F442159

General Info

Members Datasets Scaffolds Average Seq Length
430 195 860 139

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10153414|Ga0207695_101534143
Length 142
Sequence MSIKRTAKAHWNGTFKDGTGDLTTQSTTLNKTQYSFKTRFADGVGTNPEELIAAAHAGCFTMAVGYALSEAGFTPGDLNTEAVLELNTDNIPTISNIHLSLTGAKIDGVDEAKFKEIAEGAKANCIVSRALNVQISLDVQYA

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
183 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
186 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
187 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 2.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 0.47
Rhizosphere 86.74
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10153414 3300025913 Bacteria 2240
2 JGI24736J21556_1017797 3300001904 Bacteria 1127
3 JGI24739J22299_10011570 3300001989 Bacteria 3257
4 JGI24739J22299_10160228 3300001989 Bacteria 664
5 JGI24737J22298_10000796 3300001990 Bacteria 11186
6 JGI24737J22298_10011338 3300001990 Bacteria 2923
7 JGI24735J21928_10000003 3300002067 Bacteria 385983
8 JGI24735J21928_10000008 3300002067 Bacteria 319819
9 JGI24735J21928_10008450 3300002067 Bacteria 3327
10 JGI24744J21845_10012132 3300002077 Bacteria 1752
11 JGI25162J39368_1001539 3300002737 Bacteria 11872
12 JGI25164J39214_1001160 3300002772 Bacteria 7321
13 JGI25165J46597_1000157 3300003214 Bacteria 108987
14 rootH1_10032600 3300003316 Bacteria 7369
15 rootH2_10002560 3300003320 Bacteria 75599
16 rootH2_10115733 3300003320 Bacteria 9788
17 rootL2_10021763 3300003322 Bacteria 1562
18 rootL2_10021764 3300003322 Bacteria 4402
19 rootH1_10045017 3300003323 Bacteria 20986
20 rootH1_10045018 3300003323 Bacteria 4097
21 rootH1_10049623 3300003323 Bacteria 6962
22 Ga0058863_11364988 3300004799 Bacteria 3410
23 Ga0058862_10039046 3300004803 Bacteria 2790
24 Ga0065714_10150436 3300005288 Bacteria 1110
25 Ga0065714_10255104 3300005288 Bacteria 764
26 Ga0070658_10000014 3300005327 Bacteria 244978
27 Ga0070658_10307585 3300005327 Unclassified 1352
28 Ga0070658_10363638 3300005327 Bacteria 1240
29 Ga0070658_10561439 3300005327 Unclassified 988
30 Ga0070658_10854330 3300005327 Bacteria 791
31 Ga0070676_10000269 3300005328 Bacteria 22806
32 Ga0070680_100001914 3300005336 Bacteria 15284
33 Ga0070680_100011709 3300005336 Bacteria 6798
34 Ga0070682_100004229 3300005337 Bacteria 7967
35 Ga0068868_100018760 3300005338 Bacteria 5174
36 Ga0068868_100018837 3300005338 Bacteria 5166
37 Ga0070660_100005601 3300005339 Bacteria 8707
38 Ga0070660_100119434 3300005339 Bacteria 2103
39 Ga0070660_100679426 3300005339 Bacteria 863
40 Ga0070660_101274939 3300005339 Bacteria 623
41 Ga0070691_10001848 3300005341 Bacteria 9231
42 Ga0070661_101236327 3300005344 Unclassified 625
43 Ga0070669_101055901 3300005353 Unclassified 698
44 Ga0070671_100004233 3300005355 Bacteria 11357
45 Ga0070674_100283311 3300005356 Bacteria 1314
46 Ga0070674_101897088 3300005356 Bacteria 541
47 Ga0070673_100036345 3300005364 Bacteria 3743
48 Ga0070673_101942418 3300005364 Bacteria 558
49 Ga0070659_100000455 3300005366 Bacteria 30281
50 Ga0070659_100022844 3300005366 Bacteria 4778
51 Ga0070663_100046919 3300005455 Bacteria 3059
52 Ga0070678_100001143 3300005456 Bacteria 14006
53 Ga0070662_100000192 3300005457 Bacteria 35614
54 Ga0070662_100890813 3300005457 Bacteria 759
55 Ga0070681_10012636 3300005458 Bacteria 8376
56 Ga0068867_100006330 3300005459 Bacteria 8375
57 Ga0070679_100002186 3300005530 Bacteria 17647
58 Ga0070679_100122420 3300005530 Bacteria 2585
59 Ga0070679_101172181 3300005530 Unclassified 713
60 Ga0070684_100111968 3300005535 Bacteria 2448
61 Ga0068853_100001919 3300005539 Bacteria 15325
62 Ga0068853_100007060 3300005539 Bacteria 8981
63 Ga0068853_100155599 3300005539 Bacteria 2060
64 Ga0068853_100205892 3300005539 Bacteria 1792
65 Ga0070665_100000032 3300005548 Bacteria 333352
66 Ga0068855_100000043 3300005563 Bacteria 149118
67 Ga0068855_100000517 3300005563 Bacteria 47550
68 Ga0068855_100006769 3300005563 Bacteria 13901
69 Ga0068855_100016939 3300005563 Bacteria 8764
70 Ga0068855_100052365 3300005563 Bacteria 4806
