F442145

General Info

Members Datasets Scaffolds Average Seq Length
430 254 860 187

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10026693|Ga0163161_100266932
Length 207
Sequence MRFEIRNAFFYAPKKPTHFISCAMEEINPWQTLESELKYDNNWISVTEHQVINPSGGNGIYGEVHFKNIAIGILPLDENYNTWLVGQYRYPLKAYSWEIPEGGGPLDKEPLDGAKRELLEETGMSAKYWKEIQRMHLSNSVSNELSIIYVATELIQGIAMPEETEQLVVKKLPFEEAYQMVLTGKITDSMSVAAILKAKLMILNGEL

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
85 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
225 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
226 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
227 2738541283 Pedobacter sp. OK701 Isolate Unclassified
228 2738541284 Pedobacter sp. YR016 Isolate Unclassified
229 2738541302 Pedobacter sp. CF074 Isolate Unclassified
230 2738543023 Pedobacter sp. OK628 Isolate Unclassified
231 2739367651 Pedobacter sp. OK291 Isolate Unclassified
232 2739367656 Pedobacter sp. CF523 Isolate Unclassified
233 2739367663 Pedobacter sp. YR510 Isolate Unclassified
234 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
235 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
236 2818991437 Pedobacter terrae 518 Isolate Unclassified
237 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
238 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
239 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
240 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
241 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
242 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
243 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
244 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
245 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
246 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
247 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
248 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
249 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
250 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
251 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
252 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
253 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
254 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0.93
Rhizosphere 85.58
Stem 0
Stem Tuber 0
Unclassified 11.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10026693 3300017792 Bacteria 4091
2 SwRhRL2b_contig_2665874 2162886007 Bacteria 8637
3 MBSR1b_contig_13861294 2162886012 Bacteria 1827
4 MBSR1b_contig_8776295 2162886012 Bacteria 1833
5 JGI25152J39213_1000054 3300002773 Bacteria 76796
6 JGI25150J39212_1000003 3300002774 Bacteria 508651
7 JGI25150J39212_1000004 3300002774 Bacteria 417320
8 JGI25151J46595_10000002 3300003187 Bacteria 731381
9 JGI25153J46596_10000015 3300003215 Bacteria 289820
10 rootH2_10008117 3300003320 Bacteria 30213
11 rootH2_10019662 3300003320 Bacteria 2163
12 rootL2_10200586 3300003322 Bacteria 3762
13 rootH1_10014534 3300003323 Bacteria 1408
14 JGI25160J50197_1016553 3300003354 Unclassified 2373
15 Ga0065714_10002307 3300005288 Bacteria 26043
16 Ga0065714_10002609 3300005288 Bacteria 23390
17 Ga0065714_10003190 3300005288 Bacteria 8794
18 Ga0065714_10065739 3300005288 Bacteria 8667
19 Ga0065714_10074750 3300005288 Bacteria 2994
20 Ga0065704_10001668 3300005289 Bacteria 7109
21 Ga0065704_10070323 3300005289 Bacteria 32863
22 Ga0065704_10389989 3300005289 Bacteria 751
23 Ga0065715_10138389 3300005293 Bacteria 1827
24 Ga0070690_100011440 3300005330 Bacteria 5190
25 Ga0070670_100001046 3300005331 Bacteria 21950
26 Ga0070670_100063147 3300005331 Bacteria 3178
27 Ga0070670_100621487 3300005331 Unclassified 968
28 Ga0068869_100025933 3300005334 Unclassified 4075
29 Ga0070666_10002509 3300005335 Bacteria 11106
30 Ga0070666_10016002 3300005335 Bacteria 4792
31 Ga0070666_10072525 3300005335 Bacteria 2344
32 Ga0068868_100000943 3300005338 Bacteria 19752
33 Ga0068868_100029488 3300005338 Bacteria 4201
34 Ga0070689_100120243 3300005340 Bacteria 2097
35 Ga0070689_100232029 3300005340 Bacteria 1517
36 Ga0070661_100035248 3300005344 Unclassified 3633
37 Ga0070668_100027385 3300005347 Bacteria 4328
38 Ga0070669_100019971 3300005353 Bacteria 4785
39 Ga0070671_100018604 3300005355 Bacteria 5645
40 Ga0070673_100023790 3300005364 Unclassified 4481
