F442181

General Info

Members Datasets Scaffolds Average Seq Length
430 220 860 381

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0112400|Ga0373925_0112400_44_1402
Length 452
Sequence LINTCLGADIHLTSEVTEEDRENNSRSQGPRMTDEASHCGDQSINRTIAASLKRSCKMKPAHRQAVSEVSILPDSRDDSLELSDLIGEVYDTVLDQSLWQGVIERAARFVRGSGASLFSKNVANQEGSVQYEFGIDPHYKRLYFEKYVMLDPATTGHFLAEIDQPVAVADLMSPAEFLETRFYREWVQPQGLVDFVSAVLDKSATSAALFGVFRSERDGMVDDETRRRMRLIVPHIRRAVLIGRMFDLKAAEAATFADTLDGLSVGMCLVDASGRIVHANAAGYAIIGAGEILRSAGGRLVAHDAQVDKTLRETFAAAGQGDGALGTMGIAVPLTGKDGERYVAHVLPLTSGARRRAGKTYTAAAALFVRKAAMEVPSAFEVIGKTFKLTPTELRVLLAIVDVGGVPEVAAALGVAVTTVKTHLGRLFEKTGATRQADLVKLVAGYATPLSG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
195 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
210 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
216 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
217 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
218 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
219 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
220 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0.7
Rhizoplane 7.21
Rhizosphere 82.79
Stem 0
Stem Tuber 0
Unclassified 6.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0112400 3300037068 Bacteria 2106
2 rootH2_10235605 3300003320 Bacteria 1951
3 Ga0070666_10145976 3300005335 Bacteria 1649
4 Ga0070680_100033603 3300005336 Bacteria 4136
5 Ga0070680_100058089 3300005336 Bacteria 3163
6 Ga0070689_100057735 3300005340 Bacteria 3013
7 Ga0070691_10051410 3300005341 Bacteria 1968
8 Ga0070667_100085940 3300005367 Bacteria 2698
9 Ga0070709_10019266 3300005434 Bacteria 3942
10 Ga0070714_100018663 3300005435 Bacteria 5640
11 Ga0070714_100024827 3300005435 Plasmid 4940
12 Ga0070713_100016223 3300005436 Bacteria 5598
13 Ga0070713_100026518 3300005436 Bacteria 4550
14 Ga0070711_100034904 3300005439 Bacteria 3358
15 Ga0070711_100308148 3300005439 Bacteria 1261
16 Ga0070663_100072584 3300005455 Bacteria 2508
17 Ga0070681_10006312 3300005458 Bacteria 11525
18 Ga0068867_100111419 3300005459 Bacteria 2103
19 Ga0070707_100292439 3300005468 Bacteria 1583
20 Ga0070684_100099903 3300005535 Bacteria 2590
21 Ga0068853_100237067 3300005539 Unclassified 1671
22 Ga0070672_100226179 3300005543 Unclassified 1570
23 Ga0070672_100250722 3300005543 Unclassified 1491
24 Ga0070693_100002862 3300005547 Bacteria 7955
25 Ga0068855_100133716 3300005563 Bacteria 2831
26 Ga0070664_100129486 3300005564 Unclassified 2216
27 Ga0068854_100149039 3300005578 Bacteria 1802
28 Ga0068856_100180419 3300005614 Bacteria 2124
29 Ga0068852_100013691 3300005616 Bacteria 6214
30 Ga0068852_100348416 3300005616 Bacteria 1445
31 Ga0068858_100119139 3300005842 Bacteria 2468
32 Ga0068858_100168568 3300005842 Bacteria 2064
33 Ga0068860_100001170 3300005843 Bacteria 28729
34 Ga0070717_10301701 3300006028 Bacteria 1424
35 Ga0070715_10026589 3300006163 Bacteria 2303
36 Ga0075366_10023294 3300006195 Bacteria 3607
37 Ga0075370_10016780 3300006353 Bacteria 3945
38 Ga0075428_100083537 3300006844 Bacteria 3484
39 Ga0075430_100025160 3300006846 Bacteria 5062
40 Ga0075431_100025700 3300006847 Bacteria 6035
41 Ga0075434_100070885 3300006871 Bacteria 3476
42 Ga0075434_100194560 3300006871 Unclassified 2048
43 Ga0075434_100315934 3300006871 Bacteria 1583
44 Ga0068865_100084476 3300006881 Unclassified 2287
45 Ga0075435_100020700 3300007076 Bacteria 5048
46 Ga0075435_100103242 3300007076 Bacteria 2364
47 Ga0099794_10001293 3300007265 Bacteria 8683
48 Ga0099794_10007247 3300007265 Bacteria 4544
49 Ga0099794_10007504 3300007265 Bacteria 4486
50 Ga0099794_10028280 3300007265 Bacteria 2607
51 Ga0099795_10002049 3300007788 Bacteria 4625
52 Ga0099795_10014082 3300007788 Bacteria 2471
53 Ga0105247_10014123 3300009101 Bacteria 4790
54 Ga0105247_10030717 3300009101 Bacteria 3258
55 Ga0105247_10084703 3300009101 Bacteria 2003
56 Ga0105243_10093684 3300009148 Bacteria 2479
57 Ga0105242_10100229 3300009176 Bacteria 2453
58 Ga0105242_10227718 3300009176 Bacteria 1669
59 Ga0105248_10013866 3300009177 Bacteria 8868