71 Ga0068855_100114557 3300005563 Bacteria 3091
72 Ga0068855_100147043 3300005563 Bacteria 2682
73 Ga0068855_100226783 3300005563 Bacteria 2093
74 Ga0068855_100289990 3300005563 Bacteria 1814
75 Ga0068855_100655381 3300005563 Unclassified 1127
76 Ga0068855_100900582 3300005563 Bacteria 934
77 Ga0068857_102264067 3300005577 Bacteria 533
78 Ga0068854_100338587 3300005578 Bacteria 1228
79 Ga0068854_101431175 3300005578 Bacteria 626
80 Ga0068856_100001612 3300005614 Bacteria 23598
81 Ga0068856_100012648 3300005614 Bacteria 8171
82 Ga0068856_100023794 3300005614 Bacteria 5958
83 Ga0068856_100504970 3300005614 Unclassified 1230
84 Ga0068852_100050202 3300005616 Bacteria 3573
85 Ga0068864_101349287 3300005618 Bacteria 714
86 Ga0068866_10066391 3300005718 Bacteria 1890
87 Ga0068866_10434686 3300005718 Bacteria 854
88 Ga0068870_10299639 3300005840 Bacteria 1014
89 Ga0068863_100000296 3300005841 Bacteria 51531
90 Ga0075366_10031263 3300006195 Bacteria 3133
91 Ga0075366_10062299 3300006195 Bacteria 2217
92 Ga0075366_10064382 3300006195 Bacteria 2180
93 Ga0075366_10635725 3300006195 Bacteria 662
94 Ga0097621_100000579 3300006237 Bacteria 25795
95 Ga0097621_100014043 3300006237 Bacteria 5984
96 Ga0068871_100000212 3300006358 Bacteria 40531
97 Ga0068871_100140062 3300006358 Bacteria 2056
98 Ga0068865_100000970 3300006881 Bacteria 16376
99 Ga0068865_100717739 3300006881 Unclassified 856
100 Ga0105240_10000104 3300009093 Bacteria 172082
101 Ga0105240_10003876 3300009093 Bacteria 23102
102 Ga0105240_10007899 3300009093 Bacteria 15342
103 Ga0105240_10039081 3300009093 Bacteria 6080
104 Ga0105240_10048067 3300009093 Bacteria 5395
105 Ga0105240_10098004 3300009093 Bacteria 3571
106 Ga0105240_10170269 3300009093 Bacteria 2580
107 Ga0105240_10171708 3300009093 Bacteria 2567
108 Ga0105240_10198738 3300009093 Bacteria 2351
109 Ga0105240_10208599 3300009093 Bacteria 2285
110 Ga0105240_10219668 3300009093 Bacteria 2215
111 Ga0105240_10265909 3300009093 Bacteria 1977
112 Ga0105240_11032974 3300009093 Bacteria 877
113 Ga0105245_10062383 3300009098 Bacteria 3363
114 Ga0105241_10000609 3300009174 Bacteria 26925
115 Ga0105241_10002461 3300009174 Bacteria 13914
116 Ga0105241_10005078 3300009174 Bacteria 9708
117 Ga0105241_10056373 3300009174 Bacteria 3013
118 Ga0105241_10094445 3300009174 Bacteria 2365
119 Ga0105241_10140843 3300009174 Bacteria 1963
120 Ga0105241_10305713 3300009174 Bacteria 1366
121 Ga0105241_11052283 3300009174 Bacteria 764
122 Ga0105242_10027947 3300009176 Bacteria 4485
123 Ga0105242_11890200 3300009176 Bacteria 637
124 Ga0105237_10001048 3300009545 Bacteria 37140
125 Ga0105237_10003047 3300009545 Bacteria 20209
126 Ga0105237_10005430 3300009545 Bacteria 14393
127 Ga0105237_10015258 3300009545 Bacteria 8003
128 Ga0105237_10035122 3300009545 Bacteria 5074
129 Ga0105237_10077683 3300009545 Bacteria 3310
130 Ga0105237_10079825 3300009545 Bacteria 3262
131 Ga0105237_10141559 3300009545 Bacteria 2399
132 Ga0105237_10385093 3300009545 Bacteria 1407
133 Ga0105237_10534390 3300009545 Bacteria 1179
134 Ga0105238_10018913 3300009551 Bacteria 7015
135 Ga0105238_10036502 3300009551 Bacteria 4996
136 Ga0105238_10541810 3300009551 Bacteria 1168
137 Ga0105238_11363447 3300009551 Bacteria 736
138 Ga0105239_10000007 3300010375 Bacteria 385297
139 Ga0105239_10000015 3300010375 Bacteria 319892
140 Ga0105239_10000816 3300010375 Bacteria 44236
141 Ga0105239_10002272 3300010375 Bacteria 24542
142 Ga0105239_10003149 3300010375 Bacteria 20474
143 Ga0105239_10003346 3300010375 Bacteria 19705
144 Ga0105239_10015185 3300010375 Bacteria 8535
145 Ga0105239_10119817 3300010375 Bacteria 2921
146 Ga0105239_10374530 3300010375 Bacteria 1609
147 Ga0105239_10417870 3300010375 Bacteria 1519
148 Ga0105239_10599074 3300010375 Bacteria 1257
149 Ga0105239_11204227 3300010375 Bacteria 873
150 Ga0105246_10550166 3300011119 Unclassified 989
151 Ga0105246_10631645 3300011119 Bacteria 930
152 Ga0157373_10000134 3300013100 Bacteria 58266
153 Ga0157373_10001240 3300013100 Bacteria 19499
154 Ga0157373_10029870 3300013100 Bacteria 3924