41 Ga0070673_100229031 3300005364 Bacteria 1611
42 Ga0070688_100033874 3300005365 Bacteria 3090
43 Ga0070667_100000753 3300005367 Bacteria 30884
44 Ga0070667_100133943 3300005367 Bacteria 2165
45 Ga0070662_100019567 3300005457 Bacteria 4597
46 Ga0070681_10033002 3300005458 Bacteria 5197
47 Ga0068867_100036065 3300005459 Bacteria 3588
48 Ga0070685_10049630 3300005466 Bacteria 2421
49 Ga0070684_100148964 3300005535 Unclassified 2119
50 Ga0068853_100082850 3300005539 Bacteria 2810
51 Ga0070672_100034631 3300005543 Unclassified 3834
52 Ga0070672_100073170 3300005543 Bacteria 2731
53 Ga0070686_100007139 3300005544 Bacteria 6227
54 Ga0070686_100558807 3300005544 Bacteria 896
55 Ga0068855_100005566 3300005563 Bacteria 15373
56 Ga0068855_100275464 3300005563 Bacteria 1870
57 Ga0070664_100000535 3300005564 Bacteria 28978
58 Ga0068857_100057396 3300005577 Bacteria 3455
59 Ga0068857_100059035 3300005577 Bacteria 3407
60 Ga0068854_100074314 3300005578 Bacteria 2493
61 Ga0068854_100678713 3300005578 Bacteria 887
62 Ga0068856_100112525 3300005614 Bacteria 2720
63 Ga0068856_100314247 3300005614 Bacteria 1584
64 Ga0068852_100066622 3300005616 Unclassified 3145
65 Ga0068852_100145797 3300005616 Unclassified 2196
66 Ga0068852_100522296 3300005616 Bacteria 1185
67 Ga0068852_100593497 3300005616 Bacteria 1111
68 Ga0068859_100055704 3300005617 Unclassified 3978
69 Ga0068859_100161135 3300005617 Bacteria 2322
70 Ga0068859_101213011 3300005617 Unclassified 831
71 Ga0068864_100000280 3300005618 Bacteria 45611
72 Ga0068864_100041723 3300005618 Unclassified 3924
73 Ga0068864_100287242 3300005618 Unclassified 1537
74 Ga0068861_100101233 3300005719 Bacteria 2292
75 Ga0068870_10380593 3300005840 Bacteria 913
76 Ga0068863_100007784 3300005841 Bacteria 10477
77 Ga0068863_100022043 3300005841 Bacteria 6082
78 Ga0068863_100106342 3300005841 Bacteria 2670
79 Ga0068858_100010366 3300005842 Bacteria 8828
80 Ga0068858_100237076 3300005842 Bacteria 1730
81 Ga0068860_100000110 3300005843 Bacteria 131175
82 Ga0068860_100169547 3300005843 Bacteria 2108
83 Ga0068860_100307533 3300005843 Bacteria 1554
84 Ga0068862_100038894 3300005844 Bacteria 4038
85 Ga0068862_100453175 3300005844 Bacteria 1210
86 Ga0081540_1003257 3300005983 Bacteria 12898
87 Ga0097621_100013112 3300006237 Bacteria 6164
88 Ga0097621_100090600 3300006237 Bacteria 2559
89 Ga0097621_100203487 3300006237 Unclassified 1720
90 Ga0068871_100007633 3300006358 Bacteria 7736
91 Ga0068871_100061389 3300006358 Bacteria 3070
92 Ga0068871_100348580 3300006358 Bacteria 1309
93 Ga0068871_100458446 3300006358 Unclassified 1144
94 Ga0075428_100770615 3300006844 Bacteria 1023
95 Ga0075430_100810725 3300006846 Unclassified 771
96 Ga0097620_100055703 3300006931 Unclassified 3978
97 Ga0097620_100161134 3300006931 Bacteria 2322
98 Ga0097620_101212771 3300006931 Unclassified 831
99 Ga0105244_10033756 3300009036 Bacteria 2696
100 Ga0105240_10000253 3300009093 Bacteria 106101
101 Ga0105240_10001160 3300009093 Bacteria 46165
102 Ga0105240_10019282 3300009093 Bacteria 9117
103 Ga0105240_10054150 3300009093 Bacteria 5029
104 Ga0105240_10278819 3300009093 Bacteria 1921
105 Ga0105240_10396443 3300009093 Bacteria 1556
106 Ga0105240_10434414 3300009093 Bacteria 1472
107 Ga0105240_10476876 3300009093 Bacteria 1391
108 Ga0111539_10008819 3300009094 Bacteria 12781
109 Ga0105241_10000921 3300009174 Bacteria 22269
110 Ga0105241_10085379 3300009174 Bacteria 2480
111 Ga0105248_10001049 3300009177 Bacteria 30595
112 Ga0105237_10002011 3300009545 Bacteria 25894
113 Ga0105237_10004225 3300009545 Bacteria 16725
114 Ga0105237_10010869 3300009545 Bacteria 9658
115 Ga0105237_10019647 3300009545 Bacteria 6976
116 Ga0105237_10040889 3300009545 Bacteria 4676
117 Ga0105237_10439804 3300009545 Bacteria 1310
118 Ga0105238_10000806 3300009551 Bacteria 32512
119 Ga0105238_10036705 3300009551 Bacteria 4982
120 Ga0105238_10391060 3300009551 Bacteria 1383
121 Ga0105238_10599404 3300009551 Bacteria 1109
122 Ga0105238_10699937 3300009551 Bacteria 1025
123 Ga0105249_10220290 3300009553 Bacteria 1867
124 Ga0105239_10000754 3300010375 Bacteria 45868
125 Ga0105239_10002487 3300010375 Bacteria 23470
126 Ga0105239_10004525 3300010375 Bacteria 16578
127 Ga0105239_10005010 3300010375 Bacteria 15637