60 Ga0105238_10011135 3300009551 Bacteria 9044
61 Ga0105238_10059253 3300009551 Bacteria 3836
62 Ga0105249_10098335 3300009553 Bacteria 2748
63 Ga0105249_10248451 3300009553 Bacteria 1762
64 Ga0099796_10004574 3300010159 Bacteria 3366
65 Ga0099796_10004988 3300010159 Bacteria 3271
66 Ga0157369_10123607 3300013105 Bacteria 2745
67 Ga0157369_10138442 3300013105 Bacteria 2576
68 Ga0163162_10051142 3300013306 Plasmid 4145
69 Ga0157372_10221628 3300013307 Bacteria 2192
70 Ga0157375_10153859 3300013308 Bacteria 2437
71 Ga0157375_10207182 3300013308 Unclassified 2117
72 Ga0157380_10118066 3300014326 Bacteria 2242
73 Ga0157379_10029201 3300014968 Unclassified 4904
74 Ga0209758_1004833 3300025297 Bacteria 10872
75 Ga0207642_10048838 3300025899 Bacteria 1899
76 Ga0207699_10023237 3300025906 Bacteria 3372
77 Ga0207684_10107572 3300025910 Bacteria 2386
78 Ga0207671_10028082 3300025914 Bacteria 4206
79 Ga0207649_10060796 3300025920 Bacteria 2375
80 Ga0207694_10030228 3300025924 Bacteria 4136
81 Ga0207664_10036906 3300025929 Bacteria 3779
82 Ga0207644_10044157 3300025931 Plasmid 3165
83 Ga0207686_10053299 3300025934 Bacteria 2528
84 Ga0207669_10022604 3300025937 Bacteria 3344
85 Ga0207704_10114940 3300025938 Bacteria 1828
86 Ga0207691_10144061 3300025940 Bacteria 2098
87 Ga0207711_10037971 3300025941 Plasmid 4094
88 Ga0207712_10287823 3300025961 Bacteria 1343
89 Ga0207703_10057833 3300026035 Bacteria 3163
90 Ga0207639_10190665 3300026041 Bacteria 1751
91 Ga0207678_10012620 3300026067 Bacteria 7425
92 Ga0207702_10044679 3300026078 Bacteria 3724
93 Ga0207702_10296088 3300026078 Bacteria 1534
94 Ga0207648_10103620 3300026089 Bacteria 2495
95 Ga0207675_100084060 3300026118 Bacteria 2986
96 Ga0207683_10011267 3300026121 Bacteria 7623
97 Ga0207683_10125301 3300026121 Bacteria 2308
98 Ga0209179_1004784 3300027512 Bacteria 2071
99 Ga0209588_1001194 3300027671 Bacteria 6713
100 Ga0209588_1001892 3300027671 Bacteria 5595
101 Ga0268264_10000187 3300028381 Bacteria 129270
102 Ga0265334_10049706 3300028573 Bacteria 1612
103 Ga0265338_10010115 3300028800 Bacteria 11139
104 Ga0265330_10001924 3300031235 Bacteria 11547
105 Ga0265330_10010079 3300031235 Bacteria 4467
106 Ga0265330_10040755 3300031235 Bacteria 2061
107 Ga0265330_10065180 3300031235 Bacteria 1581
108 Ga0265332_10039469 3300031238 Bacteria 2045
109 Ga0265325_10001077 3300031241 Bacteria 19636
110 Ga0265325_10009734 3300031241 Bacteria 5602
111 Ga0265325_10068703 3300031241 Unclassified 1783
112 Ga0265340_10001944 3300031247 Bacteria 11812
113 Ga0265340_10005248 3300031247 Bacteria 7189
114 Ga0265340_10008807 3300031247 Bacteria 5439
115 Ga0265340_10010828 3300031247 Bacteria 4869
116 Ga0265339_10001714 3300031249 Bacteria 16152
117 Ga0265339_10003272 3300031249 Bacteria 11346
118 Ga0265339_10009285 3300031249 Bacteria 6195
119 Ga0265339_10017446 3300031249 Bacteria 4254
120 Ga0265331_10037198 3300031250 Bacteria 2385
121 Ga0307509_10111633 3300031507 Bacteria 2736
122 Ga0265313_10001394 3300031595 Bacteria 22666
123 Ga0265313_10007067 3300031595 Bacteria 7759
124 Ga0307508_10000049 3300031616 Bacteria 137413
125 Ga0307508_10000108 3300031616 Bacteria 97443
126 Ga0265314_10015519 3300031711 Bacteria 6045
127 Ga0265342_10000647 3300031712 Bacteria 36562
128 Ga0265342_10168209 3300031712 Bacteria 1208
129 Ga0373934_0006558 3300035086 Bacteria 4318
130 Ga0373934_0018441 3300035086 Bacteria 2670
131 Ga0373923_0004527 3300035111 Bacteria 4622
132 Ga0373923_0008627 3300035111 Bacteria 3647
133 Ga0373923_0053026 3300035111 Unclassified 1705
134 Ga0373936_0016213 3300035113 Bacteria 2865
135 Ga0373936_0029546 3300035113 Unclassified 2158
136 Ga0373953_0000891 3300035117 Bacteria 8357
137 Ga0373953_0003488 3300035117 Plasmid 4906
138 Ga0373953_0022144 3300035117 Bacteria 2393
139 Ga0373954_0002436 3300035118 Bacteria 7797
140 Ga0373954_0002569 3300035118 Bacteria 7629
141 Ga0373954_0015403 3300035118 Bacteria 3418
142 Ga0373954_0051086 3300035118 Bacteria 1941
143 Ga0373956_0002216 3300035119 Bacteria 8013
144 Ga0373956_0002595 3300035119 Bacteria 7325