155 Ga0157373_10385884 3300013100 Bacteria 1002
156 Ga0157371_10002943 3300013102 Bacteria 15860
157 Ga0157371_10007186 3300013102 Bacteria 9045
158 Ga0157371_10015478 3300013102 Bacteria 5720
159 Ga0157371_10029451 3300013102 Bacteria 3971
160 Ga0157371_10178340 3300013102 Bacteria 1519
161 Ga0157370_10003893 3300013104 Bacteria 17389
162 Ga0157370_10012309 3300013104 Bacteria 8879
163 Ga0157370_10287399 3300013104 Bacteria 1519
164 Ga0157370_10435989 3300013104 Bacteria 1205
165 Ga0157370_10502139 3300013104 Bacteria 1114
166 Ga0157370_10510832 3300013104 Bacteria 1103
167 Ga0157369_10000566 3300013105 Bacteria 48674
168 Ga0157369_10048844 3300013105 Bacteria 4590
169 Ga0157369_10064319 3300013105 Bacteria 3951
170 Ga0157369_10252264 3300013105 Bacteria 1841
171 Ga0157374_10001177 3300013296 Bacteria 22312
172 Ga0157374_10002121 3300013296 Bacteria 16697
173 Ga0157374_10513513 3300013296 Bacteria 1204
174 Ga0157374_10514584 3300013296 Unclassified 1202
175 Ga0157374_10610496 3300013296 Bacteria 1101
176 Ga0157374_11839100 3300013296 Bacteria 631
177 Ga0157378_10022249 3300013297 Bacteria 5580
178 Ga0157378_10048486 3300013297 Bacteria 3777
179 Ga0157378_10050424 3300013297 Bacteria 3704
180 Ga0157378_10312182 3300013297 Bacteria 1525
181 Ga0163162_10003406 3300013306 Bacteria 15182
182 Ga0163162_10005776 3300013306 Bacteria 11971
183 Ga0163162_10298821 3300013306 Bacteria 1742
184 Ga0163162_10535784 3300013306 Bacteria 1300
185 Ga0163162_10825243 3300013306 Bacteria 1043
186 Ga0157372_10000020 3300013307 Bacteria 208056
187 Ga0157372_10000725 3300013307 Bacteria 35931
188 Ga0157372_10001414 3300013307 Bacteria 25877
189 Ga0157372_10002043 3300013307 Bacteria 21955
190 Ga0157372_10002074 3300013307 Bacteria 21765
191 Ga0157372_10013800 3300013307 Bacteria 8633
192 Ga0157372_10643774 3300013307 Bacteria 1234
193 Ga0157372_11550117 3300013307 Bacteria 763
194 Ga0157375_10073018 3300013308 Bacteria 3449
195 Ga0157375_10415015 3300013308 Bacteria 1512
196 Ga0182008_10019585 3300014497 Bacteria 3492
197 Ga0182008_10034486 3300014497 Bacteria 2537
198 Ga0182008_10065267 3300014497 Bacteria 1791
199 Ga0182008_10138510 3300014497 Bacteria 1216
200 Ga0157376_10031542 3300014969 Unclassified 4246
201 Ga0157376_10789597 3300014969 Bacteria 961
202 Ga0182007_10025347 3300015262 Unclassified 2067
203 Ga0182007_10044901 3300015262 Bacteria 1465
204 Ga0182007_10091316 3300015262 Bacteria 1003
205 Ga0163161_10409274 3300017792 Bacteria 1089
206 Ga0206351_10028307 3300020077 Bacteria 813
207 Ga0206351_10568253 3300020077 Bacteria 1621
208 Ga0206352_10173995 3300020078 Unclassified 561
209 Ga0206350_11346515 3300020080 Bacteria 575
210 Ga0206350_11396680 3300020080 Bacteria 525
211 Ga0224712_10386226 3300022467 Bacteria 666
212 Ga0207427_100025 3300025231 Bacteria 433726
213 Ga0209437_100010 3300025233 Bacteria 838447
214 Ga0209437_100089 3300025233 Bacteria 250476
215 Ga0209026_1000357 3300025250 Bacteria 43020
216 Ga0209026_1002107 3300025250 Bacteria 7804
217 Ga0209233_1000017 3300025261 Bacteria 898076
218 Ga0209233_1000655 3300025261 Bacteria 16841
219 Ga0209455_1000682 3300025272 Bacteria 20151
220 Ga0209050_1032876 3300025298 Bacteria 1585
221 Ga0207642_10047741 3300025899 Bacteria 1916
222 Ga0207642_10223447 3300025899 Bacteria 1054
223 Ga0207647_10000169 3300025904 Bacteria 52146
224 Ga0207647_10000206 3300025904 Bacteria 48374
225 Ga0207647_10049385 3300025904 Bacteria 2610
226 Ga0207647_10171497 3300025904 Bacteria 1263
227 Ga0207645_10001160 3300025907 Bacteria 21787
228 Ga0207643_10332794 3300025908 Bacteria 950
229 Ga0207705_10000043 3300025909 Bacteria 181491
230 Ga0207705_10125706 3300025909 Bacteria 1906
231 Ga0207705_10139750 3300025909 Bacteria 1808
232 Ga0207705_10251824 3300025909 Unclassified 1347
233 Ga0207654_10000940 3300025911 Bacteria 16008
234 Ga0207654_10001666 3300025911 Bacteria 11606
235 Ga0207654_10032593 3300025911 Bacteria 2881
236 Ga0207654_10171365 3300025911 Bacteria 1409
237 Ga0207654_10738748 3300025911 Bacteria 708
238 Ga0207654_10991035 3300025911 Bacteria 611