128 Ga0105246_10766611 3300011119 Bacteria 852
129 Ga0157373_10000262 3300013100 Bacteria 42799
130 Ga0157373_10019166 3300013100 Bacteria 4981
131 Ga0157373_10019649 3300013100 Bacteria 4914
132 Ga0157373_10205808 3300013100 Bacteria 1388
133 Ga0157371_10000117 3300013102 Bacteria 121069
134 Ga0157371_10001520 3300013102 Bacteria 23949
135 Ga0157371_10003549 3300013102 Bacteria 14071
136 Ga0157371_10009852 3300013102 Bacteria 7487
137 Ga0157370_10003772 3300013104 Bacteria 17695
138 Ga0157370_10010246 3300013104 Bacteria 9898
139 Ga0157370_10021228 3300013104 Bacteria 6473
140 Ga0157370_10031313 3300013104 Bacteria 5205
141 Ga0157370_10091862 3300013104 Bacteria 2849
142 Ga0157370_10117441 3300013104 Bacteria 2485
143 Ga0157370_10138605 3300013104 Bacteria 2267
144 Ga0157370_10178700 3300013104 Bacteria 1972
145 Ga0157370_10237416 3300013104 Bacteria 1687
146 Ga0157370_10353258 3300013104 Bacteria 1355
147 Ga0157369_10000047 3300013105 Bacteria 172682
148 Ga0157369_10038399 3300013105 Bacteria 5236
149 Ga0157374_10055245 3300013296 Unclassified 3705
150 Ga0157378_10115640 3300013297 Bacteria 2465
151 Ga0163162_10000895 3300013306 Bacteria 27750
152 Ga0163162_10001109 3300013306 Bacteria 24984
153 Ga0163162_10007084 3300013306 Bacteria 10882
154 Ga0163162_10024283 3300013306 Bacteria 5983
155 Ga0163162_10199033 3300013306 Bacteria 2132
156 Ga0163162_10204162 3300013306 Bacteria 2105
157 Ga0157372_10002664 3300013307 Bacteria 19339
158 Ga0157372_10003000 3300013307 Bacteria 18202
159 Ga0157372_10114170 3300013307 Bacteria 3096
160 Ga0157375_10003115 3300013308 Bacteria 14397
161 Ga0157375_10229172 3300013308 Bacteria 2017
162 Ga0157375_10290508 3300013308 Unclassified 1798
163 Ga0157375_10704732 3300013308 Bacteria 1163
164 Ga0163163_10023928 3300014325 Bacteria 5807
165 Ga0163163_10033136 3300014325 Bacteria 4996
166 Ga0163163_10069771 3300014325 Bacteria 3499
167 Ga0163163_10166646 3300014325 Bacteria 2249
168 Ga0163163_11463291 3300014325 Bacteria 745
169 Ga0157380_10002429 3300014326 Bacteria 12558
170 Ga0157380_10029131 3300014326 Bacteria 4218
171 Ga0182008_10000002 3300014497 Bacteria 480216
172 Ga0182008_10000132 3300014497 Bacteria 56231
173 Ga0182008_10000294 3300014497 Bacteria 39204
174 Ga0182008_10021243 3300014497 Unclassified 3335
175 Ga0182008_10029039 3300014497 Bacteria 2795
176 Ga0157377_10009180 3300014745 Bacteria 4842
177 Ga0157377_10068619 3300014745 Bacteria 2043
178 Ga0157379_10100751 3300014968 Bacteria 2593
179 Ga0157376_10338413 3300014969 Bacteria 1436
180 Ga0157376_10358738 3300014969 Unclassified 1397
181 Ga0157376_10835751 3300014969 Bacteria 935
182 Ga0182006_1000179 3300015261 Bacteria 66779
183 Ga0182006_1000182 3300015261 Bacteria 65171
184 Ga0182006_1000349 3300015261 Bacteria 38806
185 Ga0182006_1003895 3300015261 Bacteria 7480
186 Ga0182006_1012363 3300015261 Bacteria 3731
187 Ga0182007_10000005 3300015262 Bacteria 442702
188 Ga0182007_10011302 3300015262 Bacteria 3478
189 Ga0182007_10011780 3300015262 Unclassified 3389
190 Ga0182005_1000224 3300015265 Bacteria 37425
191 Ga0183373_1002 3300015682 Bacteria 990153
192 Ga0163161_10000800 3300017792 Bacteria 24627
193 Ga0163161_10000830 3300017792 Bacteria 24159
194 Ga0163161_10000838 3300017792 Bacteria 23986
195 Ga0163161_10001299 3300017792 Bacteria 18626
196 Ga0163161_10049327 3300017792 Bacteria 3042
197 Ga0163161_10122115 3300017792 Bacteria 1958
198 Ga0163161_10265853 3300017792 Unclassified 1341
199 Ga0209436_103227 3300025208 Bacteria 4428
200 Ga0207425_1000003 3300025245 Bacteria 1145342
201 Ga0209129_1000014 3300025258 Bacteria 509018
202 Ga0209130_1004441 3300025284 Bacteria 5317
203 Ga0209025_1000007 3300025294 Bacteria 1145109
204 Ga0209758_1000012 3300025297 Bacteria 949866
205 Ga0207426_1000216 3300025302 Bacteria 136337
206 Ga0207680_10013256 3300025903 Bacteria 4229
207 Ga0207680_10016532 3300025903 Unclassified 3876
208 Ga0207647_10150659 3300025904 Bacteria 1360
209 Ga0207654_10005523 3300025911 Bacteria 6397
210 Ga0207654_10049820 3300025911 Bacteria 2404
211 Ga0207707_10033252 3300025912 Bacteria 4514
212 Ga0207695_10000021 3300025913 Bacteria 679399
213 Ga0207695_10001248 3300025913 Bacteria 43473
214 Ga0207695_10117833 3300025913 Bacteria 2627
215 Ga0207695_10217251 3300025913 Bacteria 1820
