F442183

General Info

Members Datasets Scaffolds Average Seq Length
430 234 860 435

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0008366|Ga0395900_0008366_4724_6163
Length 479
Sequence MAYFYLRVNFVKFFNGFWGKILLFELFNHKVKLNNIYFIMKSNIQPAEGKLGILIPGLGAVATTLIAGVEAVKKGISQPFGSLTQMGHIRLGKRTENRFPKIKDFVPLADLNDIAFGGWDVYSDNVYQAASNAKVLDQGLLYAIKPELEKLVPMKAAFDKNYAKNLDGTHVKQGTRRELADQVIEDIQNFKEKNGCNRIVLVWCGSTEIYYEASEIHQSLAAFEEALDNDDKRISPSMIYAYAALKLGFPFANGAPNLTVDIPALIELSKLTNTPIAGKDFKTGQTLMKTILAPGLAARALGIKGWFSTNILGNRDGLVLDDPDNFKTKEVSKLGVLEDILRPEDNPELYGDIFHKIRINYYPPHGDNKESWDNIDIFGWLGYPMQIKINFLCRDSILAAPIALDLALFIDLAKRAEMSGIQEWLSFYLKSPQTLPGLRPENDIFKQLMKLQNTLRHLMGEDLITHLGLDYYQDLVEAL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
121 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
127 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
186 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
187 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
188 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
189 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
194 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
195 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
196 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
210 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
211 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
212 2738541278 Niastella sp. CF465 Isolate Unclassified
213 2738541302 Pedobacter sp. CF074 Isolate Unclassified
214 2738543023 Pedobacter sp. OK628 Isolate Unclassified
215 2739367651 Pedobacter sp. OK291 Isolate Unclassified
216 2818991437 Pedobacter terrae 518 Isolate Unclassified
217 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
218 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
219 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
220 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
221 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
222 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
223 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
224 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
225 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
226 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
227 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
228 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
229 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
230 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
231 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
232 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
233 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
234 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 1.63
Isolates 5.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.63
Nodule 0
Rhizoplane 0.7
Rhizosphere 77.67
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0008366 3300037418 Bacteria 10647
2 JGI24737J22298_10000110 3300001990 Bacteria 24863
3 JGI24737J22298_10003483 3300001990 Bacteria 5550
4 JGI24735J21928_10000004 3300002067 Bacteria 381713
5 JGI25162J39368_1000017 3300002737 Bacteria 281385
6 JGI25162J39368_1000342 3300002737 Bacteria 40311
7 JGI25152J39213_1000067 3300002773 Bacteria 68480
8 JGI25150J39212_1000001 3300002774 Bacteria 1318726
9 JGI25151J46595_10000005 3300003187 Bacteria 431598
10 JGI25165J46597_1001336 3300003214 Bacteria 13864
11 JGI25153J46596_10000040 3300003215 Bacteria 165523
12 rootH1_10018005 3300003316 Bacteria 14041
13 rootH2_10001334 3300003320 Bacteria 238709
14 rootH2_10028071 3300003320 Bacteria 16976
15 rootH2_10029493 3300003320 Bacteria 12960
16 rootH2_10047367 3300003320 Bacteria 14620
17 rootH2_10076352 3300003320 Bacteria 6882
18 rootL2_10091047 3300003322 Bacteria 2325
19 rootH1_10002464 3300003323 Bacteria 35419
20 rootH1_10006939 3300003323 Bacteria 26814
21 Ga0055536_1000049 3300003781 Bacteria 113328
22 Ga0055530_10001497 3300003791 Bacteria 16966
23 Ga0058863_11920111 3300004799 Bacteria 2076
24 Ga0058862_12251515 3300004803 Bacteria 1713
25 Ga0065165_1006758 3300005262 Bacteria 5874
26 Ga0065714_10003376 3300005288 Bacteria 7316
27 Ga0065714_10064453 3300005288 Bacteria 74728
28 Ga0065714_10064880 3300005288 Bacteria 16161
29 Ga0065714_10068070 3300005288 Bacteria 4991
30 Ga0065714_10086150 3300005288 Bacteria 2112
31 Ga0070658_10000019 3300005327 Bacteria 194742
32 Ga0070658_10094675 3300005327 Bacteria 2464
33 Ga0070658_10172543 3300005327 Bacteria 1817
34 Ga0070676_10000038 3300005328 Bacteria 39143
35 Ga0070676_10011160 3300005328 Bacteria 4881
36 Ga0070683_100001459 3300005329 Bacteria 18185
37 Ga0070683_100033104 3300005329 Bacteria 4711
38 Ga0070666_10028643 3300005335 Bacteria 3656
39 Ga0068868_100031929 3300005338 Bacteria 4048