145 Ga0373956_0016685 3300035119 Bacteria 3086
146 Ga0373956_0034017 3300035119 Bacteria 2244
147 Ga0373957_0000693 3300035120 Bacteria 8710
148 Ga0373957_0001767 3300035120 Bacteria 5958
149 Ga0373957_0021899 3300035120 Bacteria 2273
150 Ga0373960_0028824 3300035121 Bacteria 1535
151 Ga0373943_0001125 3300035170 Bacteria 11944
152 Ga0373943_0018860 3300035170 Bacteria 3171
153 Ga0373946_0015555 3300035171 Bacteria 2887
154 Ga0373946_0017207 3300035171 Bacteria 2763
155 Ga0373955_0000505 3300035172 Bacteria 16570
156 Ga0373955_0001690 3300035172 Bacteria 9435
157 Ga0373955_0010140 3300035172 Bacteria 4440
158 Ga0373955_0029629 3300035172 Plasmid 2848
159 Ga0373955_0034856 3300035172 Bacteria 2662
160 Ga0373962_0032185 3300035242 Bacteria 1442
161 Ga0373924_0007519 3300035410 Bacteria 3937
162 Ga0373924_0038822 3300035410 Bacteria 1943
163 Ga0373924_0078861 3300035410 Unclassified 1398
164 Ga0373935_0001061 3300035692 Bacteria 14985
165 Ga0373935_0023480 3300035692 Bacteria 3790
166 Ga0373935_0024920 3300035692 Bacteria 3685
167 Ga0373935_0120584 3300035692 Unclassified 1752
168 Ga0373927_0000136 3300035695 Bacteria 56656
169 Ga0373927_0005935 3300035695 Bacteria 8362
170 Ga0373927_0009654 3300035695 Bacteria 6470
171 Ga0373927_0012403 3300035695 Bacteria 5673
172 Ga0373927_0130575 3300035695 Bacteria 1641
173 Ga0373933_0001655 3300035724 Bacteria 12971
174 Ga0373933_0002077 3300035724 Bacteria 11497
175 Ga0373933_0003089 3300035724 Bacteria 9278
176 Ga0373947_0000107 3300035725 Bacteria 41080
177 Ga0373947_0018045 3300035725 Bacteria 4060
178 Ga0373947_0085765 3300035725 Bacteria 1956
179 Ga0373937_0007574 3300036401 Bacteria 9400
180 Ga0373937_0013955 3300036401 Bacteria 7083
181 Ga0373937_0065946 3300036401 Bacteria 3333
182 Ga0373937_0096221 3300036401 Bacteria 2746
183 Ga0373937_0107282 3300036401 Bacteria 2596
184 Ga0373937_0126899 3300036401 Unclassified 2381
185 Ga0373925_0001167 3300037068 Bacteria 23303
186 Ga0373925_0025936 3300037068 Bacteria 4285
187 Ga0373925_0038971 3300037068 Bacteria 3515
188 Ga0373925_0212636 3300037068 Bacteria 1541
189 Ga0395898_0177285 3300037466 Bacteria 2037
190 Ga0395905_0033366 3300037471 Bacteria 4836
191 Ga0395901_0218867 3300038443 Bacteria 1991
192 Ga0466967_0017585 3300045976 Bacteria 5683
193 Ga0495592_0001464 3300046454 Bacteria 16415
194 Ga0495592_0004003 3300046454 Bacteria 10691
195 Ga0495592_0036203 3300046454 Bacteria 3717
196 Ga0495603_0000019 3300046455 Bacteria 65316
197 Ga0495603_0001255 3300046455 Bacteria 14802
198 Ga0495603_0024402 3300046455 Bacteria 3657
199 Ga0495629_0000071 3300046459 Bacteria 88879
200 Ga0495629_0000073 3300046459 Bacteria 87538
201 Ga0495629_0003400 3300046459 Bacteria 12036
202 Ga0495629_0004276 3300046459 Bacteria 10708
203 Ga0495638_0004221 3300046460 Bacteria 10936
204 Ga0495638_0011223 3300046460 Bacteria 6182
205 Ga0495641_0006516 3300046461 Bacteria 7546
206 Ga0495651_0001021 3300046462 Bacteria 21657
207 Ga0495651_0018312 3300046462 Bacteria 5423
208 Ga0495651_0031147 3300046462 Bacteria 4160
209 Ga0495651_0117865 3300046462 Unclassified 1954
210 Ga0495653_0003343 3300046463 Bacteria 12890
211 Ga0495653_0005985 3300046463 Bacteria 9956
212 Ga0495653_0029797 3300046463 Unclassified 4352
213 Ga0495653_0045329 3300046463 Bacteria 3409
214 Ga0495653_0088659 3300046463 Bacteria 2269
215 Ga0495580_0000057 3300046472 Bacteria 64650
216 Ga0495582_0000019 3300046473 Bacteria 91143
217 Ga0495582_0000111 3300046473 Bacteria 42751
218 Ga0495582_0044915 3300046473 Unclassified 2433
219 Ga0495639_0000003 3300046475 Bacteria 118479
220 Ga0495639_0000159 3300046475 Bacteria 34872
221 Ga0495639_0031213 3300046475 Unclassified 2371
222 Ga0495639_0067364 3300046475 Bacteria 1649
223 Ga0495662_0000087 3300046476 Bacteria 33327
224 Ga0495662_0004770 3300046476 Bacteria 6795
225 Ga0495662_0012060 3300046476 Plasmid 4224
226 Ga0495664_0001693 3300046477 Bacteria 11732
227 Ga0495664_0024950 3300046477 Bacteria 3477
228 Ga0495664_0025175 3300046477 Bacteria 3464
229 Ga0495664_0042391 3300046477 Bacteria 2695
230 Ga0495664_0048822 3300046477 Bacteria 2513