216 Ga0207695_10351728 3300025913 Bacteria 1360
217 Ga0207695_10417528 3300025913 Bacteria 1226
218 Ga0207671_10001328 3300025914 Bacteria 28918
219 Ga0207671_10002003 3300025914 Bacteria 22450
220 Ga0207671_10004879 3300025914 Bacteria 12608
221 Ga0207671_10012112 3300025914 Bacteria 6964
222 Ga0207671_10017094 3300025914 Bacteria 5607
223 Ga0207671_10028520 3300025914 Bacteria 4170
224 Ga0207671_10038512 3300025914 Bacteria 3543
225 Ga0207671_10300776 3300025914 Bacteria 1267
226 Ga0207671_10628697 3300025914 Bacteria 855
227 Ga0207662_10228817 3300025918 Bacteria 1213
228 Ga0207649_10013647 3300025920 Unclassified 4540
229 Ga0207681_10008265 3300025923 Bacteria 6363
230 Ga0207694_10004674 3300025924 Bacteria 10660
231 Ga0207694_10155241 3300025924 Bacteria 1846
232 Ga0207694_10364654 3300025924 Bacteria 1197
233 Ga0207650_10005416 3300025925 Bacteria 8711
234 Ga0207659_10047547 3300025926 Bacteria 3035
235 Ga0207706_10028697 3300025933 Bacteria 4967
236 Ga0207670_10136494 3300025936 Bacteria 1804
237 Ga0207670_10221829 3300025936 Bacteria 1448
238 Ga0207669_10059412 3300025937 Bacteria 2338
239 Ga0207669_10334351 3300025937 Bacteria 1164
240 Ga0207691_10008214 3300025940 Bacteria 10028
241 Ga0207691_10593578 3300025940 Bacteria 938
242 Ga0207711_10051972 3300025941 Unclassified 3510
243 Ga0207689_10051812 3300025942 Bacteria 3383
244 Ga0207679_10022146 3300025945 Unclassified 4322
245 Ga0207667_10001687 3300025949 Bacteria 27830
246 Ga0207667_10153037 3300025949 Bacteria 2374
247 Ga0207651_10043095 3300025960 Bacteria 3009
248 Ga0207651_10047364 3300025960 Bacteria 2898
249 Ga0207712_10350947 3300025961 Bacteria 1226
250 Ga0207668_10038904 3300025972 Bacteria 3196
251 Ga0207640_10639763 3300025981 Bacteria 905
252 Ga0207658_10021067 3300025986 Bacteria 4520
253 Ga0207658_11238836 3300025986 Bacteria 682
254 Ga0207677_10007254 3300026023 Bacteria 6113
255 Ga0207703_10129742 3300026035 Unclassified 2175
256 Ga0207639_10033891 3300026041 Bacteria 3770
257 Ga0207639_10102644 3300026041 Bacteria 2315
258 Ga0207639_10255586 3300026041 Bacteria 1530
259 Ga0207702_10047244 3300026078 Unclassified 3627
260 Ga0207702_10426971 3300026078 Bacteria 1282
261 Ga0207702_11257484 3300026078 Bacteria 734
262 Ga0207641_10057678 3300026088 Bacteria 3303
263 Ga0207641_10063978 3300026088 Bacteria 3143
264 Ga0207641_10074571 3300026088 Unclassified 2927
265 Ga0207648_10146977 3300026089 Bacteria 2079
266 Ga0207648_10398373 3300026089 Bacteria 1247
267 Ga0207676_10000681 3300026095 Bacteria 27020
268 Ga0207676_10268474 3300026095 Bacteria 1544
269 Ga0207674_10005266 3300026116 Bacteria 15396
270 Ga0207674_10008311 3300026116 Bacteria 12012
271 Ga0207674_10056420 3300026116 Bacteria 3989
272 Ga0207675_100024802 3300026118 Bacteria 5579
273 Ga0207675_100127064 3300026118 Bacteria 2416
274 Ga0207683_10195548 3300026121 Bacteria 1837
275 Ga0207698_10002119 3300026142 Bacteria 11707
276 Ga0209999_1027476 3300027543 Bacteria 1053
277 Ga0207428_10038829 3300027907 Bacteria 3868
278 Ga0268266_10000010 3300028379 Bacteria 1030233
279 Ga0268265_10172841 3300028380 Bacteria 1848
280 Ga0268265_10239226 3300028380 Bacteria 1601
281 Ga0268264_10000052 3300028381 Bacteria 321218
282 Ga0268264_10144206 3300028381 Bacteria 2127
283 Ga0268264_10252154 3300028381 Bacteria 1640
284 Ga0307517_10042902 3300028786 Bacteria 4835
285 Ga0307517_10192610 3300028786 Bacteria 1291
286 Ga0307517_10276061 3300028786 Unclassified 962
287 Ga0307511_10000362 3300030521 Bacteria 48275
288 Ga0265328_10136927 3300031239 Unclassified 918
289 Ga0265325_10081751 3300031241 Bacteria 1605
290 Ga0265331_10035939 3300031250 Bacteria 2435
291 Ga0265331_10064999 3300031250 Bacteria 1716
292 Ga0265316_10098874 3300031344 Bacteria 2220
293 Ga0307509_10059632 3300031507 Bacteria 4038
294 Ga0307509_10252917 3300031507 Bacteria 1544
295 Ga0265313_10013704 3300031595 Bacteria 4841
296 Ga0265314_10016016 3300031711 Bacteria 5936
297 Ga0307516_10001001 3300031730 Bacteria 39099
298 Ga0307405_10000009 3300031731 Bacteria 259388
299 Ga0307407_10000001 3300031903 Bacteria 570048
300 Ga0307412_10000050 3300031911 Bacteria 151527
301 Ga0307409_100000833 3300031995 Bacteria 14214
302 Ga0307416_100000008 3300032002 Bacteria 401343
303 Ga0307414_10000344 3300032004 Bacteria 26282