239 Ga0207707_10002144 3300025912 Bacteria 17867
240 Ga0207707_10050739 3300025912 Bacteria 3614
241 Ga0207695_10000048 3300025913 Bacteria 421800
242 Ga0207695_10007976 3300025913 Bacteria 13353
243 Ga0207695_10008731 3300025913 Bacteria 12637
244 Ga0207695_10010497 3300025913 Bacteria 11329
245 Ga0207695_10100382 3300025913 Bacteria 2890
246 Ga0207695_10110469 3300025913 Bacteria 2729
247 Ga0207695_10221742 3300025913 Bacteria 1798
248 Ga0207695_10275783 3300025913 Bacteria 1576
249 Ga0207695_10288685 3300025913 Bacteria 1533
250 Ga0207695_10301342 3300025913 Bacteria 1494
251 Ga0207695_10555577 3300025913 Unclassified 1029
252 Ga0207695_10576073 3300025913 Bacteria 1007
253 Ga0207671_10002352 3300025914 Bacteria 20357
254 Ga0207671_10005530 3300025914 Bacteria 11616
255 Ga0207671_10023992 3300025914 Bacteria 4591
256 Ga0207671_10037528 3300025914 Bacteria 3593
257 Ga0207671_10319622 3300025914 Bacteria 1228
258 Ga0207671_10529053 3300025914 Bacteria 940
259 Ga0207671_10575916 3300025914 Bacteria 897
260 Ga0207660_10003392 3300025917 Bacteria 10383
261 Ga0207657_10007134 3300025919 Bacteria 11475
262 Ga0207657_10179266 3300025919 Bacteria 1713
263 Ga0207657_10274356 3300025919 Bacteria 1340
264 Ga0207657_10424321 3300025919 Unclassified 1045
265 Ga0207657_10956531 3300025919 Bacteria 658
266 Ga0207649_10928578 3300025920 Unclassified 683
267 Ga0207652_10001983 3300025921 Bacteria 17713
268 Ga0207694_10067320 3300025924 Bacteria 2795
269 Ga0207694_10133143 3300025924 Bacteria 1994
270 Ga0207687_10600634 3300025927 Bacteria 927
271 Ga0207644_10007617 3300025931 Bacteria 7060
272 Ga0207690_10000190 3300025932 Bacteria 47477
273 Ga0207690_10011790 3300025932 Bacteria 5228
274 Ga0207706_10000167 3300025933 Bacteria 72622
275 Ga0207706_10208487 3300025933 Bacteria 1713
276 Ga0207686_10010761 3300025934 Bacteria 4985
277 Ga0207686_10792245 3300025934 Unclassified 759
278 Ga0207669_10190144 3300025937 Bacteria 1480
279 Ga0207669_11685345 3300025937 Bacteria 541
280 Ga0207704_10000042 3300025938 Bacteria 89683
281 Ga0207667_10000015 3300025949 Bacteria 417534
282 Ga0207667_10000644 3300025949 Bacteria 45263
283 Ga0207667_10010553 3300025949 Bacteria 10792
284 Ga0207667_10017043 3300025949 Bacteria 8195
285 Ga0207667_10107668 3300025949 Bacteria 2876
286 Ga0207667_10286582 3300025949 Bacteria 1683
287 Ga0207667_10287615 3300025949 Bacteria 1680
288 Ga0207667_11239799 3300025949 Bacteria 724
289 Ga0207651_10024281 3300025960 Bacteria 3746
290 Ga0207640_10028760 3300025981 Bacteria 3403
291 Ga0207640_10595696 3300025981 Bacteria 935
292 Ga0207677_10015719 3300026023 Bacteria 4462
293 Ga0207639_10013277 3300026041 Bacteria 5760
294 Ga0207639_10019287 3300026041 Bacteria 4862
295 Ga0207639_10023037 3300026041 Bacteria 4492
296 Ga0207639_10400060 3300026041 Bacteria 1237
297 Ga0207639_10639102 3300026041 Bacteria 984
298 Ga0207639_10740654 3300026041 Bacteria 913
299 Ga0207639_11977186 3300026041 Bacteria 544
300 Ga0207678_10234812 3300026067 Bacteria 1570
301 Ga0207702_10000165 3300026078 Bacteria 79066
302 Ga0207702_10034738 3300026078 Bacteria 4217
303 Ga0207702_10145384 3300026078 Bacteria 2151
304 Ga0207641_10000051 3300026088 Bacteria 174706
305 Ga0207648_10003557 3300026089 Bacteria 16296
306 Ga0207676_10037053 3300026095 Bacteria 3714
307 Ga0207674_10021734 3300026116 Bacteria 6906
308 Ga0207683_10002545 3300026121 Bacteria 15908
309 Ga0207698_10001222 3300026142 Bacteria 15005
310 Ga0268266_10000030 3300028379 Bacteria 417120
311 Ga0307517_10003956 3300028786 Bacteria 22947
312 Ga0307517_10026831 3300028786 Bacteria 6952
313 Ga0307515_10001736 3300028794 Bacteria 48546
314 Ga0265338_10503999 3300028800 Unclassified 852
315 Ga0307512_10297827 3300030522 Bacteria 754
316 Ga0265327_10139241 3300031251 Bacteria 1135
317 Ga0265327_10414509 3300031251 Unclassified 584
318 Ga0307509_10050878 3300031507 Bacteria 4434
319 Ga0307509_10060402 3300031507 Bacteria 4007
320 Ga0307509_10197317 3300031507 Bacteria 1855
321 Ga0307516_10000189 3300031730 Bacteria 79794
322 Ga0307412_10161072 3300031911 Bacteria 1667