40 Ga0068868_100076913 3300005338 Bacteria 2669
41 Ga0068868_100102624 3300005338 Bacteria 2316
42 Ga0070660_100095447 3300005339 Bacteria 2350
43 Ga0070691_10010073 3300005341 Bacteria 4307
44 Ga0070673_100011398 3300005364 Bacteria 6065
45 Ga0070659_100068355 3300005366 Bacteria 2818
46 Ga0070659_100071202 3300005366 Bacteria 2764
47 Ga0070663_100003783 3300005455 Bacteria 8795
48 Ga0070662_100000464 3300005457 Bacteria 24077
49 Ga0070681_10034844 3300005458 Bacteria 5055
50 Ga0068867_100000255 3300005459 Bacteria 35036
51 Ga0068867_100026605 3300005459 Bacteria 4154
52 Ga0070685_10014905 3300005466 Bacteria 4124
53 Ga0070684_100234458 3300005535 Bacteria 1676
54 Ga0068853_100001443 3300005539 Bacteria 17201
55 Ga0068853_100032860 3300005539 Bacteria 4398
56 Ga0070693_100021034 3300005547 Bacteria 3451
57 Ga0070665_100000003 3300005548 Bacteria 811857
58 Ga0070665_100000074 3300005548 Bacteria 192944
59 Ga0068855_100000073 3300005563 Bacteria 121126
60 Ga0068855_100000086 3300005563 Bacteria 111462
61 Ga0068855_100005249 3300005563 Bacteria 15806
62 Ga0068855_100032255 3300005563 Bacteria 6255
63 Ga0068855_100131442 3300005563 Bacteria 2858
64 Ga0068857_100003719 3300005577 Bacteria 12802
65 Ga0068857_100013211 3300005577 Bacteria 7195
66 Ga0068854_100020154 3300005578 Bacteria 4506
67 Ga0068856_100001137 3300005614 Bacteria 27953
68 Ga0068856_100026426 3300005614 Bacteria 5661
69 Ga0068856_100027517 3300005614 Bacteria 5547
70 Ga0068856_100074592 3300005614 Bacteria 3359
71 Ga0068856_100105588 3300005614 Bacteria 2810
72 Ga0068852_100000937 3300005616 Bacteria 19263
73 Ga0068852_100001089 3300005616 Bacteria 17919
74 Ga0068852_100065146 3300005616 Bacteria 3178
75 Ga0068852_100093285 3300005616 Bacteria 2698
76 Ga0068851_10005158 3300005834 Bacteria 5928
77 Ga0068860_100000110 3300005843 Bacteria 131175
78 Ga0068860_100129222 3300005843 Bacteria 2423
79 Ga0075366_10000577 3300006195 Bacteria 17211
80 Ga0075366_10003825 3300006195 Bacteria 8013
81 Ga0075366_10004460 3300006195 Bacteria 7513
82 Ga0097621_100000241 3300006237 Bacteria 36577
83 Ga0097621_100020810 3300006237 Bacteria 5062
84 Ga0068871_100000499 3300006358 Bacteria 26769
85 Ga0068871_100006779 3300006358 Bacteria 8138
86 Ga0068865_100000022 3300006881 Bacteria 102976
87 Ga0105244_10013507 3300009036 Bacteria 4770
88 Ga0105240_10000010 3300009093 Bacteria 537830
89 Ga0105240_10000253 3300009093 Bacteria 106101
90 Ga0105240_10000418 3300009093 Bacteria 78645
91 Ga0105240_10000448 3300009093 Bacteria 75837
92 Ga0105240_10018127 3300009093 Bacteria 9465
93 Ga0105240_10020548 3300009093 Bacteria 8802
94 Ga0105240_10057496 3300009093 Bacteria 4859
95 Ga0105240_10156171 3300009093 Bacteria 2713
96 Ga0105240_10227633 3300009093 Bacteria 2169
97 Ga0105241_10001498 3300009174 Bacteria 17918
98 Ga0105241_10002955 3300009174 Bacteria 12694
99 Ga0105241_10003853 3300009174 Bacteria 11119
100 Ga0105241_10009914 3300009174 Bacteria 7001
101 Ga0105237_10000065 3300009545 Bacteria 139423
102 Ga0105237_10000137 3300009545 Bacteria 102639
103 Ga0105237_10001288 3300009545 Bacteria 33371
104 Ga0105237_10001855 3300009545 Bacteria 27072
105 Ga0105237_10002699 3300009545 Bacteria 21706
106 Ga0105237_10003021 3300009545 Bacteria 20301
107 Ga0105237_10003749 3300009545 Bacteria 17908
108 Ga0105237_10007138 3300009545 Bacteria 12276
109 Ga0105237_10103258 3300009545 Bacteria 2842
110 Ga0105237_10103812 3300009545 Bacteria 2834
111 Ga0105238_10003185 3300009551 Bacteria 16373
112 Ga0105238_10016846 3300009551 Bacteria 7412
113 Ga0105238_10188094 3300009551 Bacteria 2041
114 Ga0105239_10000005 3300010375 Bacteria 496066
115 Ga0105239_10000042 3300010375 Bacteria 199662
116 Ga0105239_10000079 3300010375 Bacteria 135513
117 Ga0105239_10001594 3300010375 Bacteria 29975
118 Ga0105239_10002289 3300010375 Bacteria 24463
119 Ga0105239_10007964 3300010375 Bacteria 12104
120 Ga0105239_10008882 3300010375 Bacteria 11375
121 Ga0105239_10015875 3300010375 Bacteria 8336
122 Ga0105239_10019439 3300010375 Bacteria 7499
123 Ga0105239_10032740 3300010375 Bacteria 5712
124 Ga0105239_10044904 3300010375 Bacteria 4843
125 Ga0105239_10053336 3300010375 Bacteria 4436
126 Ga0105239_10056437 3300010375 Bacteria 4308
127 Ga0105239_10098630 3300010375 Bacteria 3230
128 Ga0105239_10101063 3300010375 Bacteria 3190
129 Ga0157373_10000223 3300013100 Bacteria 46516
130 Ga0157373_10018449 3300013100 Bacteria 5079
131 Ga0157371_10000051 3300013102 Bacteria 180272
132 Ga0157371_10000622 3300013102 Bacteria 42231
133 Ga0157371_10001433 3300013102 Bacteria 24766
134 Ga0157371_10032101 3300013102 Bacteria 3780
135 Ga0157370_10000695 3300013104 Bacteria 42043
136 Ga0157370_10004105 3300013104 Bacteria 16885