304 Ga0307414_10008697 3300032004 Bacteria 5782
305 Ga0307414_10054450 3300032004 Bacteria 2796
306 Ga0307414_10075067 3300032004 Bacteria 2452
307 Ga0307414_10208467 3300032004 Bacteria 1595
308 Ga0307414_10243063 3300032004 Unclassified 1491
309 Ga0307414_10979769 3300032004 Unclassified 778
310 Ga0307510_10400876 3300033180 Unclassified 815
311 Ga0373934_0114167 3300035086 Bacteria 1097
312 Ga0373953_0336146 3300035117 Unclassified 661
313 Ga0373954_0109135 3300035118 Bacteria 1338
314 Ga0373957_0323520 3300035120 Unclassified 656
315 Ga0373924_0163806 3300035410 Bacteria 976
316 Ga0373937_0005809 3300036401 Bacteria 10609
317 Ga0436365_1622828 3300039437 Bacteria 27494
318 Ga0466965_0007953 3300044683 Bacteria 4889
319 Ga0466961_0142202 3300044693 Bacteria 1501
320 Ga0453684_0033562 3300044712 Bacteria 7151
321 Ga0466968_0006457 3300044735 Bacteria 4421
322 Ga0466970_0034012 3300044765 Bacteria 2697
323 Ga0466970_0101840 3300044765 Bacteria 1564
324 Ga0466957_0356196 3300044842 Bacteria 994
325 Ga0466959_0000420 3300045049 Bacteria 24757
326 Ga0466958_0387707 3300045836 Bacteria 901
327 Ga0495592_0075682 3300046454 Bacteria 2444
328 Ga0495638_0067980 3300046460 Bacteria 2186
329 Ga0495638_0274153 3300046460 Bacteria 919
330 Ga0495651_0008762 3300046462 Bacteria 7760
331 Ga0495651_0490465 3300046462 Bacteria 788
332 Ga0495653_0003503 3300046463 Bacteria 12630
333 Ga0495662_0079139 3300046476 Unclassified 1598
334 Ga0495664_0132474 3300046477 Bacteria 1510
335 Ga0495583_0057985 3300046506 Bacteria 1740
336 Ga0495606_0002264 3300046507 Bacteria 22818
337 Ga0495606_0024744 3300046507 Bacteria 4318
338 Ga0495606_0035081 3300046507 Bacteria 3434
339 Ga0495608_0077785 3300046511 Bacteria 2159
340 Ga0495610_0000076 3300046512 Bacteria 118246
341 Ga0495610_0000696 3300046512 Bacteria 32341
342 Ga0495618_0021308 3300046514 Bacteria 3995
343 Ga0495628_0000344 3300046516 Bacteria 42305
344 Ga0495628_0477685 3300046516 Unclassified 902
345 Ga0495637_0005787 3300046520 Bacteria 6262
346 Ga0495648_0004081 3300046524 Bacteria 12598
347 Ga0495652_0002409 3300046529 Bacteria 19315
348 Ga0495586_0052749 3300046535 Bacteria 2202
349 Ga0495587_0000696 3300046536 Bacteria 22548
350 Ga0495609_0007600 3300046538 Bacteria 5388
351 Ga0495645_0012762 3300046543 Bacteria 5928
352 Ga0495633_0037364 3300046558 Bacteria 2323
353 Ga0495667_0000554 3300046559 Bacteria 23934
354 Ga0495667_0034126 3300046559 Bacteria 3402
355 Ga0495634_0472706 3300046642 Unclassified 737
356 Ga0495611_0000176 3300046648 Bacteria 46302
357 Ga0495625_0054549 3300046660 Bacteria 2854
358 Ga0495625_0106325 3300046660 Bacteria 1922
359 Ga0495625_0219369 3300046660 Bacteria 1247
360 Ga0495635_0397558 3300046663 Unclassified 916
361 Ga0495657_0000347 3300046675 Bacteria 42821
362 Ga0495657_0004862 3300046675 Bacteria 10698
363 Ga0495599_0015570 3300046678 Bacteria 4720
364 Ga0495647_0024062 3300046681 Unclassified 2215
365 Ga0495613_0079274 3300046689 Bacteria 2388
366 Ga0495670_0014786 3300046691 Bacteria 3842
367 Ga0495649_0287128 3300046694 Bacteria 840
368 Ga0495600_0007416 3300046809 Bacteria 6710
369 Ga0495660_0015470 3300046810 Bacteria 4406
370 Ga0495604_0012010 3300047317 Bacteria 6884
371 Ga0495674_0004796 3300047319 Bacteria 13012
372 Ga0495674_0033844 3300047319 Unclassified 4625
373 Ga0495674_0504958 3300047319 Unclassified 967
374 Ga0495680_0042900 3300047322 Bacteria 3585
375 Ga0495687_000039 3300047443 Bacteria 245077
376 Ga0495675_0000073 3300047444 Bacteria 69936
377 Ga0495684_0006940 3300047471 Bacteria 8793
378 Ga0495684_0076355 3300047471 Unclassified 2545
379 Ga0495686_0000046 3300047472 Bacteria 281963
380 Ga0495602_0079804 3300048088 Bacteria 2759
381 Ga0496112_0190012 3300048915 Bacteria 2016
382 Ga0496114_0312094 3300048917 Bacteria 1389
383 Ga0496115_0040339 3300048918 Bacteria 3711
384 Ga0496122_0004298 3300048925 Bacteria 17852
385 Ga0496123_0005429 3300048926 Bacteria 12835
386 Ga0501241_003024 3300049758 Bacteria 3216
387 nmdc:mga08y16_35642_c1 3300050511 Bacteria 5225
388 Ga0495619_0026067 3300053085 Unclassified 3759
389 Ga0500644_0014571 3300053088 Bacteria 2223
390 Ga0500644_0142055 3300053088 Bacteria 955
391 Ga0500646_0009260 3300053090 Bacteria 2521
392 Ga0500651_0000350 3300053093 Bacteria 25883