323 Ga0307412_10417578 3300031911 Bacteria 1097
324 Ga0307507_10000023 3300033179 Bacteria 212423
325 Ga0307507_10001430 3300033179 Bacteria 53551
326 Ga0307510_10000147 3300033180 Bacteria 58704
327 Ga0307510_10001320 3300033180 Bacteria 27047
328 Ga0373941_0088969 3300035115 Bacteria 1056
329 Ga0395899_0000136 3300037312 Bacteria 112112
330 Ga0395899_0000286 3300037312 Bacteria 65138
331 Ga0395900_0000115 3300037418 Bacteria 138474
332 Ga0395900_0000285 3300037418 Bacteria 75772
333 Ga0395900_0480072 3300037418 Bacteria 1196
334 Ga0395900_1174729 3300037418 Bacteria 683
335 Ga0395898_0005702 3300037466 Bacteria 13415
336 Ga0395905_0000045 3300037471 Bacteria 241370
337 Ga0395901_0001032 3300038443 Bacteria 30164
338 Ga0395901_0509010 3300038443 Bacteria 1225
339 Ga0439436_0257430 3300041404 Bacteria 507
340 Ga0451849_1091099 3300041505 Bacteria 626
341 Ga0451851_1315931 3300041507 Unclassified 619
342 Ga0439448_0018357 3300042005 Bacteria 2142
343 Ga0439455_0076204 3300042012 Bacteria 907
344 Ga0466969_0354457 3300044656 Unclassified 664
345 Ga0466966_0121420 3300044684 Unclassified 1604
346 Ga0466964_0143908 3300044706 Bacteria 1099
347 Ga0466957_0329951 3300044842 Bacteria 1031
348 Ga0466958_0038231 3300045836 Bacteria 2879
349 Ga0495592_0612691 3300046454 Bacteria 663
350 Ga0495638_0457827 3300046460 Bacteria 650
351 Ga0495651_0135993 3300046462 Bacteria 1788
352 Ga0495650_0000119 3300046471 Bacteria 185719
353 Ga0495650_0086558 3300046471 Bacteria 1199
354 Ga0495585_0000173 3300046492 Bacteria 69500
355 Ga0495585_0000456 3300046492 Bacteria 39053
356 Ga0495596_0021550 3300046500 Bacteria 2630
357 Ga0495607_0150266 3300046501 Bacteria 1193
358 Ga0495583_0220584 3300046506 Bacteria 766
359 Ga0495606_0000008 3300046507 Bacteria 321373
360 Ga0495606_0110166 3300046507 Bacteria 1662
361 Ga0495608_0222631 3300046511 Bacteria 1183
362 Ga0495610_0000089 3300046512 Bacteria 106925
363 Ga0495610_0002038 3300046512 Bacteria 17252
364 Ga0495616_0002658 3300046513 Bacteria 11737
365 Ga0495616_0013249 3300046513 Bacteria 4659
366 Ga0495628_0145946 3300046516 Bacteria 1804
367 Ga0495631_0002766 3300046518 Bacteria 9734
368 Ga0495631_0166413 3300046518 Bacteria 946
369 Ga0495632_0052287 3300046519 Bacteria 2009
370 Ga0495632_0217090 3300046519 Bacteria 866
371 Ga0495637_0025708 3300046520 Bacteria 2651
372 Ga0495644_0061205 3300046523 Bacteria 1415
373 Ga0495648_0008886 3300046524 Bacteria 7853
374 Ga0495648_0237365 3300046524 Bacteria 888
375 Ga0495652_0062168 3300046529 Bacteria 3149
376 Ga0495652_0237533 3300046529 Bacteria 1359
377 Ga0495654_0299882 3300046530 Bacteria 656
378 Ga0495633_0000273 3300046558 Bacteria 60402
379 Ga0495633_0004402 3300046558 Bacteria 8976
380 Ga0495668_0000134 3300046616 Bacteria 112135
381 Ga0495611_0092410 3300046648 Bacteria 1399
382 Ga0495611_0423862 3300046648 Bacteria 607
383 Ga0495625_0000017 3300046660 Bacteria 299728
384 Ga0495625_0002361 3300046660 Bacteria 20556
385 Ga0495625_0004708 3300046660 Bacteria 12776
386 Ga0495625_0024525 3300046660 Bacteria 4590
387 Ga0495625_0032543 3300046660 Bacteria 3864
388 Ga0495625_0037005 3300046660 Bacteria 3583
389 Ga0495625_0070929 3300046660 Bacteria 2446
390 Ga0495625_0268795 3300046660 Bacteria 1101
391 Ga0495625_0546280 3300046660 Bacteria 702
392 Ga0495661_0027547 3300046665 Bacteria 3646
393 Ga0495669_0557921 3300046684 Bacteria 557
394 Ga0495670_0763573 3300046691 Unclassified 527
395 Ga0495670_0827160 3300046691 Bacteria 506
396 Ga0495649_0000121 3300046694 Bacteria 68443
397 Ga0495649_0352630 3300046694 Bacteria 743
398 Ga0495600_0462502 3300046809 Bacteria 783
399 Ga0495683_0032543 3300047323 Bacteria 2656
400 Ga0495683_0051944 3300047323 Bacteria 2047
401 Ga0495687_001739 3300047443 Bacteria 19268
402 Ga0495687_001856 3300047443 Bacteria 18416
403 Ga0495687_034031 3300047443 Bacteria 2306
404 Ga0495677_0214088 3300047445 Bacteria 750
405 Ga0495673_0119838 3300047469 Bacteria 1043
406 Ga0495686_0000974 3300047472 Bacteria 35181
407 Ga0495686_0001124 3300047472 Bacteria 31635