231 Ga0495594_0000249 3300046499 Bacteria 26130
232 Ga0495594_0007808 3300046499 Bacteria 5501
233 Ga0495608_0000349 3300046511 Bacteria 32301
234 Ga0495608_0006887 3300046511 Bacteria 8052
235 Ga0495608_0032951 3300046511 Bacteria 3503
236 Ga0495608_0134752 3300046511 Bacteria 1579
237 Ga0495610_0028533 3300046512 Bacteria 2950
238 Ga0495618_0002788 3300046514 Bacteria 11086
239 Ga0495618_0034678 3300046514 Bacteria 3166
240 Ga0495618_0068014 3300046514 Bacteria 2265
241 Ga0495618_0154828 3300046514 Bacteria 1463
242 Ga0495628_0004069 3300046516 Bacteria 13009
243 Ga0495628_0005745 3300046516 Bacteria 10869
244 Ga0495628_0227377 3300046516 Bacteria 1399
245 Ga0495630_0000929 3300046517 Bacteria 20449
246 Ga0495630_0012194 3300046517 Bacteria 6235
247 Ga0495630_0051845 3300046517 Unclassified 3071
248 Ga0495631_0036197 3300046518 Bacteria 2205
249 Ga0495637_0058551 3300046520 Bacteria 1588
250 Ga0495666_0094270 3300046526 Unclassified 1412
251 Ga0495666_0111989 3300046526 Bacteria 1281
252 Ga0495652_0010519 3300046529 Bacteria 8383
253 Ga0495652_0017779 3300046529 Bacteria 6345
254 Ga0495652_0027727 3300046529 Bacteria 4989
255 Ga0495654_0002933 3300046530 Bacteria 10683
256 Ga0495665_0000001 3300046531 Bacteria 156121
257 Ga0495665_0000093 3300046531 Bacteria 40936
258 Ga0495640_0001980 3300046533 Bacteria 16352
259 Ga0495640_0005349 3300046533 Bacteria 10210
260 Ga0495640_0023298 3300046533 Bacteria 4514
261 Ga0495640_0035567 3300046533 Bacteria 3525
262 Ga0495640_0046343 3300046533 Bacteria 3012
263 Ga0495640_0075929 3300046533 Bacteria 2243
264 Ga0495587_0001792 3300046536 Bacteria 14342
265 Ga0495587_0141955 3300046536 Bacteria 1370
266 Ga0495645_0005652 3300046543 Bacteria 8611
267 Ga0495645_0018064 3300046543 Bacteria 5060
268 Ga0495622_0000571 3300046557 Bacteria 22078
269 Ga0495622_0013786 3300046557 Bacteria 3748
270 Ga0495667_0001143 3300046559 Bacteria 17300
271 Ga0495667_0212530 3300046559 Bacteria 1236
272 Ga0495634_0000046 3300046642 Bacteria 97947
273 Ga0495634_0004469 3300046642 Bacteria 10972
274 Ga0495634_0010391 3300046642 Bacteria 6820
275 Ga0495634_0060276 3300046642 Bacteria 2525
276 Ga0495634_0067097 3300046642 Bacteria 2374
277 Ga0495634_0115602 3300046642 Bacteria 1722
278 Ga0495634_0170691 3300046642 Bacteria 1367
279 Ga0495635_0000322 3300046663 Bacteria 30913
280 Ga0495635_0000454 3300046663 Bacteria 25920
281 Ga0495635_0000534 3300046663 Bacteria 24127
282 Ga0495635_0001233 3300046663 Bacteria 17126
283 Ga0495635_0015830 3300046663 Bacteria 5267
284 Ga0495588_0002499 3300046674 Bacteria 7878
285 Ga0495657_0003422 3300046675 Bacteria 12954
286 Ga0495657_0020082 3300046675 Bacteria 4807
287 Ga0495599_0001118 3300046678 Bacteria 15101
288 Ga0495599_0007138 3300046678 Bacteria 6764
289 Ga0495599_0104287 3300046678 Bacteria 1766
290 Ga0495599_0118562 3300046678 Bacteria 1645
291 Ga0495623_0002907 3300046679 Bacteria 11279
292 Ga0495623_0018064 3300046679 Unclassified 4555
293 Ga0495646_0006567 3300046680 Bacteria 7381
294 Ga0495646_0008584 3300046680 Bacteria 6489
295 Ga0495646_0020724 3300046680 Bacteria 4158
296 Ga0495647_0000250 3300046681 Bacteria 14710
297 Ga0495647_0005246 3300046681 Bacteria 4243
298 Ga0495658_0000054 3300046683 Bacteria 57414
299 Ga0495658_0000285 3300046683 Bacteria 28523
300 Ga0495658_0118387 3300046683 Bacteria 1599
301 Ga0495658_0134170 3300046683 Bacteria 1510
302 Ga0495613_0020512 3300046689 Bacteria 4927
303 Ga0495613_0028588 3300046689 Bacteria 4147
304 Ga0495613_0035614 3300046689 Bacteria 3693
305 Ga0495613_0132784 3300046689 Bacteria 1782
306 Ga0495613_0173434 3300046689 Bacteria 1530
307 Ga0495624_0015204 3300046690 Bacteria 5205
308 Ga0495600_0041720 3300046809 Bacteria 2991
309 Ga0495660_0058625 3300046810 Bacteria 2073
310 Ga0495581_0000110 3300047315 Bacteria 34511
311 Ga0495581_0000247 3300047315 Bacteria 25790
312 Ga0495604_0001489 3300047317 Bacteria 19311
313 Ga0495604_0017185 3300047317 Bacteria 5787
314 Ga0495604_0131696 3300047317 Unclassified 1796
315 Ga0495674_0000031 3300047319 Bacteria 115867