393 Ga0500650_0134752 3300053098 Bacteria 1147
394 Ga0500618_004885 3300053125 Bacteria 4174
395 Ga0500642_0054416 3300053130 Bacteria 1777
396 Ga0500588_0125061 3300053146 Unclassified 911
397 Ga0500633_0245316 3300053160 Bacteria 666
398 Ga0500637_0225448 3300053178 Bacteria 1058
399 Ga0500645_054990 3300053730 Unclassified 1157
400 2523105414 2522572158 Bacteria 6514390
401 2586208799 2585427687 Bacteria 5544917
402 2599481457 2599185184 Bacteria 6430550
403 2738759093 2738541283 Bacteria 7222293
404 2738761797 2738541284 Bacteria 5199923
405 2738854850 2738541302 Bacteria 5944758
406 2739302295 2738543023 Bacteria 6767879
407 2739587032 2739367651 Bacteria 6359826
408 2739618222 2739367656 Bacteria 5152243
409 2739646329 2739367663 Bacteria 5040914
410 2740031196 2739367866 Bacteria 4215900
411 2776615557 2775506987 Bacteria 5373360
412 2819547485 2818991437 Bacteria 5805520
413 2819573081 2818991442 Bacteria 8318214
414 2842726509 2842722452 Bacteria 6263924
415 2842911273 2842909656 Bacteria 6185908
416 2849286479 2849281842 Bacteria 6065644
417 2852631046 2852627209 Bacteria 5896285
418 2857631488 2857627736 Bacteria 5625397
419 2902051303 2902048731 Bacteria 4976191
420 2904448915 2904445276 Bacteria 5310396
421 2919190747 2919186247 Bacteria 6244071
422 2928083238 2928078545 Bacteria 6534839
423 2928152703 2928147474 Bacteria 6512076
424 2929179653 2929177148 Bacteria 7883697
425 2939669043 2939664404 Bacteria 6364494
426 2945982081 2945977869 Bacteria 7777518
427 2946003190 2945997725 Bacteria 6404843
428 2946018531 2946013367 Bacteria 7766675
429 2954020047 2954016120 Bacteria 6446024
430 2977234034 2977232053 Bacteria 5485925
431 Ga0163161_10026693
432 SwRhRL2b_contig_2665874
433 MBSR1b_contig_13861294
434 MBSR1b_contig_8776295
435 JGI25152J39213_1000054
436 JGI25150J39212_1000003
437 JGI25150J39212_1000004
438 JGI25151J46595_10000002
439 JGI25153J46596_10000015
440 rootH2_10008117
441 rootH2_10019662
442 rootL2_10200586
443 rootH1_10014534
444 JGI25160J50197_1016553
445 Ga0065714_10002307
446 Ga0065714_10002609
447 Ga0065714_10003190
448 Ga0065714_10065739
449 Ga0065714_10074750
450 Ga0065704_10001668
451 Ga0065704_10070323
452 Ga0065704_10389989
453 Ga0065715_10138389
454 Ga0070690_100011440
455 Ga0070670_100001046
456 Ga0070670_100063147
457 Ga0070670_100621487
458 Ga0068869_100025933
459 Ga0070666_10002509
460 Ga0070666_10016002
461 Ga0070666_10072525
462 Ga0068868_100000943
463 Ga0068868_100029488
464 Ga0070689_100120243
465 Ga0070689_100232029
466 Ga0070661_100035248
467 Ga0070668_100027385
468 Ga0070669_100019971
469 Ga0070671_100018604
470 Ga0070673_100023790
471 Ga0070673_100229031
472 Ga0070688_100033874
473 Ga0070667_100000753
474 Ga0070667_100133943
475 Ga0070662_100019567
476 Ga0070681_10033002
477 Ga0068867_100036065
478 Ga0070685_10049630
479 Ga0070684_100148964
480 Ga0068853_100082850
481 Ga0070672_100034631
482 Ga0070672_100073170
483 Ga0070686_100007139
484 Ga0070686_100558807
485 Ga0068855_100005566
486 Ga0068855_100275464
487 Ga0070664_100000535
488 Ga0068857_100057396
489 Ga0068857_100059035
490 Ga0068854_100074314
491 Ga0068854_100678713
492 Ga0068856_100112525
493 Ga0068856_100314247
494 Ga0068852_100066622
495 Ga0068852_100145797
496 Ga0068852_100522296
497 Ga0068852_100593497
498 Ga0068859_100055704
499 Ga0068859_100161135
500 Ga0068859_101213011
501 Ga0068864_100000280
502 Ga0068864_100041723
503 Ga0068864_100287242
504 Ga0068861_100101233
505 Ga0068870_10380593
506 Ga0068863_100007784
507 Ga0068863_100022043
508 Ga0068863_100106342
509 Ga0068858_100010366
510 Ga0068858_100237076
511 Ga0068860_100000110
512 Ga0068860_100169547
513 Ga0068860_100307533
514 Ga0068862_100038894
515 Ga0068862_100453175
516 Ga0081540_1003257
517 Ga0097621_100013112
518 Ga0097621_100090600
519 Ga0097621_100203487
520 Ga0068871_100007633
521 Ga0068871_100061389
522 Ga0068871_100348580
523 Ga0068871_100458446
524 Ga0075428_100770615
525 Ga0075430_100810725
526 Ga0097620_100055703
527 Ga0097620_100161134
528 Ga0097620_101212771
529 Ga0105244_10033756
530 Ga0105240_10000253
531 Ga0105240_10001160
532 Ga0105240_10019282
533 Ga0105240_10054150
534 Ga0105240_10278819
535 Ga0105240_10396443
536 Ga0105240_10434414
537 Ga0105240_10476876
538 Ga0111539_10008819