408 Ga0495686_0086810 3300047472 Bacteria 1904
409 Ga0495686_0126388 3300047472 Bacteria 1520
410 Ga0496100_1282821 3300048903 Unclassified 578
411 Ga0496115_0198846 3300048918 Bacteria 1656
412 Ga0495678_005167 3300049459 Bacteria 7314
413 nmdc:mga0k408_2155_c1 3300050493 Bacteria 7660
414 nmdc:mga0k408_41272_c1 3300050493 Bacteria 2656
415 nmdc:mga0k408_93674_c1 3300050493 Bacteria 1766
416 Ga0500635_0000997 3300053080 Bacteria 6785
417 Ga0500647_0376906 3300053091 Bacteria 582
418 Ga0500583_0491300 3300053092 Bacteria 578
419 Ga0500569_151755 3300053109 Bacteria 782
420 Ga0500608_002183 3300053122 Bacteria 7042
421 Ga0500614_104666 3300053123 Bacteria 819
422 Ga0500618_000266 3300053125 Bacteria 40517
423 Ga0500561_0164938 3300053137 Bacteria 693
424 Ga0500588_0003826 3300053146 Bacteria 3215
425 Ga0500616_0178343 3300053153 Bacteria 959
426 Ga0500622_0022740 3300053156 Bacteria 3320
427 Ga0500624_000153 3300053157 Bacteria 28320
428 Ga0500634_0209698 3300053161 Bacteria 847
429 Ga0500645_023694 3300053730 Bacteria 1881
430 Ga0587073_0175359 3300059492 Bacteria 625
431 Ga0207695_10153414
432 JGI24736J21556_1017797
433 JGI24739J22299_10011570
434 JGI24739J22299_10160228
435 JGI24737J22298_10000796
436 JGI24737J22298_10011338
437 JGI24735J21928_10000003
438 JGI24735J21928_10000008
439 JGI24735J21928_10008450
440 JGI24744J21845_10012132
441 JGI25162J39368_1001539
442 JGI25164J39214_1001160
443 JGI25165J46597_1000157
444 rootH1_10032600
445 rootH2_10002560
446 rootH2_10115733
447 rootL2_10021763
448 rootL2_10021764
449 rootH1_10045017
450 rootH1_10045018
451 rootH1_10049623
452 Ga0058863_11364988
453 Ga0058862_10039046
454 Ga0065714_10150436
455 Ga0065714_10255104
456 Ga0070658_10000014
457 Ga0070658_10307585
458 Ga0070658_10363638
459 Ga0070658_10561439
460 Ga0070658_10854330
461 Ga0070676_10000269
462 Ga0070680_100001914
463 Ga0070680_100011709
464 Ga0070682_100004229
465 Ga0068868_100018760
466 Ga0068868_100018837
467 Ga0070660_100005601
468 Ga0070660_100119434
469 Ga0070660_100679426
470 Ga0070660_101274939
471 Ga0070691_10001848
472 Ga0070661_101236327
473 Ga0070669_101055901
474 Ga0070671_100004233
475 Ga0070674_100283311
476 Ga0070674_101897088
477 Ga0070673_100036345
478 Ga0070673_101942418
479 Ga0070659_100000455
480 Ga0070659_100022844
481 Ga0070663_100046919
482 Ga0070678_100001143
483 Ga0070662_100000192
484 Ga0070662_100890813
485 Ga0070681_10012636
486 Ga0068867_100006330
487 Ga0070679_100002186
488 Ga0070679_100122420
489 Ga0070679_101172181
490 Ga0070684_100111968
491 Ga0068853_100001919
492 Ga0068853_100007060
493 Ga0068853_100155599
494 Ga0068853_100205892
495 Ga0070665_100000032
496 Ga0068855_100000043
497 Ga0068855_100000517
498 Ga0068855_100006769
499 Ga0068855_100016939
500 Ga0068855_100052365
501 Ga0068855_100114557
502 Ga0068855_100147043
503 Ga0068855_100226783
504 Ga0068855_100289990
505 Ga0068855_100655381
506 Ga0068855_100900582
507 Ga0068857_102264067
508 Ga0068854_100338587
509 Ga0068854_101431175
510 Ga0068856_100001612
511 Ga0068856_100012648
512 Ga0068856_100023794
513 Ga0068856_100504970
514 Ga0068852_100050202
515 Ga0068864_101349287
516 Ga0068866_10066391
517 Ga0068866_10434686
518 Ga0068870_10299639
519 Ga0068863_100000296
520 Ga0075366_10031263
521 Ga0075366_10062299
522 Ga0075366_10064382
523 Ga0075366_10635725
524 Ga0097621_100000579
525 Ga0097621_100014043
526 Ga0068871_100000212
527 Ga0068871_100140062
528 Ga0068865_100000970
529 Ga0068865_100717739
530 Ga0105240_10000104
531 Ga0105240_10003876
532 Ga0105240_10007899
533 Ga0105240_10039081
534 Ga0105240_10048067
535 Ga0105240_10098004
536 Ga0105240_10170269
537 Ga0105240_10171708
538 Ga0105240_10198738
539 Ga0105240_10208599
540 Ga0105240_10219668
541 Ga0105240_10265909
542 Ga0105240_11032974
543 Ga0105245_10062383
544 Ga0105241_10000609
545 Ga0105241_10002461
546 Ga0105241_10005078
547 Ga0105241_10056373
548 Ga0105241_10094445
549 Ga0105241_10140843
550 Ga0105241_10305713
551 Ga0105241_11052283
552 Ga0105242_10027947
553 Ga0105242_11890200
554 Ga0105237_10001048
555 Ga0105237_10003047
556 Ga0105237_10005430