137 Ga0157370_10031278 3300013104 Bacteria 5208
138 Ga0157370_10045526 3300013104 Bacteria 4209
139 Ga0157370_10047374 3300013104 Bacteria 4121
140 Ga0157370_10152094 3300013104 Bacteria 2153
141 Ga0157369_10000033 3300013105 Bacteria 201124
142 Ga0157369_10000165 3300013105 Bacteria 93924
143 Ga0157369_10036312 3300013105 Bacteria 5400
144 Ga0157369_10059614 3300013105 Bacteria 4115
145 Ga0157369_10062176 3300013105 Bacteria 4024
146 Ga0157374_10000003 3300013296 Bacteria 854471
147 Ga0157374_10000130 3300013296 Bacteria 68718
148 Ga0157374_10001204 3300013296 Bacteria 22127
149 Ga0157374_10003721 3300013296 Bacteria 12819
150 Ga0157378_10011920 3300013297 Bacteria 7613
151 Ga0157378_10023601 3300013297 Bacteria 5410
152 Ga0163162_10000064 3300013306 Bacteria 103542
153 Ga0163162_10000453 3300013306 Bacteria 37951
154 Ga0163162_10014886 3300013306 Bacteria 7596
155 Ga0163162_10028857 3300013306 Bacteria 5492
156 Ga0157372_10000021 3300013307 Bacteria 207801
157 Ga0157372_10001064 3300013307 Bacteria 30014
158 Ga0157372_10001219 3300013307 Bacteria 27839
159 Ga0157372_10005160 3300013307 Bacteria 13886
160 Ga0157372_10029773 3300013307 Bacteria 5966
161 Ga0157372_10103085 3300013307 Bacteria 3260
162 Ga0157372_10264678 3300013307 Bacteria 1997
163 Ga0157372_10313843 3300013307 Bacteria 1825
164 Ga0157375_10007870 3300013308 Bacteria 9328
165 Ga0157375_10016311 3300013308 Bacteria 6668
166 Ga0163163_10138888 3300014325 Bacteria 2472
167 Ga0157377_10112178 3300014745 Bacteria 1640
168 Ga0157376_10034937 3300014969 Bacteria 4062
169 Ga0157376_10168474 3300014969 Bacteria 1992
170 Ga0182006_1000168 3300015261 Bacteria 69340
171 Ga0182006_1000353 3300015261 Bacteria 38632
172 Ga0182007_10000015 3300015262 Bacteria 207893
173 Ga0183373_1005 3300015682 Bacteria 351562
174 Ga0163161_10000178 3300017792 Bacteria 58130
175 Ga0163161_10000215 3300017792 Bacteria 52730
176 Ga0163161_10000331 3300017792 Bacteria 40390
177 Ga0206356_10180947 3300020070 Bacteria 1736
178 Ga0206352_10142486 3300020078 Bacteria 2173
179 Ga0213872_10013848 3300021361 Bacteria 3770
180 Ga0213876_10000546 3300021384 Bacteria 28155
181 Ga0224712_10053999 3300022467 Bacteria 1575
182 Ga0209436_102713 3300025208 Bacteria 5115
183 Ga0207427_100208 3300025231 Bacteria 53345
184 Ga0209437_100024 3300025233 Bacteria 592878
185 Ga0209437_100052 3300025233 Bacteria 380548
186 Ga0207425_1000002 3300025245 Bacteria 1362590
187 Ga0209026_1000305 3300025250 Bacteria 53618
188 Ga0209026_1002307 3300025250 Bacteria 7270
189 Ga0209129_1000002 3300025258 Bacteria 1359086
190 Ga0209233_1000067 3300025261 Bacteria 380554
191 Ga0209233_1002811 3300025261 Bacteria 6250
192 Ga0209455_1002548 3300025272 Bacteria 6968
193 Ga0209676_1000001 3300025292 Bacteria 1852142
194 Ga0209676_1003582 3300025292 Bacteria 9371
195 Ga0209025_1000004 3300025294 Bacteria 1361782
196 Ga0209758_1000006 3300025297 Bacteria 1359562
197 Ga0209050_1000258 3300025298 Bacteria 113741
198 Ga0207426_1015505 3300025302 Bacteria 2761
199 Ga0207656_10018679 3300025321 Bacteria 2732
200 Ga0207647_10000093 3300025904 Bacteria 68094
201 Ga0207647_10000494 3300025904 Bacteria 31578
202 Ga0207647_10049626 3300025904 Bacteria 2602
203 Ga0207645_10000585 3300025907 Bacteria 30250
204 Ga0207645_10027220 3300025907 Bacteria 3693
205 Ga0207705_10000069 3300025909 Bacteria 133094
206 Ga0207654_10002822 3300025911 Bacteria 8815
207 Ga0207654_10006865 3300025911 Bacteria 5729
208 Ga0207654_10009641 3300025911 Bacteria 4910
209 Ga0207695_10000019 3300025913 Bacteria 732137
210 Ga0207695_10000039 3300025913 Bacteria 454801
211 Ga0207695_10000073 3300025913 Bacteria 312565
212 Ga0207695_10000990 3300025913 Bacteria 50315
213 Ga0207695_10002972 3300025913 Bacteria 24457
214 Ga0207695_10021056 3300025913 Bacteria 7449
215 Ga0207695_10036314 3300025913 Bacteria 5330
216 Ga0207695_10052864 3300025913 Bacteria 4252
217 Ga0207695_10103369 3300025913 Bacteria 2840
218 Ga0207695_10181431 3300025913 Bacteria 2026
219 Ga0207671_10000424 3300025914 Bacteria 58429
220 Ga0207671_10000657 3300025914 Bacteria 45082
221 Ga0207671_10001714 3300025914 Bacteria 24751
222 Ga0207671_10003844 3300025914 Bacteria 14692
223 Ga0207671_10004413 3300025914 Bacteria 13479
224 Ga0207671_10004886 3300025914 Bacteria 12600
225 Ga0207671_10006359 3300025914 Bacteria 10534
226 Ga0207671_10029190 3300025914 Bacteria 4119
227 Ga0207671_10029206 3300025914 Bacteria 4118
228 Ga0207652_10012750 3300025921 Bacteria 6795
229 Ga0207694_10002351 3300025924 Bacteria 15472
230 Ga0207694_10006989 3300025924 Bacteria 8566
231 Ga0207694_10084022 3300025924 Bacteria 2504
232 Ga0207706_10000243 3300025933 Bacteria 59842
233 Ga0207686_10017457 3300025934 Bacteria 4045
234 Ga0207709_10000010 3300025935 Bacteria 601305