539 Ga0105241_10000921
540 Ga0105241_10085379
541 Ga0105248_10001049
542 Ga0105237_10002011
543 Ga0105237_10004225
544 Ga0105237_10010869
545 Ga0105237_10019647
546 Ga0105237_10040889
547 Ga0105237_10439804
548 Ga0105238_10000806
549 Ga0105238_10036705
550 Ga0105238_10391060
551 Ga0105238_10599404
552 Ga0105238_10699937
553 Ga0105249_10220290
554 Ga0105239_10000754
555 Ga0105239_10002487
556 Ga0105239_10004525
557 Ga0105239_10005010
558 Ga0105246_10766611
559 Ga0157373_10000262
560 Ga0157373_10019166
561 Ga0157373_10019649
562 Ga0157373_10205808
563 Ga0157371_10000117
564 Ga0157371_10001520
565 Ga0157371_10003549
566 Ga0157371_10009852
567 Ga0157370_10003772
568 Ga0157370_10010246
569 Ga0157370_10021228
570 Ga0157370_10031313
571 Ga0157370_10091862
572 Ga0157370_10117441
573 Ga0157370_10138605
574 Ga0157370_10178700
575 Ga0157370_10237416
576 Ga0157370_10353258
577 Ga0157369_10000047
578 Ga0157369_10038399
579 Ga0157374_10055245
580 Ga0157378_10115640
581 Ga0163162_10000895
582 Ga0163162_10001109
583 Ga0163162_10007084
584 Ga0163162_10024283
585 Ga0163162_10199033
586 Ga0163162_10204162
587 Ga0157372_10002664
588 Ga0157372_10003000
589 Ga0157372_10114170
590 Ga0157375_10003115
591 Ga0157375_10229172
592 Ga0157375_10290508
593 Ga0157375_10704732
594 Ga0163163_10023928
595 Ga0163163_10033136
596 Ga0163163_10069771
597 Ga0163163_10166646
598 Ga0163163_11463291
599 Ga0157380_10002429
600 Ga0157380_10029131
601 Ga0182008_10000002
602 Ga0182008_10000132
603 Ga0182008_10000294
604 Ga0182008_10021243
605 Ga0182008_10029039
606 Ga0157377_10009180
607 Ga0157377_10068619
608 Ga0157379_10100751
609 Ga0157376_10338413
610 Ga0157376_10358738
611 Ga0157376_10835751
612 Ga0182006_1000179
613 Ga0182006_1000182
614 Ga0182006_1000349
615 Ga0182006_1003895
616 Ga0182006_1012363
617 Ga0182007_10000005
618 Ga0182007_10011302
619 Ga0182007_10011780
620 Ga0182005_1000224
621 Ga0183373_1002
622 Ga0163161_10000800
623 Ga0163161_10000830
624 Ga0163161_10000838
625 Ga0163161_10001299
626 Ga0163161_10049327
627 Ga0163161_10122115
628 Ga0163161_10265853
629 Ga0209436_103227
630 Ga0207425_1000003
631 Ga0209129_1000014
632 Ga0209130_1004441
633 Ga0209025_1000007
634 Ga0209758_1000012
635 Ga0207426_1000216
636 Ga0207680_10013256
637 Ga0207680_10016532
638 Ga0207647_10150659
639 Ga0207654_10005523
640 Ga0207654_10049820
641 Ga0207707_10033252
642 Ga0207695_10000021
643 Ga0207695_10001248
644 Ga0207695_10117833
645 Ga0207695_10217251
646 Ga0207695_10351728
647 Ga0207695_10417528
648 Ga0207671_10001328
649 Ga0207671_10002003
650 Ga0207671_10004879
651 Ga0207671_10012112
652 Ga0207671_10017094
653 Ga0207671_10028520
654 Ga0207671_10038512
655 Ga0207671_10300776
656 Ga0207671_10628697
657 Ga0207662_10228817
658 Ga0207649_10013647
659 Ga0207681_10008265
660 Ga0207694_10004674
661 Ga0207694_10155241
662 Ga0207694_10364654
663 Ga0207650_10005416
664 Ga0207659_10047547
665 Ga0207706_10028697
666 Ga0207670_10136494
667 Ga0207670_10221829
668 Ga0207669_10059412
669 Ga0207669_10334351
670 Ga0207691_10008214
671 Ga0207691_10593578
672 Ga0207711_10051972
673 Ga0207689_10051812
674 Ga0207679_10022146
675 Ga0207667_10001687
676 Ga0207667_10153037
677 Ga0207651_10043095
678 Ga0207651_10047364
679 Ga0207712_10350947
680 Ga0207668_10038904
681 Ga0207640_10639763
682 Ga0207658_10021067
683 Ga0207658_11238836
684 Ga0207677_10007254
685 Ga0207703_10129742
686 Ga0207639_10033891
687 Ga0207639_10102644
688 Ga0207639_10255586
689 Ga0207702_10047244
690 Ga0207702_10426971
691 Ga0207702_11257484
692 Ga0207641_10057678
693 Ga0207641_10063978
694 Ga0207641_10074571
695 Ga0207648_10146977
696 Ga0207648_10398373
697 Ga0207676_10000681
698 Ga0207676_10268474
699 Ga0207674_10005266
700 Ga0207674_10008311
701 Ga0207674_10056420
702 Ga0207675_100024802
703 Ga0207675_100127064
704 Ga0207683_10195548
705 Ga0207698_10002119
706 Ga0209999_1027476
707 Ga0207428_10038829
708 Ga0268266_10000010
709 Ga0268265_10172841
710 Ga0268265_10239226
711 Ga0268264_10000052
712 Ga0268264_10144206
713 Ga0268264_10252154
714 Ga0307517_10042902
715 Ga0307517_10192610
716 Ga0307517_10276061
717 Ga0307511_10000362
718 Ga0265328_10136927
719 Ga0265325_10081751
720 Ga0265331_10035939
721 Ga0265331_10064999
722 Ga0265316_10098874
723 Ga0307509_10059632
724 Ga0307509_10252917