557 Ga0105237_10015258
558 Ga0105237_10035122
559 Ga0105237_10077683
560 Ga0105237_10079825
561 Ga0105237_10141559
562 Ga0105237_10385093
563 Ga0105237_10534390
564 Ga0105238_10018913
565 Ga0105238_10036502
566 Ga0105238_10541810
567 Ga0105238_11363447
568 Ga0105239_10000007
569 Ga0105239_10000015
570 Ga0105239_10000816
571 Ga0105239_10002272
572 Ga0105239_10003149
573 Ga0105239_10003346
574 Ga0105239_10015185
575 Ga0105239_10119817
576 Ga0105239_10374530
577 Ga0105239_10417870
578 Ga0105239_10599074
579 Ga0105239_11204227
580 Ga0105246_10550166
581 Ga0105246_10631645
582 Ga0157373_10000134
583 Ga0157373_10001240
584 Ga0157373_10029870
585 Ga0157373_10385884
586 Ga0157371_10002943
587 Ga0157371_10007186
588 Ga0157371_10015478
589 Ga0157371_10029451
590 Ga0157371_10178340
591 Ga0157370_10003893
592 Ga0157370_10012309
593 Ga0157370_10287399
594 Ga0157370_10435989
595 Ga0157370_10502139
596 Ga0157370_10510832
597 Ga0157369_10000566
598 Ga0157369_10048844
599 Ga0157369_10064319
600 Ga0157369_10252264
601 Ga0157374_10001177
602 Ga0157374_10002121
603 Ga0157374_10513513
604 Ga0157374_10514584
605 Ga0157374_10610496
606 Ga0157374_11839100
607 Ga0157378_10022249
608 Ga0157378_10048486
609 Ga0157378_10050424
610 Ga0157378_10312182
611 Ga0163162_10003406
612 Ga0163162_10005776
613 Ga0163162_10298821
614 Ga0163162_10535784
615 Ga0163162_10825243
616 Ga0157372_10000020
617 Ga0157372_10000725
618 Ga0157372_10001414
619 Ga0157372_10002043
620 Ga0157372_10002074
621 Ga0157372_10013800
622 Ga0157372_10643774
623 Ga0157372_11550117
624 Ga0157375_10073018
625 Ga0157375_10415015
626 Ga0182008_10019585
627 Ga0182008_10034486
628 Ga0182008_10065267
629 Ga0182008_10138510
630 Ga0157376_10031542
631 Ga0157376_10789597
632 Ga0182007_10025347
633 Ga0182007_10044901
634 Ga0182007_10091316
635 Ga0163161_10409274
636 Ga0206351_10028307
637 Ga0206351_10568253
638 Ga0206352_10173995
639 Ga0206350_11346515
640 Ga0206350_11396680
641 Ga0224712_10386226
642 Ga0207427_100025
643 Ga0209437_100010
644 Ga0209437_100089
645 Ga0209026_1000357
646 Ga0209026_1002107
647 Ga0209233_1000017
648 Ga0209233_1000655
649 Ga0209455_1000682
650 Ga0209050_1032876
651 Ga0207642_10047741
652 Ga0207642_10223447
653 Ga0207647_10000169
654 Ga0207647_10000206
655 Ga0207647_10049385
656 Ga0207647_10171497
657 Ga0207645_10001160
658 Ga0207643_10332794
659 Ga0207705_10000043
660 Ga0207705_10125706
661 Ga0207705_10139750
662 Ga0207705_10251824
663 Ga0207654_10000940
664 Ga0207654_10001666
665 Ga0207654_10032593
666 Ga0207654_10171365
667 Ga0207654_10738748
668 Ga0207654_10991035
669 Ga0207707_10002144
670 Ga0207707_10050739
671 Ga0207695_10000048
672 Ga0207695_10007976
673 Ga0207695_10008731
674 Ga0207695_10010497
675 Ga0207695_10100382
676 Ga0207695_10110469
677 Ga0207695_10221742
678 Ga0207695_10275783
679 Ga0207695_10288685
680 Ga0207695_10301342
681 Ga0207695_10555577
682 Ga0207695_10576073
683 Ga0207671_10002352
684 Ga0207671_10005530
685 Ga0207671_10023992
686 Ga0207671_10037528
687 Ga0207671_10319622
688 Ga0207671_10529053
689 Ga0207671_10575916
690 Ga0207660_10003392
691 Ga0207657_10007134
692 Ga0207657_10179266
693 Ga0207657_10274356
694 Ga0207657_10424321
695 Ga0207657_10956531
696 Ga0207649_10928578
697 Ga0207652_10001983
698 Ga0207694_10067320
699 Ga0207694_10133143
700 Ga0207687_10600634
701 Ga0207644_10007617
702 Ga0207690_10000190
703 Ga0207690_10011790
704 Ga0207706_10000167
705 Ga0207706_10208487
706 Ga0207686_10010761
707 Ga0207686_10792245
708 Ga0207669_10190144
709 Ga0207669_11685345
710 Ga0207704_10000042
711 Ga0207667_10000015
712 Ga0207667_10000644
713 Ga0207667_10010553
714 Ga0207667_10017043
715 Ga0207667_10107668
716 Ga0207667_10286582
717 Ga0207667_10287615
718 Ga0207667_11239799
719 Ga0207651_10024281
720 Ga0207640_10028760
721 Ga0207640_10595696
722 Ga0207677_10015719
723 Ga0207639_10013277
724 Ga0207639_10019287
725 Ga0207639_10023037
726 Ga0207639_10400060
727 Ga0207639_10639102
728 Ga0207639_10740654
729 Ga0207639_11977186
730 Ga0207678_10234812
731 Ga0207702_10000165
732 Ga0207702_10034738