235 Ga0207704_10000011 3300025938 Bacteria 180140
236 Ga0207665_10061359 3300025939 Bacteria 2548
237 Ga0207661_10022438 3300025944 Bacteria 4755
238 Ga0207661_10027170 3300025944 Bacteria 4369
239 Ga0207667_10000009 3300025949 Bacteria 603135
240 Ga0207667_10000229 3300025949 Bacteria 78821
241 Ga0207667_10001845 3300025949 Bacteria 26612
242 Ga0207667_10006679 3300025949 Bacteria 13945
243 Ga0207667_10063906 3300025949 Bacteria 3845
244 Ga0207651_10023776 3300025960 Bacteria 3777
245 Ga0207640_10024141 3300025981 Bacteria 3664
246 Ga0207677_10020815 3300026023 Bacteria 3993
247 Ga0207639_10008167 3300026041 Bacteria 7159
248 Ga0207639_10011872 3300026041 Bacteria 6058
249 Ga0207702_10004829 3300026078 Bacteria 11875
250 Ga0207702_10130296 3300026078 Bacteria 2263
251 Ga0207648_10001014 3300026089 Bacteria 31612
252 Ga0207648_10046823 3300026089 Bacteria 3791
253 Ga0207674_10000801 3300026116 Bacteria 40866
254 Ga0207674_10036564 3300026116 Bacteria 5114
255 Ga0207683_10008234 3300026121 Bacteria 8919
256 Ga0207698_10001995 3300026142 Bacteria 12019
257 Ga0207698_10215368 3300026142 Bacteria 1731
258 Ga0268266_10000010 3300028379 Bacteria 1030233
259 Ga0268266_10000078 3300028379 Bacteria 213632
260 Ga0268264_10000052 3300028381 Bacteria 321218
261 Ga0268264_10022012 3300028381 Bacteria 5201
262 Ga0268264_10088667 3300028381 Bacteria 2663
263 Ga0268264_10281261 3300028381 Bacteria 1559
264 Ga0307517_10004416 3300028786 Bacteria 21602
265 Ga0307515_10000076 3300028794 Bacteria 228736
266 Ga0307515_10001207 3300028794 Bacteria 59017
267 Ga0307515_10001331 3300028794 Bacteria 55969
268 Ga0307515_10001361 3300028794 Bacteria 55260
269 Ga0265338_10029950 3300028800 Bacteria 5381
270 Ga0307511_10000367 3300030521 Bacteria 48024
271 Ga0316176_1031671 3300030732 Bacteria 50195
272 Ga0316183_1007327 3300030742 Bacteria 68568
273 Ga0265327_10015699 3300031251 Bacteria 4867
274 Ga0307513_10090619 3300031456 Bacteria 3118
275 Ga0265313_10023552 3300031595 Bacteria 3315
276 Ga0307508_10001839 3300031616 Bacteria 23472
277 Ga0307514_10055758 3300031649 Bacteria 3036
278 Ga0316579_10020254 3300031691 Bacteria 2948
279 Ga0307516_10001688 3300031730 Bacteria 30411
280 Ga0307405_10000038 3300031731 Bacteria 86305
281 Ga0307407_10000005 3300031903 Bacteria 233125
282 Ga0307412_10067671 3300031911 Bacteria 2426
283 Ga0307409_100051659 3300031995 Bacteria 3147
284 Ga0307409_100077071 3300031995 Bacteria 2676
285 Ga0307416_100000001 3300032002 Bacteria 515017
286 Ga0307507_10000034 3300033179 Bacteria 188697
287 Ga0307510_10001439 3300033180 Bacteria 26186
288 Ga0307510_10027516 3300033180 Bacteria 6514
289 Ga0373927_0070933 3300035695 Bacteria 2255
290 Ga0395899_0000121 3300037312 Bacteria 125324
291 Ga0395899_0000461 3300037312 Bacteria 46076
292 Ga0395899_0001870 3300037312 Bacteria 17378
293 Ga0395899_0124661 3300037312 Bacteria 1843
294 Ga0395900_0000014 3300037418 Bacteria 386513
295 Ga0395900_0000358 3300037418 Bacteria 66350
296 Ga0395900_0084893 3300037418 Bacteria 3254
297 Ga0395898_0070220 3300037466 Bacteria 3387
298 Ga0395905_0000037 3300037471 Bacteria 261808
299 Ga0395905_0001101 3300037471 Bacteria 33997
300 Ga0395905_0005047 3300037471 Bacteria 13596
301 Ga0395901_0000117 3300038443 Bacteria 105071
302 Ga0395901_0075658 3300038443 Bacteria 3512
303 Ga0436365_1030238 3300039437 Bacteria 41914
304 Ga0436361_1054104 3300039447 Bacteria 8064
305 Ga0439465_0018172 3300041413 Bacteria 2197
306 Ga0439448_0016317 3300042005 Bacteria 2259
307 Ga0439455_0023206 3300042012 Bacteria 1492
308 Ga0439457_012683 3300042014 Bacteria 1898
309 Ga0451577_0048588 3300042876 Bacteria 3790
310 Ga0466972_0000015 3300044658 Bacteria 210687
311 Ga0466972_0000950 3300044658 Bacteria 13952
312 Ga0466972_0068407 3300044658 Bacteria 1696
313 Ga0466961_0100195 3300044693 Unclassified 1825
314 Ga0466964_0018977 3300044706 Bacteria 2642
315 Ga0466971_0027990 3300044719 Unclassified 2523
316 Ga0466957_0000015 3300044842 Bacteria 68333
317 Ga0466957_0012253 3300044842 Bacteria 4963
318 Ga0466957_0037334 3300044842 Unclassified 2925
319 Ga0466959_0014760 3300045049 Bacteria 5686
320 Ga0466958_0018279 3300045836 Bacteria 4067
321 Ga0495638_0068247 3300046460 Bacteria 2181
322 Ga0495650_0000087 3300046471 Bacteria 234870
323 Ga0495585_0000448 3300046492 Bacteria 39402
324 Ga0495585_0023273 3300046492 Bacteria 3555
325 Ga0495606_0000052 3300046507 Bacteria 201529
326 Ga0495606_0005009 3300046507 Bacteria 12914
327 Ga0495606_0005602 3300046507 Bacteria 11940
328 Ga0495606_0047678 3300046507 Bacteria 2823
329 Ga0495610_0000151 3300046512 Bacteria 76854
330 Ga0495610_0000334 3300046512 Bacteria 49810
331 Ga0495610_0006882 3300046512 Bacteria 7703
