F442183
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 234 | 860 | 435 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0008366|Ga0395900_0008366_4724_6163 |
| Length | 479 |
| Sequence | MAYFYLRVNFVKFFNGFWGKILLFELFNHKVKLNNIYFIMKSNIQPAEGKLGILIPGLGAVATTLIAGVEAVKKGISQPFGSLTQMGHIRLGKRTENRFPKIKDFVPLADLNDIAFGGWDVYSDNVYQAASNAKVLDQGLLYAIKPELEKLVPMKAAFDKNYAKNLDGTHVKQGTRRELADQVIEDIQNFKEKNGCNRIVLVWCGSTEIYYEASEIHQSLAAFEEALDNDDKRISPSMIYAYAALKLGFPFANGAPNLTVDIPALIELSKLTNTPIAGKDFKTGQTLMKTILAPGLAARALGIKGWFSTNILGNRDGLVLDDPDNFKTKEVSKLGVLEDILRPEDNPELYGDIFHKIRINYYPPHGDNKESWDNIDIFGWLGYPMQIKINFLCRDSILAAPIALDLALFIDLAKRAEMSGIQEWLSFYLKSPQTLPGLRPENDIFKQLMKLQNTLRHLMGEDLITHLGLDYYQDLVEAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 120 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 121 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 122 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 124 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 127 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 143 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 144 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 145 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 146 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 147 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 148 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 181 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 182 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 185 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 186 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 187 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 188 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 189 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 190 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 191 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 194 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 195 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 196 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 199 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 201 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 202 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 203 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 204 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 205 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 209 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 210 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 211 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 212 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 213 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 214 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 215 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 216 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 217 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 218 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 219 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 220 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 221 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 222 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 223 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 224 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 225 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 226 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 227 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 228 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 229 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 230 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 231 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 232 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 233 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 234 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.56 |
| Metatranscriptomes | 1.63 |
| Isolates | 5.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.63 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 77.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0008366 | 3300037418 | Bacteria | 10647 |
| 2 | JGI24737J22298_10000110 | 3300001990 | Bacteria | 24863 |
| 3 | JGI24737J22298_10003483 | 3300001990 | Bacteria | 5550 |
| 4 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 5 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 6 | JGI25162J39368_1000342 | 3300002737 | Bacteria | 40311 |
| 7 | JGI25152J39213_1000067 | 3300002773 | Bacteria | 68480 |
| 8 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 9 | JGI25151J46595_10000005 | 3300003187 | Bacteria | 431598 |
| 10 | JGI25165J46597_1001336 | 3300003214 | Bacteria | 13864 |
| 11 | JGI25153J46596_10000040 | 3300003215 | Bacteria | 165523 |
| 12 | rootH1_10018005 | 3300003316 | Bacteria | 14041 |
| 13 | rootH2_10001334 | 3300003320 | Bacteria | 238709 |
| 14 | rootH2_10028071 | 3300003320 | Bacteria | 16976 |
| 15 | rootH2_10029493 | 3300003320 | Bacteria | 12960 |
| 16 | rootH2_10047367 | 3300003320 | Bacteria | 14620 |
| 17 | rootH2_10076352 | 3300003320 | Bacteria | 6882 |