316 Ga0495674_0000871 3300047319 Bacteria 28857
317 Ga0495674_0012705 3300047319 Bacteria 7934
318 Ga0495674_0032678 3300047319 Bacteria 4717
319 Ga0495674_0047782 3300047319 Bacteria 3792
320 Ga0495674_0051760 3300047319 Bacteria 3619
321 Ga0495674_0074010 3300047319 Bacteria 2935
322 Ga0495674_0167806 3300047319 Bacteria 1833
323 Ga0495676_0013934 3300047321 Bacteria 7208
324 Ga0495676_0145506 3300047321 Bacteria 1693
325 Ga0495676_0157394 3300047321 Unclassified 1610
326 Ga0495680_0005732 3300047322 Bacteria 11632
327 Ga0495680_0006969 3300047322 Bacteria 10427
328 Ga0495680_0014406 3300047322 Bacteria 6848
329 Ga0495680_0028628 3300047322 Bacteria 4567
330 Ga0495675_0006182 3300047444 Bacteria 7325
331 Ga0495675_0070934 3300047444 Bacteria 2199
332 Ga0495684_0001012 3300047471 Bacteria 22906
333 Ga0495684_0010338 3300047471 Bacteria 7218
334 Ga0495684_0160307 3300047471 Bacteria 1678
335 Ga0495686_0084355 3300047472 Bacteria 1936
336 Ga0495593_0000008 3300047673 Bacteria 87310
337 Ga0495593_0000652 3300047673 Bacteria 19971
338 Ga0495593_0005048 3300047673 Bacteria 7810
339 Ga0495593_0009851 3300047673 Bacteria 5545
340 Ga0495593_0032789 3300047673 Plasmid 2830
341 Ga0495602_0010805 3300048088 Bacteria 9461
342 Ga0495602_0031218 3300048088 Bacteria 5040
343 Ga0495602_0089294 3300048088 Bacteria 2563
344 Ga0495602_0198292 3300048088 Bacteria 1533
345 Ga0495614_0021139 3300048089 Plasmid 2813
346 Ga0496100_0054503 3300048903 Bacteria 2608
347 Ga0496101_0084592 3300048904 Unclassified 2349
348 Ga0496102_0017019 3300048905 Bacteria 6363
349 Ga0496102_0068448 3300048905 Plasmid 3257
350 Ga0496103_0028788 3300048906 Plasmid 3374
351 Ga0496104_0011011 3300048907 Bacteria 8092
352 Ga0496104_0080560 3300048907 Bacteria 3104
353 Ga0496105_0004737 3300048908 Bacteria 10266
354 Ga0496105_0011839 3300048908 Bacteria 6909
355 Ga0496106_0008931 3300048909 Bacteria 7407
356 Ga0496106_0047742 3300048909 Bacteria 3223
357 Ga0496107_0023292 3300048910 Plasmid 4378
358 Ga0496107_0170898 3300048910 Unclassified 1613
359 Ga0496108_0105461 3300048911 Bacteria 2406
360 Ga0496109_0121455 3300048912 Bacteria 2434
361 Ga0496110_0002086 3300048913 Bacteria 14892
362 Ga0496110_0025992 3300048913 Bacteria 5005
363 Ga0496110_0163795 3300048913 Bacteria 2016
364 Ga0496111_0018482 3300048914 Bacteria 4830
365 Ga0496111_0055480 3300048914 Bacteria 2865
366 Ga0496111_0121512 3300048914 Bacteria 1929
367 Ga0496112_0011552 3300048915 Bacteria 8069
368 Ga0496112_0046550 3300048915 Bacteria 4254
369 Ga0496112_0060842 3300048915 Bacteria 3721
370 Ga0496112_0115034 3300048915 Bacteria 2661
371 Ga0496113_0003304 3300048916 Bacteria 9626
372 Ga0496113_0025531 3300048916 Bacteria 4212
373 Ga0496113_0033077 3300048916 Bacteria 3762
374 Ga0496114_0038550 3300048917 Bacteria 3954
375 Ga0496115_0002928 3300048918 Bacteria 12305
376 Ga0496115_0153527 3300048918 Bacteria 1902
377 Ga0496116_0005365 3300048919 Bacteria 11931
378 Ga0496121_0002931 3300048924 Bacteria 24972
379 Ga0496121_0145375 3300048924 Unclassified 1753
380 Ga0496122_0042552 3300048925 Bacteria 3572
381 Ga0496123_0122353 3300048926 Bacteria 1460
382 Ga0496124_0135160 3300048927 Bacteria 1953
383 Ga0496125_0000063 3300048928 Bacteria 250260
384 Ga0496125_0000504 3300048928 Bacteria 67902
385 Ga0496125_0002796 3300048928 Bacteria 22060
386 Ga0496125_0021699 3300048928 Bacteria 5978
387 nmdc:mga0yw44_195297_c1 3300050492 Bacteria 1335
388 nmdc:mga0qj67_46267_c1 3300050509 Bacteria 3435
389 nmdc:mga06r32_18187_c1 3300050510 Bacteria 6430
390 nmdc:mga0n895_64691_c1 3300050512 Bacteria 3618
391 nmdc:mga0n895_71625_c1 3300050512 Bacteria 3437
392 nmdc:mga0rr50_25631_c1 3300050513 Bacteria 4102
393 nmdc:mga0rr50_50566_c1 3300050513 Bacteria 3080
394 Ga0495601_0000604 3300053077 Bacteria 19103
395 Ga0495601_0002270 3300053077 Bacteria 10851
396 Ga0495612_0002276 3300053078 Bacteria 7901
397 Ga0495612_0025343 3300053078 Bacteria 2381
398 Ga0500635_0007541 3300053080 Bacteria 2953
399 Ga0495655_0018395 3300053083 Unclassified 1535
400 Ga0495595_0000165 3300053084 Bacteria 26110
