
859 Ga0501084_0531860
860 Ga0501084_0779482

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

23

108

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.937 1 102
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.9283 1 102
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.9076 2 102
2omo-assembly4.cif.gz_E putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.9071 1 102
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.9034 2 102
ID Description Score Start End Superfamily
1tuvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.939 1 102 3.30.70.100
1tuvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9303 1 102 3.30.70.100
af_O33291_1_95_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9155 2 102 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9034 2 102 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9034 2 102 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2D7EFC9-F1-model_v4 deleted 0.9929 1 102
AF-A0A0P7YDZ5-F1-model_v4 ABM domain-containing protein 0.9891 1 102 GO:0005829
GO:0016491
AF-A0A3E0NDG9-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9879 1 102 GO:0004497
AF-A0A2D9JRY0-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.9865 1 102 GO:0004497
GO:0005829
AF-A0A7C7NDH3-F1-model_v4 deleted 0.9859 1 102

Map