332 Ga0495616_0047442 3300046513 Bacteria 2163
333 Ga0495631_0013832 3300046518 Bacteria 3908
334 Ga0495632_0045362 3300046519 Bacteria 2190
335 Ga0495644_0003932 3300046523 Bacteria 5848
336 Ga0495648_0001850 3300046524 Bacteria 20297
337 Ga0495648_0005656 3300046524 Bacteria 10344
338 Ga0495609_0016585 3300046538 Bacteria 3431
339 Ga0495622_0023249 3300046557 Bacteria 2890
340 Ga0495633_0000177 3300046558 Bacteria 82953
341 Ga0495668_0000207 3300046616 Bacteria 85136
342 Ga0495668_0011638 3300046616 Bacteria 5261
343 Ga0495611_0000761 3300046648 Bacteria 18065
344 Ga0495625_0000008 3300046660 Bacteria 536165
345 Ga0495625_0005804 3300046660 Bacteria 11149
346 Ga0495625_0014987 3300046660 Bacteria 6159
347 Ga0495625_0040978 3300046660 Bacteria 3373
348 Ga0495661_0000579 3300046665 Bacteria 37896
349 Ga0495649_0000018 3300046694 Bacteria 220586
350 Ga0495649_0055515 3300046694 Bacteria 2140
351 Ga0495687_000039 3300047443 Bacteria 245077
352 Ga0495687_001584 3300047443 Bacteria 20599
353 Ga0495687_001870 3300047443 Bacteria 18236
354 Ga0495686_0000046 3300047472 Bacteria 281963
355 Ga0495686_0000052 3300047472 Bacteria 262622
356 Ga0495686_0006150 3300047472 Bacteria 9282
357 Ga0495686_0032424 3300047472 Bacteria 3382
358 Ga0495614_0014276 3300048089 Bacteria 3480
359 Ga0496115_0018532 3300048918 Bacteria 5347
360 Ga0496115_0085092 3300048918 Bacteria 2579
361 Ga0496116_0021166 3300048919 Bacteria 4911
362 Ga0496117_0013605 3300048920 Bacteria 7087
363 Ga0496118_0069734 3300048921 Bacteria 2544
364 Ga0496122_0008079 3300048925 Bacteria 11471
365 Ga0496123_0042756 3300048926 Bacteria 3122
366 Ga0501306_006170 3300049127 Bacteria 1398
367 Ga0501319_000472 3300049535 Bacteria 1928
368 Ga0501202_008465 3300049652 Bacteria 1875
369 Ga0501202_008878 3300049652 Bacteria 1839
370 Ga0501217_015247 3300049661 Bacteria 1747
371 Ga0501242_000474 3300049674 Bacteria 3526
372 Ga0501250_000127 3300049680 Bacteria 4152
373 Ga0501257_003846 3300049686 Bacteria 3248
374 Ga0501259_001527 3300049688 Bacteria 3855
375 Ga0501225_0002275 3300049705 Bacteria 5938
376 Ga0501225_0007151 3300049705 Bacteria 3240
377 Ga0501225_0023413 3300049705 Bacteria 1701
378 Ga0501245_005924 3300049708 Bacteria 1700
379 Ga0501080_0062394 3300049742 Bacteria 3469
380 Ga0501266_001073 3300049763 Bacteria 3525
381 Ga0501268_002540 3300049765 Bacteria 2411
382 Ga0501269_001294 3300049766 Bacteria 3344
383 Ga0501270_001325 3300049767 Bacteria 2344
384 nmdc:mga0k408_256_c2 3300050493 Bacteria 19110
385 nmdc:mga0k408_7792_c1 3300050493 Bacteria 5726
386 nmdc:mga0k408_884_c1 3300050493 Bacteria 16424
387 Ga0500578_0098408 3300053086 Bacteria 1853
388 Ga0500644_0000146 3300053088 Bacteria 44082
389 Ga0500583_0000044 3300053092 Bacteria 81138
390 Ga0500583_0000584 3300053092 Bacteria 10971
391 Ga0500583_0003888 3300053092 Bacteria 4785
392 Ga0500556_0004339 3300053104 Bacteria 4040
393 Ga0500608_005054 3300053122 Bacteria 5187
394 Ga0500618_000124 3300053125 Bacteria 63455
395 Ga0500618_002701 3300053125 Bacteria 6480
396 Ga0500642_0031322 3300053130 Bacteria 2221
397 Ga0500652_075126 3300053131 Bacteria 1404
398 Ga0500604_0003566 3300053151 Bacteria 4188
399 Ga0500616_0001419 3300053153 Bacteria 23106
400 Ga0500622_0000991 3300053156 Bacteria 23992
401 Ga0500622_0002447 3300053156 Bacteria 13387
402 Ga0500622_0009023 3300053156 Bacteria 5541
403 Ga0500622_0083577 3300053156 Bacteria 1595
404 Ga0500622_0095710 3300053156 Bacteria 1468
405 Ga0500661_006301 3300055283 Unclassified 2209
406 2599478217 2599185184 Bacteria 6430550
407 2722727602 2721755487 Bacteria 6357185
408 2738730073 2738541278 Bacteria 9755573
409 2738855549 2738541302 Bacteria 5944758
410 2739300489 2738543023 Bacteria 6767879
411 2739589979 2739367651 Bacteria 6359826
412 2819548601 2818991437 Bacteria 5805520
413 2842722697 2842722452 Bacteria 6263924
414 2842905580 2842903701 Bacteria 6986368
415 2842913467 2842909656 Bacteria 6185908
416 2849283940 2849281842 Bacteria 6065644
417 2852623364 2852623160 Bacteria 4376875
418 2857630958 2857627736 Bacteria 5625397
419 2884937759 2884933994 Bacteria 4535041
420 2902049816 2902048731 Bacteria 4976191
421 2904781668 2904780799 Bacteria 5840761
422 2919177622 2919177583 Bacteria 5641607
423 2919438918 2919437846 Bacteria 6199444
424 2928080733 2928078545 Bacteria 6534839
425 2928150958 2928147474 Bacteria 6512076
426 2932082885 2932082852 Bacteria 6563563
427 2945999626 2945997725 Bacteria 6404843
428 2954016368 2954016120 Bacteria 6446024
429 2977236145 2977232053 Bacteria 5485925
430 8003014756 8003014200 Bacteria 4059994
431 Ga0395900_0008366
432 JGI24737J22298_10000110
433 JGI24737J22298_10003483
434 JGI24735J21928_10000004
435 JGI25162J39368_1000017
436 JGI25162J39368_1000342