401 Ga0495595_0000465 3300053084 Bacteria 15378
402 Ga0495595_0001309 3300053084 Bacteria 9675
403 Ga0495619_0000016 3300053085 Bacteria 231442
404 Ga0495619_0001330 3300053085 Bacteria 16187
405 Ga0495619_0119436 3300053085 Bacteria 1807
406 Ga0495619_0119600 3300053085 Bacteria 1805
407 Ga0500643_001631 3300053087 Bacteria 12536
408 Ga0500647_0008345 3300053091 Bacteria 4494
409 Ga0500566_0001759 3300053094 Bacteria 12737
410 Ga0500566_0008264 3300053094 Bacteria 6155
411 Ga0500641_0002155 3300053096 Bacteria 6979
412 Ga0500554_001023 3300053102 Bacteria 5440
413 Ga0500556_0000002 3300053104 Bacteria 773626
414 Ga0500608_012770 3300053122 Bacteria 3696
415 Ga0500642_0000034 3300053130 Bacteria 110440
416 Ga0500652_000352 3300053131 Bacteria 16556
417 Ga0500658_0026240 3300053134 Bacteria 2243
418 Ga0500568_0000190 3300053139 Bacteria 53492
419 Ga0500586_000336 3300053145 Bacteria 9307
420 Ga0500603_000696 3300053150 Bacteria 8194
421 Ga0500616_0000036 3300053153 Bacteria 390769
422 Ga0500622_0000813 3300053156 Bacteria 26762
423 Ga0500636_0007061 3300053177 Bacteria 6479
424 Ga0500637_0000440 3300053178 Bacteria 15897
425 Ga0500661_000513 3300055283 Bacteria 7233
426 2513640708 2513237094 Bacteria 8789602
427 2876813491 2876808645 Bacteria 8824342
428 2879114741 2879110137 Bacteria 8907982
429 2885417107 2885409591 Bacteria 9235467
430 8019653139 8019648815 Bacteria 10014479
431 Ga0373925_0112400
432 rootH2_10235605
433 Ga0070666_10145976
434 Ga0070680_100033603
435 Ga0070680_100058089
436 Ga0070689_100057735
437 Ga0070691_10051410
438 Ga0070667_100085940
439 Ga0070709_10019266
440 Ga0070714_100018663
441 Ga0070714_100024827
442 Ga0070713_100016223
443 Ga0070713_100026518
444 Ga0070711_100034904
445 Ga0070711_100308148
446 Ga0070663_100072584
447 Ga0070681_10006312
448 Ga0068867_100111419
449 Ga0070707_100292439
450 Ga0070684_100099903
451 Ga0068853_100237067
452 Ga0070672_100226179
453 Ga0070672_100250722
454 Ga0070693_100002862
455 Ga0068855_100133716
456 Ga0070664_100129486
457 Ga0068854_100149039
458 Ga0068856_100180419
459 Ga0068852_100013691
460 Ga0068852_100348416
461 Ga0068858_100119139
462 Ga0068858_100168568
463 Ga0068860_100001170
464 Ga0070717_10301701
465 Ga0070715_10026589
466 Ga0075366_10023294
467 Ga0075370_10016780
468 Ga0075428_100083537
469 Ga0075430_100025160
470 Ga0075431_100025700
471 Ga0075434_100070885
472 Ga0075434_100194560
473 Ga0075434_100315934
474 Ga0068865_100084476
475 Ga0075435_100020700
476 Ga0075435_100103242
477 Ga0099794_10001293
478 Ga0099794_10007247
479 Ga0099794_10007504
480 Ga0099794_10028280
481 Ga0099795_10002049
482 Ga0099795_10014082
483 Ga0105247_10014123
484 Ga0105247_10030717
485 Ga0105247_10084703
486 Ga0105243_10093684
487 Ga0105242_10100229
488 Ga0105242_10227718
489 Ga0105248_10013866
490 Ga0105238_10011135
491 Ga0105238_10059253
492 Ga0105249_10098335
493 Ga0105249_10248451
494 Ga0099796_10004574
495 Ga0099796_10004988
496 Ga0157369_10123607
497 Ga0157369_10138442
498 Ga0163162_10051142
499 Ga0157372_10221628
500 Ga0157375_10153859
501 Ga0157375_10207182
502 Ga0157380_10118066
503 Ga0157379_10029201
504 Ga0209758_1004833
505 Ga0207642_10048838
506 Ga0207699_10023237
507 Ga0207684_10107572
508 Ga0207671_10028082
509 Ga0207649_10060796
510 Ga0207694_10030228
511 Ga0207664_10036906
512 Ga0207644_10044157
513 Ga0207686_10053299
514 Ga0207669_10022604
515 Ga0207704_10114940
516 Ga0207691_10144061
517 Ga0207711_10037971
518 Ga0207712_10287823
519 Ga0207703_10057833
520 Ga0207639_10190665
521 Ga0207678_10012620
522 Ga0207702_10044679
523 Ga0207702_10296088
524 Ga0207648_10103620
525 Ga0207675_100084060
526 Ga0207683_10011267
527 Ga0207683_10125301
528 Ga0209179_1004784
529 Ga0209588_1001194
530 Ga0209588_1001892
531 Ga0268264_10000187
532 Ga0265334_10049706
533 Ga0265338_10010115
534 Ga0265330_10001924
535 Ga0265330_10010079
536 Ga0265330_10040755
537 Ga0265330_10065180
538 Ga0265332_10039469
539 Ga0265325_10001077
540 Ga0265325_10009734
541 Ga0265325_10068703
542 Ga0265340_10001944
543 Ga0265340_10005248
544 Ga0265340_10008807