725 Ga0265313_10013704
726 Ga0265314_10016016
727 Ga0307516_10001001
728 Ga0307405_10000009
729 Ga0307407_10000001
730 Ga0307412_10000050
731 Ga0307409_100000833
732 Ga0307416_100000008
733 Ga0307414_10000344
734 Ga0307414_10008697
735 Ga0307414_10054450
736 Ga0307414_10075067
737 Ga0307414_10208467
738 Ga0307414_10243063
739 Ga0307414_10979769
740 Ga0307510_10400876
741 Ga0373934_0114167
742 Ga0373953_0336146
743 Ga0373954_0109135
744 Ga0373957_0323520
745 Ga0373924_0163806
746 Ga0373937_0005809
747 Ga0436365_1622828
748 Ga0466965_0007953
749 Ga0466961_0142202
750 Ga0453684_0033562
751 Ga0466968_0006457
752 Ga0466970_0034012
753 Ga0466970_0101840
754 Ga0466957_0356196
755 Ga0466959_0000420
756 Ga0466958_0387707
757 Ga0495592_0075682
758 Ga0495638_0067980
759 Ga0495638_0274153
760 Ga0495651_0008762
761 Ga0495651_0490465
762 Ga0495653_0003503
763 Ga0495662_0079139
764 Ga0495664_0132474
765 Ga0495583_0057985
766 Ga0495606_0002264
767 Ga0495606_0024744
768 Ga0495606_0035081
769 Ga0495608_0077785
770 Ga0495610_0000076
771 Ga0495610_0000696
772 Ga0495618_0021308
773 Ga0495628_0000344
774 Ga0495628_0477685
775 Ga0495637_0005787
776 Ga0495648_0004081
777 Ga0495652_0002409
778 Ga0495586_0052749
779 Ga0495587_0000696
780 Ga0495609_0007600
781 Ga0495645_0012762
782 Ga0495633_0037364
783 Ga0495667_0000554
784 Ga0495667_0034126
785 Ga0495634_0472706
786 Ga0495611_0000176
787 Ga0495625_0054549
788 Ga0495625_0106325
789 Ga0495625_0219369
790 Ga0495635_0397558
791 Ga0495657_0000347
792 Ga0495657_0004862
793 Ga0495599_0015570
794 Ga0495647_0024062
795 Ga0495613_0079274
796 Ga0495670_0014786
797 Ga0495649_0287128
798 Ga0495600_0007416
799 Ga0495660_0015470
800 Ga0495604_0012010
801 Ga0495674_0004796
802 Ga0495674_0033844
803 Ga0495674_0504958
804 Ga0495680_0042900
805 Ga0495687_000039
806 Ga0495675_0000073
807 Ga0495684_0006940
808 Ga0495684_0076355
809 Ga0495686_0000046
810 Ga0495602_0079804
811 Ga0496112_0190012
812 Ga0496114_0312094
813 Ga0496115_0040339
814 Ga0496122_0004298
815 Ga0496123_0005429
816 Ga0501241_003024
817 nmdc:mga08y16_35642_c1
818 Ga0495619_0026067
819 Ga0500644_0014571
820 Ga0500644_0142055
821 Ga0500646_0009260
822 Ga0500651_0000350
823 Ga0500650_0134752
824 Ga0500618_004885
825 Ga0500642_0054416
826 Ga0500588_0125061
827 Ga0500633_0245316
828 Ga0500637_0225448
829 Ga0500645_054990
830 2523105414
831 2586208799
832 2599481457
833 2738759093
834 2738761797
835 2738854850
836 2739302295
837 2739587032
838 2739618222
839 2739646329
840 2740031196
841 2776615557
842 2819547485
843 2819573081
844 2842726509
845 2842911273
846 2849286479
847 2852631046
848 2857631488
849 2902051303
850 2904448915
851 2919190747
852 2928083238
853 2928152703
854 2929179653
855 2939669043
856 2945982081
857 2946003190
858 2946018531
859 2954020047
860 2977234034

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

66

190

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c7q-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9321 7 183
5c8l-assembly1.cif.gz_B crystal structure of the bdellovibrio bacteriovorus nucleoside diphosphate sugar hydrolase 0.9284 7 184
1mk1-assembly1.cif.gz_A structure of the mt-adprase in complex with adpr, a nudix enzyme 0.9217 8 184
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9132 7 184
5i8u-assembly4.cif.gz_E crystal structure of the rv1700 (mt adprase) e142q mutant 0.9099 8 184
ID Description Score Start End Superfamily
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9284 7 184 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9237 7 179 3.90.79.10
5c8lB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9088 7 184 3.90.79.10
2yvmA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9001 4 184 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8938 7 179 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A519TYR5-F1-model_v4 deleted 0.9923 2 184
AF-A0A6A2FK87-F1-model_v4 NUDIX hydrolase 0.9882 1 184 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A7C1ZXS5-F1-model_v4 GDP-mannose pyrophosphatase (GDP-mannose hydrolase) (GDPMK) 0.9866 6 180 GO:0005829
GO:0006753
GO:0016787
GO:0019693
AF-A0A4Q3C8D5-F1-model_v4 NUDIX hydrolase 0.9864 1 140 GO:0016787
AF-A0A7W0MI53-F1-model_v4 NUDIX hydrolase 0.9859 15 178 GO:0005829
GO:0006753
GO:0016787
GO:0019693

Map