437 JGI25152J39213_1000067
438 JGI25150J39212_1000001
439 JGI25151J46595_10000005
440 JGI25165J46597_1001336
441 JGI25153J46596_10000040
442 rootH1_10018005
443 rootH2_10001334
444 rootH2_10028071
445 rootH2_10029493
446 rootH2_10047367
447 rootH2_10076352
448 rootL2_10091047
449 rootH1_10002464
450 rootH1_10006939
451 Ga0055536_1000049
452 Ga0055530_10001497
453 Ga0058863_11920111
454 Ga0058862_12251515
455 Ga0065165_1006758
456 Ga0065714_10003376
457 Ga0065714_10064453
458 Ga0065714_10064880
459 Ga0065714_10068070
460 Ga0065714_10086150
461 Ga0070658_10000019
462 Ga0070658_10094675
463 Ga0070658_10172543
464 Ga0070676_10000038
465 Ga0070676_10011160
466 Ga0070683_100001459
467 Ga0070683_100033104
468 Ga0070666_10028643
469 Ga0068868_100031929
470 Ga0068868_100076913
471 Ga0068868_100102624
472 Ga0070660_100095447
473 Ga0070691_10010073
474 Ga0070673_100011398
475 Ga0070659_100068355
476 Ga0070659_100071202
477 Ga0070663_100003783
478 Ga0070662_100000464
479 Ga0070681_10034844
480 Ga0068867_100000255
481 Ga0068867_100026605
482 Ga0070685_10014905
483 Ga0070684_100234458
484 Ga0068853_100001443
485 Ga0068853_100032860
486 Ga0070693_100021034
487 Ga0070665_100000003
488 Ga0070665_100000074
489 Ga0068855_100000073
490 Ga0068855_100000086
491 Ga0068855_100005249
492 Ga0068855_100032255
493 Ga0068855_100131442
494 Ga0068857_100003719
495 Ga0068857_100013211
496 Ga0068854_100020154
497 Ga0068856_100001137
498 Ga0068856_100026426
499 Ga0068856_100027517
500 Ga0068856_100074592
501 Ga0068856_100105588
502 Ga0068852_100000937
503 Ga0068852_100001089
504 Ga0068852_100065146
505 Ga0068852_100093285
506 Ga0068851_10005158
507 Ga0068860_100000110
508 Ga0068860_100129222
509 Ga0075366_10000577
510 Ga0075366_10003825
511 Ga0075366_10004460
512 Ga0097621_100000241
513 Ga0097621_100020810
514 Ga0068871_100000499
515 Ga0068871_100006779
516 Ga0068865_100000022
517 Ga0105244_10013507
518 Ga0105240_10000010
519 Ga0105240_10000253
520 Ga0105240_10000418
521 Ga0105240_10000448
522 Ga0105240_10018127
523 Ga0105240_10020548
524 Ga0105240_10057496
525 Ga0105240_10156171
526 Ga0105240_10227633
527 Ga0105241_10001498
528 Ga0105241_10002955
529 Ga0105241_10003853
530 Ga0105241_10009914
531 Ga0105237_10000065
532 Ga0105237_10000137
533 Ga0105237_10001288
534 Ga0105237_10001855
535 Ga0105237_10002699
536 Ga0105237_10003021
537 Ga0105237_10003749
538 Ga0105237_10007138
539 Ga0105237_10103258
540 Ga0105237_10103812
541 Ga0105238_10003185
542 Ga0105238_10016846
543 Ga0105238_10188094
544 Ga0105239_10000005
545 Ga0105239_10000042
546 Ga0105239_10000079
547 Ga0105239_10001594
548 Ga0105239_10002289
549 Ga0105239_10007964
550 Ga0105239_10008882
551 Ga0105239_10015875
552 Ga0105239_10019439
553 Ga0105239_10032740
554 Ga0105239_10044904
555 Ga0105239_10053336
556 Ga0105239_10056437
557 Ga0105239_10098630
558 Ga0105239_10101063
559 Ga0157373_10000223
560 Ga0157373_10018449
561 Ga0157371_10000051
562 Ga0157371_10000622
563 Ga0157371_10001433
564 Ga0157371_10032101
565 Ga0157370_10000695
566 Ga0157370_10004105
567 Ga0157370_10031278
568 Ga0157370_10045526
569 Ga0157370_10047374
570 Ga0157370_10152094
571 Ga0157369_10000033
572 Ga0157369_10000165
573 Ga0157369_10036312
574 Ga0157369_10059614
575 Ga0157369_10062176
576 Ga0157374_10000003
577 Ga0157374_10000130
578 Ga0157374_10001204
579 Ga0157374_10003721
580 Ga0157378_10011920
581 Ga0157378_10023601
582 Ga0163162_10000064
583 Ga0163162_10000453
584 Ga0163162_10014886
585 Ga0163162_10028857
586 Ga0157372_10000021
587 Ga0157372_10001064
588 Ga0157372_10001219
589 Ga0157372_10005160
590 Ga0157372_10029773
591 Ga0157372_10103085
592 Ga0157372_10264678
593 Ga0157372_10313843
594 Ga0157375_10007870
595 Ga0157375_10016311
596 Ga0163163_10138888
597 Ga0157377_10112178
598 Ga0157376_10034937
599 Ga0157376_10168474
600 Ga0182006_1000168
601 Ga0182006_1000353
602 Ga0182007_10000015
603 Ga0183373_1005
604 Ga0163161_10000178
605 Ga0163161_10000215
606 Ga0163161_10000331
607 Ga0206356_10180947
608 Ga0206352_10142486
609 Ga0213872_10013848
610 Ga0213876_10000546
611 Ga0224712_10053999
612 Ga0209436_102713
613 Ga0207427_100208
614 Ga0209437_100024
615 Ga0209437_100052
616 Ga0207425_1000002
617 Ga0209026_1000305
618 Ga0209026_1002307
619 Ga0209129_1000002
620 Ga0209233_1000067
621 Ga0209233_1002811
622 Ga0209455_1002548
623 Ga0209676_1000001
624 Ga0209676_1003582
625 Ga0209025_1000004
626 Ga0209758_1000006
627 Ga0209050_1000258
628 Ga0207426_1015505
629 Ga0207656_10018679
630 Ga0207647_10000093
631 Ga0207647_10000494
632 Ga0207647_10049626
633 Ga0207645_10000585
634 Ga0207645_10027220
635 Ga0207705_10000069
636 Ga0207654_10002822
637 Ga0207654_10006865
638 Ga0207654_10009641
639 Ga0207695_10000019
640 Ga0207695_10000039
641 Ga0207695_10000073