545 Ga0265340_10010828
546 Ga0265339_10001714
547 Ga0265339_10003272
548 Ga0265339_10009285
549 Ga0265339_10017446
550 Ga0265331_10037198
551 Ga0307509_10111633
552 Ga0265313_10001394
553 Ga0265313_10007067
554 Ga0307508_10000049
555 Ga0307508_10000108
556 Ga0265314_10015519
557 Ga0265342_10000647
558 Ga0265342_10168209
559 Ga0373934_0006558
560 Ga0373934_0018441
561 Ga0373923_0004527
562 Ga0373923_0008627
563 Ga0373923_0053026
564 Ga0373936_0016213
565 Ga0373936_0029546
566 Ga0373953_0000891
567 Ga0373953_0003488
568 Ga0373953_0022144
569 Ga0373954_0002436
570 Ga0373954_0002569
571 Ga0373954_0015403
572 Ga0373954_0051086
573 Ga0373956_0002216
574 Ga0373956_0002595
575 Ga0373956_0016685
576 Ga0373956_0034017
577 Ga0373957_0000693
578 Ga0373957_0001767
579 Ga0373957_0021899
580 Ga0373960_0028824
581 Ga0373943_0001125
582 Ga0373943_0018860
583 Ga0373946_0015555
584 Ga0373946_0017207
585 Ga0373955_0000505
586 Ga0373955_0001690
587 Ga0373955_0010140
588 Ga0373955_0029629
589 Ga0373955_0034856
590 Ga0373962_0032185
591 Ga0373924_0007519
592 Ga0373924_0038822
593 Ga0373924_0078861
594 Ga0373935_0001061
595 Ga0373935_0023480
596 Ga0373935_0024920
597 Ga0373935_0120584
598 Ga0373927_0000136
599 Ga0373927_0005935
600 Ga0373927_0009654
601 Ga0373927_0012403
602 Ga0373927_0130575
603 Ga0373933_0001655
604 Ga0373933_0002077
605 Ga0373933_0003089
606 Ga0373947_0000107
607 Ga0373947_0018045
608 Ga0373947_0085765
609 Ga0373937_0007574
610 Ga0373937_0013955
611 Ga0373937_0065946
612 Ga0373937_0096221
613 Ga0373937_0107282
614 Ga0373937_0126899
615 Ga0373925_0001167
616 Ga0373925_0025936
617 Ga0373925_0038971
618 Ga0373925_0212636
619 Ga0395898_0177285
620 Ga0395905_0033366
621 Ga0395901_0218867
622 Ga0466967_0017585
623 Ga0495592_0001464
624 Ga0495592_0004003
625 Ga0495592_0036203
626 Ga0495603_0000019
627 Ga0495603_0001255
628 Ga0495603_0024402
629 Ga0495629_0000071
630 Ga0495629_0000073
631 Ga0495629_0003400
632 Ga0495629_0004276
633 Ga0495638_0004221
634 Ga0495638_0011223
635 Ga0495641_0006516
636 Ga0495651_0001021
637 Ga0495651_0018312
638 Ga0495651_0031147
639 Ga0495651_0117865
640 Ga0495653_0003343
641 Ga0495653_0005985
642 Ga0495653_0029797
643 Ga0495653_0045329
644 Ga0495653_0088659
645 Ga0495580_0000057
646 Ga0495582_0000019
647 Ga0495582_0000111
648 Ga0495582_0044915
649 Ga0495639_0000003
650 Ga0495639_0000159
651 Ga0495639_0031213
652 Ga0495639_0067364
653 Ga0495662_0000087
654 Ga0495662_0004770
655 Ga0495662_0012060
656 Ga0495664_0001693
657 Ga0495664_0024950
658 Ga0495664_0025175
659 Ga0495664_0042391
660 Ga0495664_0048822
661 Ga0495594_0000249
662 Ga0495594_0007808
663 Ga0495608_0000349
664 Ga0495608_0006887
665 Ga0495608_0032951
666 Ga0495608_0134752
667 Ga0495610_0028533
668 Ga0495618_0002788
669 Ga0495618_0034678
670 Ga0495618_0068014
671 Ga0495618_0154828
672 Ga0495628_0004069
673 Ga0495628_0005745
674 Ga0495628_0227377
675 Ga0495630_0000929
676 Ga0495630_0012194
677 Ga0495630_0051845
678 Ga0495631_0036197
679 Ga0495637_0058551
680 Ga0495666_0094270
681 Ga0495666_0111989
682 Ga0495652_0010519
683 Ga0495652_0017779
684 Ga0495652_0027727
685 Ga0495654_0002933
686 Ga0495665_0000001
687 Ga0495665_0000093
688 Ga0495640_0001980
689 Ga0495640_0005349
690 Ga0495640_0023298
691 Ga0495640_0035567
692 Ga0495640_0046343
693 Ga0495640_0075929
694 Ga0495587_0001792
695 Ga0495587_0141955
696 Ga0495645_0005652
697 Ga0495645_0018064
698 Ga0495622_0000571
699 Ga0495622_0013786
700 Ga0495667_0001143
701 Ga0495667_0212530
702 Ga0495634_0000046
703 Ga0495634_0004469
704 Ga0495634_0010391
705 Ga0495634_0060276
706 Ga0495634_0067097
707 Ga0495634_0115602
708 Ga0495634_0170691
709 Ga0495635_0000322
710 Ga0495635_0000454
711 Ga0495635_0000534
712 Ga0495635_0001233
713 Ga0495635_0015830
714 Ga0495588_0002499
715 Ga0495657_0003422
716 Ga0495657_0020082
717 Ga0495599_0001118
718 Ga0495599_0007138
719 Ga0495599_0104287
720 Ga0495599_0118562
721 Ga0495623_0002907
722 Ga0495623_0018064
723 Ga0495646_0006567
724 Ga0495646_0008584
725 Ga0495646_0020724
726 Ga0495647_0000250
727 Ga0495647_0005246