733 Ga0207702_10145384
734 Ga0207641_10000051
735 Ga0207648_10003557
736 Ga0207676_10037053
737 Ga0207674_10021734
738 Ga0207683_10002545
739 Ga0207698_10001222
740 Ga0268266_10000030
741 Ga0307517_10003956
742 Ga0307517_10026831
743 Ga0307515_10001736
744 Ga0265338_10503999
745 Ga0307512_10297827
746 Ga0265327_10139241
747 Ga0265327_10414509
748 Ga0307509_10050878
749 Ga0307509_10060402
750 Ga0307509_10197317
751 Ga0307516_10000189
752 Ga0307412_10161072
753 Ga0307412_10417578
754 Ga0307507_10000023
755 Ga0307507_10001430
756 Ga0307510_10000147
757 Ga0307510_10001320
758 Ga0373941_0088969
759 Ga0395899_0000136
760 Ga0395899_0000286
761 Ga0395900_0000115
762 Ga0395900_0000285
763 Ga0395900_0480072
764 Ga0395900_1174729
765 Ga0395898_0005702
766 Ga0395905_0000045
767 Ga0395901_0001032
768 Ga0395901_0509010
769 Ga0439436_0257430
770 Ga0451849_1091099
771 Ga0451851_1315931
772 Ga0439448_0018357
773 Ga0439455_0076204
774 Ga0466969_0354457
775 Ga0466966_0121420
776 Ga0466964_0143908
777 Ga0466957_0329951
778 Ga0466958_0038231
779 Ga0495592_0612691
780 Ga0495638_0457827
781 Ga0495651_0135993
782 Ga0495650_0000119
783 Ga0495650_0086558
784 Ga0495585_0000173
785 Ga0495585_0000456
786 Ga0495596_0021550
787 Ga0495607_0150266
788 Ga0495583_0220584
789 Ga0495606_0000008
790 Ga0495606_0110166
791 Ga0495608_0222631
792 Ga0495610_0000089
793 Ga0495610_0002038
794 Ga0495616_0002658
795 Ga0495616_0013249
796 Ga0495628_0145946
797 Ga0495631_0002766
798 Ga0495631_0166413
799 Ga0495632_0052287
800 Ga0495632_0217090
801 Ga0495637_0025708
802 Ga0495644_0061205
803 Ga0495648_0008886
804 Ga0495648_0237365
805 Ga0495652_0062168
806 Ga0495652_0237533
807 Ga0495654_0299882
808 Ga0495633_0000273
809 Ga0495633_0004402
810 Ga0495668_0000134
811 Ga0495611_0092410
812 Ga0495611_0423862
813 Ga0495625_0000017
814 Ga0495625_0002361
815 Ga0495625_0004708
816 Ga0495625_0024525
817 Ga0495625_0032543
818 Ga0495625_0037005
819 Ga0495625_0070929
820 Ga0495625_0268795
821 Ga0495625_0546280
822 Ga0495661_0027547
823 Ga0495669_0557921
824 Ga0495670_0763573
825 Ga0495670_0827160
826 Ga0495649_0000121
827 Ga0495649_0352630
828 Ga0495600_0462502
829 Ga0495683_0032543
830 Ga0495683_0051944
831 Ga0495687_001739
832 Ga0495687_001856
833 Ga0495687_034031
834 Ga0495677_0214088
835 Ga0495673_0119838
836 Ga0495686_0000974
837 Ga0495686_0001124
838 Ga0495686_0086810
839 Ga0495686_0126388
840 Ga0496100_1282821
841 Ga0496115_0198846
842 Ga0495678_005167
843 nmdc:mga0k408_2155_c1
844 nmdc:mga0k408_41272_c1
845 nmdc:mga0k408_93674_c1
846 Ga0500635_0000997
847 Ga0500647_0376906
848 Ga0500583_0491300
849 Ga0500569_151755
850 Ga0500608_002183
851 Ga0500614_104666
852 Ga0500618_000266
853 Ga0500561_0164938
854 Ga0500588_0003826
855 Ga0500616_0178343
856 Ga0500622_0022740
857 Ga0500624_000153
858 Ga0500634_0209698
859 Ga0500645_023694
860 Ga0587073_0175359

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

41

140

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9467 1 139
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9444 1 139
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.944 1 139
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9401 1 139
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9379 1 139
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9427 1 139 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9362 1 139 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8963 4 139 3.30.300.20
af_Q57993_77_188_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8895 39 137 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8764 1 137 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A1H5WVH9-F1-model_v4 Osmotically inducible protein OsmC 0.9835 1 139 GO:0004601
GO:0006979
AF-A0A7Y4QFA4-F1-model_v4 OsmC family protein 0.9835 1 139 GO:0004601
GO:0006979
AF-A0A0Q5T6M1-F1-model_v4 Peroxiredoxin 0.9806 1 138 GO:0004601
GO:0006979
AF-A0A1N6JDU6-F1-model_v4 Osmotically inducible protein OsmC 0.9802 1 139 GO:0004601
GO:0006979
AF-A0A7G6YP33-F1-model_v4 OsmC family peroxiredoxin 0.9776 1 139 GO:0004601
GO:0006979

Map