642 Ga0207695_10000990
643 Ga0207695_10002972
644 Ga0207695_10021056
645 Ga0207695_10036314
646 Ga0207695_10052864
647 Ga0207695_10103369
648 Ga0207695_10181431
649 Ga0207671_10000424
650 Ga0207671_10000657
651 Ga0207671_10001714
652 Ga0207671_10003844
653 Ga0207671_10004413
654 Ga0207671_10004886
655 Ga0207671_10006359
656 Ga0207671_10029190
657 Ga0207671_10029206
658 Ga0207652_10012750
659 Ga0207694_10002351
660 Ga0207694_10006989
661 Ga0207694_10084022
662 Ga0207706_10000243
663 Ga0207686_10017457
664 Ga0207709_10000010
665 Ga0207704_10000011
666 Ga0207665_10061359
667 Ga0207661_10022438
668 Ga0207661_10027170
669 Ga0207667_10000009
670 Ga0207667_10000229
671 Ga0207667_10001845
672 Ga0207667_10006679
673 Ga0207667_10063906
674 Ga0207651_10023776
675 Ga0207640_10024141
676 Ga0207677_10020815
677 Ga0207639_10008167
678 Ga0207639_10011872
679 Ga0207702_10004829
680 Ga0207702_10130296
681 Ga0207648_10001014
682 Ga0207648_10046823
683 Ga0207674_10000801
684 Ga0207674_10036564
685 Ga0207683_10008234
686 Ga0207698_10001995
687 Ga0207698_10215368
688 Ga0268266_10000010
689 Ga0268266_10000078
690 Ga0268264_10000052
691 Ga0268264_10022012
692 Ga0268264_10088667
693 Ga0268264_10281261
694 Ga0307517_10004416
695 Ga0307515_10000076
696 Ga0307515_10001207
697 Ga0307515_10001331
698 Ga0307515_10001361
699 Ga0265338_10029950
700 Ga0307511_10000367
701 Ga0316176_1031671
702 Ga0316183_1007327
703 Ga0265327_10015699
704 Ga0307513_10090619
705 Ga0265313_10023552
706 Ga0307508_10001839
707 Ga0307514_10055758
708 Ga0316579_10020254
709 Ga0307516_10001688
710 Ga0307405_10000038
711 Ga0307407_10000005
712 Ga0307412_10067671
713 Ga0307409_100051659
714 Ga0307409_100077071
715 Ga0307416_100000001
716 Ga0307507_10000034
717 Ga0307510_10001439
718 Ga0307510_10027516
719 Ga0373927_0070933
720 Ga0395899_0000121
721 Ga0395899_0000461
722 Ga0395899_0001870
723 Ga0395899_0124661
724 Ga0395900_0000014
725 Ga0395900_0000358
726 Ga0395900_0084893
727 Ga0395898_0070220
728 Ga0395905_0000037
729 Ga0395905_0001101
730 Ga0395905_0005047
731 Ga0395901_0000117
732 Ga0395901_0075658
733 Ga0436365_1030238
734 Ga0436361_1054104
735 Ga0439465_0018172
736 Ga0439448_0016317
737 Ga0439455_0023206
738 Ga0439457_012683
739 Ga0451577_0048588
740 Ga0466972_0000015
741 Ga0466972_0000950
742 Ga0466972_0068407
743 Ga0466961_0100195
744 Ga0466964_0018977
745 Ga0466971_0027990
746 Ga0466957_0000015
747 Ga0466957_0012253
748 Ga0466957_0037334
749 Ga0466959_0014760
750 Ga0466958_0018279
751 Ga0495638_0068247
752 Ga0495650_0000087
753 Ga0495585_0000448
754 Ga0495585_0023273
755 Ga0495606_0000052
756 Ga0495606_0005009
757 Ga0495606_0005602
758 Ga0495606_0047678
759 Ga0495610_0000151
760 Ga0495610_0000334
761 Ga0495610_0006882
762 Ga0495616_0047442
763 Ga0495631_0013832
764 Ga0495632_0045362
765 Ga0495644_0003932
766 Ga0495648_0001850
767 Ga0495648_0005656
768 Ga0495609_0016585
769 Ga0495622_0023249
770 Ga0495633_0000177
771 Ga0495668_0000207
772 Ga0495668_0011638
773 Ga0495611_0000761
774 Ga0495625_0000008
775 Ga0495625_0005804
776 Ga0495625_0014987
777 Ga0495625_0040978
778 Ga0495661_0000579
779 Ga0495649_0000018
780 Ga0495649_0055515
781 Ga0495687_000039
782 Ga0495687_001584
783 Ga0495687_001870
784 Ga0495686_0000046
785 Ga0495686_0000052
786 Ga0495686_0006150
787 Ga0495686_0032424
788 Ga0495614_0014276
789 Ga0496115_0018532
790 Ga0496115_0085092
791 Ga0496116_0021166
792 Ga0496117_0013605
793 Ga0496118_0069734
794 Ga0496122_0008079
795 Ga0496123_0042756
796 Ga0501306_006170
797 Ga0501319_000472
798 Ga0501202_008465
799 Ga0501202_008878
800 Ga0501217_015247
801 Ga0501242_000474
802 Ga0501250_000127
803 Ga0501257_003846
804 Ga0501259_001527
805 Ga0501225_0002275
806 Ga0501225_0007151
807 Ga0501225_0023413
808 Ga0501245_005924
809 Ga0501080_0062394
810 Ga0501266_001073
811 Ga0501268_002540
812 Ga0501269_001294
813 Ga0501270_001325
814 nmdc:mga0k408_256_c2
815 nmdc:mga0k408_7792_c1
816 nmdc:mga0k408_884_c1
817 Ga0500578_0098408
818 Ga0500644_0000146
819 Ga0500583_0000044
820 Ga0500583_0000584
821 Ga0500583_0003888
822 Ga0500556_0004339
823 Ga0500608_005054
824 Ga0500618_000124
825 Ga0500618_002701
826 Ga0500642_0031322
827 Ga0500652_075126
828 Ga0500604_0003566
829 Ga0500616_0001419
830 Ga0500622_0000991
831 Ga0500622_0002447
832 Ga0500622_0009023
833 Ga0500622_0083577
834 Ga0500622_0095710
835 Ga0500661_006301
836 2599478217
837 2722727602
838 2738730073
839 2738855549
840 2739300489
841 2739589979
842 2819548601
843 2842722697
844 2842905580
845 2842913467
846 2849283940
847 2852623364
848 2857630958
849 2884937759
850 2902049816
851 2904781668
852 2919177622
853 2919438918
854 2928080733
855 2928150958
856 2932082885
857 2945999626
858 2954016368
859 2977236145
860 8003014756