728 Ga0495658_0000054
729 Ga0495658_0000285
730 Ga0495658_0118387
731 Ga0495658_0134170
732 Ga0495613_0020512
733 Ga0495613_0028588
734 Ga0495613_0035614
735 Ga0495613_0132784
736 Ga0495613_0173434
737 Ga0495624_0015204
738 Ga0495600_0041720
739 Ga0495660_0058625
740 Ga0495581_0000110
741 Ga0495581_0000247
742 Ga0495604_0001489
743 Ga0495604_0017185
744 Ga0495604_0131696
745 Ga0495674_0000031
746 Ga0495674_0000871
747 Ga0495674_0012705
748 Ga0495674_0032678
749 Ga0495674_0047782
750 Ga0495674_0051760
751 Ga0495674_0074010
752 Ga0495674_0167806
753 Ga0495676_0013934
754 Ga0495676_0145506
755 Ga0495676_0157394
756 Ga0495680_0005732
757 Ga0495680_0006969
758 Ga0495680_0014406
759 Ga0495680_0028628
760 Ga0495675_0006182
761 Ga0495675_0070934
762 Ga0495684_0001012
763 Ga0495684_0010338
764 Ga0495684_0160307
765 Ga0495686_0084355
766 Ga0495593_0000008
767 Ga0495593_0000652
768 Ga0495593_0005048
769 Ga0495593_0009851
770 Ga0495593_0032789
771 Ga0495602_0010805
772 Ga0495602_0031218
773 Ga0495602_0089294
774 Ga0495602_0198292
775 Ga0495614_0021139
776 Ga0496100_0054503
777 Ga0496101_0084592
778 Ga0496102_0017019
779 Ga0496102_0068448
780 Ga0496103_0028788
781 Ga0496104_0011011
782 Ga0496104_0080560
783 Ga0496105_0004737
784 Ga0496105_0011839
785 Ga0496106_0008931
786 Ga0496106_0047742
787 Ga0496107_0023292
788 Ga0496107_0170898
789 Ga0496108_0105461
790 Ga0496109_0121455
791 Ga0496110_0002086
792 Ga0496110_0025992
793 Ga0496110_0163795
794 Ga0496111_0018482
795 Ga0496111_0055480
796 Ga0496111_0121512
797 Ga0496112_0011552
798 Ga0496112_0046550
799 Ga0496112_0060842
800 Ga0496112_0115034
801 Ga0496113_0003304
802 Ga0496113_0025531
803 Ga0496113_0033077
804 Ga0496114_0038550
805 Ga0496115_0002928
806 Ga0496115_0153527
807 Ga0496116_0005365
808 Ga0496121_0002931
809 Ga0496121_0145375
810 Ga0496122_0042552
811 Ga0496123_0122353
812 Ga0496124_0135160
813 Ga0496125_0000063
814 Ga0496125_0000504
815 Ga0496125_0002796
816 Ga0496125_0021699
817 nmdc:mga0yw44_195297_c1
818 nmdc:mga0qj67_46267_c1
819 nmdc:mga06r32_18187_c1
820 nmdc:mga0n895_64691_c1
821 nmdc:mga0n895_71625_c1
822 nmdc:mga0rr50_25631_c1
823 nmdc:mga0rr50_50566_c1
824 Ga0495601_0000604
825 Ga0495601_0002270
826 Ga0495612_0002276
827 Ga0495612_0025343
828 Ga0500635_0007541
829 Ga0495655_0018395
830 Ga0495595_0000165
831 Ga0495595_0000465
832 Ga0495595_0001309
833 Ga0495619_0000016
834 Ga0495619_0001330
835 Ga0495619_0119436
836 Ga0495619_0119600
837 Ga0500643_001631
838 Ga0500647_0008345
839 Ga0500566_0001759
840 Ga0500566_0008264
841 Ga0500641_0002155
842 Ga0500554_001023
843 Ga0500556_0000002
844 Ga0500608_012770
845 Ga0500642_0000034
846 Ga0500652_000352
847 Ga0500658_0026240
848 Ga0500568_0000190
849 Ga0500586_000336
850 Ga0500603_000696
851 Ga0500616_0000036
852 Ga0500622_0000813
853 Ga0500636_0007061
854 Ga0500637_0000440
855 Ga0500661_000513
856 2513640708
857 2876813491
858 2879114741
859 2885417107
860 8019653139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

388

443

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9488 300 359
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9455 300 357
4wul-assembly1.cif.gz_B crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9452 300 357
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.945 301 357
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9412 301 357
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9301 301 356 1.10.10.10
af_Q11028_1077_1158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9261 300 357 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 300 359 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9163 302 359 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9085 299 357 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A528FI50-F1-model_v4 LuxR family transcriptional regulator 0.882 5 212
AF-A0A329AMK5-F1-model_v4 deleted 0.8031 2 288
AF-A0A378ZY30-F1-model_v4 GAF domain-containing protein 0.7889 1 242
AF-A0A4P1ARH8-F1-model_v4 deleted 0.7704 1 212
AF-A0A528FI50-F1-model_v4 LuxR family transcriptional regulator 0.7634 5 212

Map