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07994

NAD_binding_5

Myo-inositol-1-phosphate synthase

51

456

0.99

PF01658

Inos-1-P_synth

Myo-inositol-1-phosphate synthase

284

396

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nwr-assembly1.cif.gz_B structure of bt1526, a myo-inositol-1-phosphate synthase 0.9234 4 428
7nwr-assembly1.cif.gz_B structure of bt1526, a myo-inositol-1-phosphate synthase 0.9192 4 428
1p1j-assembly1.cif.gz_B crystal structure of the 1l-myo-inositol 1-phosphate synthase complexed with nadh 0.8695 11 432
1jki-assembly1.cif.gz_A myo-inositol-1-phosphate synthase complexed with an inhibitor, 2-deoxy-glucitol-6-phosphate 0.8635 11 428
1vko-assembly1.cif.gz_A crystal structure of inositol-3-phosphate synthase (ce21227) from caenorhabditis elegans at 2.30 a resolution 0.8496 5 437
ID Description Score Start End Superfamily
af_A0A1D6NW00_41_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 71 259 3.40.50.720
af_A4HW82_1_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9427 63 246 3.40.50.720
af_Q4DFC2_1_344_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9209 9 277 3.40.50.720
af_Q8I3Y8_28_377_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9067 9 288 3.40.50.720
af_Q4DDJ2_1_218_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9007 9 154 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0HFW8-F1-model_v4 Inositol-3-phosphate synthase 0.9889 115 240 GO:0004512
GO:0006021
GO:0008654
AF-A0A2V9H342-F1-model_v4 Inositol-3-phosphate synthase 0.9834 16 226 GO:0004512
GO:0006021
GO:0008654
AF-A0A4Q3LR54-F1-model_v4 deleted 0.9819 1 244
AF-A0A7W1R7H3-F1-model_v4 Inositol-3-phosphate synthase 0.9817 4 220 GO:0004512
GO:0006021
GO:0008654
AF-A0A352VHW6-F1-model_v4 Inositol-3-phosphate synthase 0.9795 4 180 GO:0004512
GO:0006021
GO:0008654

Map