| 18 | rootL2_10091047 | 3300003322 | Bacteria | 2325 |
| 19 | rootH1_10002464 | 3300003323 | Bacteria | 35419 |
| 20 | rootH1_10006939 | 3300003323 | Bacteria | 26814 |
| 21 | Ga0055536_1000049 | 3300003781 | Bacteria | 113328 |
| 22 | Ga0055530_10001497 | 3300003791 | Bacteria | 16966 |
| 23 | Ga0058863_11920111 | 3300004799 | Bacteria | 2076 |
| 24 | Ga0058862_12251515 | 3300004803 | Bacteria | 1713 |
| 25 | Ga0065165_1006758 | 3300005262 | Bacteria | 5874 |
| 26 | Ga0065714_10003376 | 3300005288 | Bacteria | 7316 |
| 27 | Ga0065714_10064453 | 3300005288 | Bacteria | 74728 |
| 28 | Ga0065714_10064880 | 3300005288 | Bacteria | 16161 |
| 29 | Ga0065714_10068070 | 3300005288 | Bacteria | 4991 |
| 30 | Ga0065714_10086150 | 3300005288 | Bacteria | 2112 |
| 31 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 32 | Ga0070658_10094675 | 3300005327 | Bacteria | 2464 |
| 33 | Ga0070658_10172543 | 3300005327 | Bacteria | 1817 |
| 34 | Ga0070676_10000038 | 3300005328 | Bacteria | 39143 |
| 35 | Ga0070676_10011160 | 3300005328 | Bacteria | 4881 |
| 36 | Ga0070683_100001459 | 3300005329 | Bacteria | 18185 |
| 37 | Ga0070683_100033104 | 3300005329 | Bacteria | 4711 |
| 38 | Ga0070666_10028643 | 3300005335 | Bacteria | 3656 |
| 39 | Ga0068868_100031929 | 3300005338 | Bacteria | 4048 |
| 40 | Ga0068868_100076913 | 3300005338 | Bacteria | 2669 |
| 41 | Ga0068868_100102624 | 3300005338 | Bacteria | 2316 |
| 42 | Ga0070660_100095447 | 3300005339 | Bacteria | 2350 |
| 43 | Ga0070691_10010073 | 3300005341 | Bacteria | 4307 |
| 44 | Ga0070673_100011398 | 3300005364 | Bacteria | 6065 |
| 45 | Ga0070659_100068355 | 3300005366 | Bacteria | 2818 |
| 46 | Ga0070659_100071202 | 3300005366 | Bacteria | 2764 |
| 47 | Ga0070663_100003783 | 3300005455 | Bacteria | 8795 |
| 48 | Ga0070662_100000464 | 3300005457 | Bacteria | 24077 |
| 49 | Ga0070681_10034844 | 3300005458 | Bacteria | 5055 |
| 50 | Ga0068867_100000255 | 3300005459 | Bacteria | 35036 |
| 51 | Ga0068867_100026605 | 3300005459 | Bacteria | 4154 |
| 52 | Ga0070685_10014905 | 3300005466 | Bacteria | 4124 |
| 53 | Ga0070684_100234458 | 3300005535 | Bacteria | 1676 |
| 54 | Ga0068853_100001443 | 3300005539 | Bacteria | 17201 |
| 55 | Ga0068853_100032860 | 3300005539 | Bacteria | 4398 |
| 56 | Ga0070693_100021034 | 3300005547 | Bacteria | 3451 |
| 57 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 58 | Ga0070665_100000074 | 3300005548 | Bacteria | 192944 |
| 59 | Ga0068855_100000073 | 3300005563 | Bacteria | 121126 |
| 60 | Ga0068855_100000086 | 3300005563 | Bacteria | 111462 |
| 61 | Ga0068855_100005249 | 3300005563 | Bacteria | 15806 |
| 62 | Ga0068855_100032255 | 3300005563 | Bacteria | 6255 |
| 63 | Ga0068855_100131442 | 3300005563 | Bacteria | 2858 |
| 64 | Ga0068857_100003719 | 3300005577 | Bacteria | 12802 |
| 65 | Ga0068857_100013211 | 3300005577 | Bacteria | 7195 |
| 66 | Ga0068854_100020154 | 3300005578 | Bacteria | 4506 |
| 67 | Ga0068856_100001137 | 3300005614 | Bacteria | 27953 |
| 68 | Ga0068856_100026426 | 3300005614 | Bacteria | 5661 |
| 69 | Ga0068856_100027517 | 3300005614 | Bacteria | 5547 |
| 70 | Ga0068856_100074592 | 3300005614 | Bacteria | 3359 |
| 71 | Ga0068856_100105588 | 3300005614 | Bacteria | 2810 |
| 72 | Ga0068852_100000937 | 3300005616 | Bacteria | 19263 |
| 73 | Ga0068852_100001089 | 3300005616 | Bacteria | 17919 |
| 74 | Ga0068852_100065146 | 3300005616 | Bacteria | 3178 |
| 75 | Ga0068852_100093285 | 3300005616 | Bacteria | 2698 |
| 76 | Ga0068851_10005158 | 3300005834 | Bacteria | 5928 |
| 77 | Ga0068860_100000110 | 3300005843 | Bacteria | 131175 |
| 78 | Ga0068860_100129222 | 3300005843 | Bacteria | 2423 |
| 79 | Ga0075366_10000577 | 3300006195 | Bacteria | 17211 |
| 80 | Ga0075366_10003825 | 3300006195 | Bacteria | 8013 |
| 81 | Ga0075366_10004460 | 3300006195 | Bacteria | 7513 |
| 82 | Ga0097621_100000241 | 3300006237 | Bacteria | 36577 |
| 83 | Ga0097621_100020810 | 3300006237 | Bacteria | 5062 |
| 84 | Ga0068871_100000499 | 3300006358 | Bacteria | 26769 |
| 85 | Ga0068871_100006779 | 3300006358 | Bacteria | 8138 |
| 86 | Ga0068865_100000022 | 3300006881 | Bacteria | 102976 |
| 87 | Ga0105244_10013507 | 3300009036 | Bacteria | 4770 |
| 88 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 89 | Ga0105240_10000253 | 3300009093 | Bacteria | 106101 |
| 90 | Ga0105240_10000418 | 3300009093 | Bacteria | 78645 |
| 91 | Ga0105240_10000448 | 3300009093 | Bacteria | 75837 |
| 92 | Ga0105240_10018127 | 3300009093 | Bacteria | 9465 |
| 93 | Ga0105240_10020548 | 3300009093 | Bacteria | 8802 |
| 94 | Ga0105240_10057496 | 3300009093 | Bacteria | 4859 |
| 95 | Ga0105240_10156171 | 3300009093 | Bacteria | 2713 |
| 96 | Ga0105240_10227633 | 3300009093 | Bacteria | 2169 |
| 97 | Ga0105241_10001498 | 3300009174 | Bacteria | 17918 |
| 98 | Ga0105241_10002955 | 3300009174 | Bacteria | 12694 |
| 99 | Ga0105241_10003853 | 3300009174 | Bacteria | 11119 |
| 100 | Ga0105241_10009914 | 3300009174 | Bacteria | 7001 |
| 101 | Ga0105237_10000065 | 3300009545 | Bacteria | 139423 |
| 102 | Ga0105237_10000137 | 3300009545 | Bacteria | 102639 |
| 103 | Ga0105237_10001288 | 3300009545 | Bacteria | 33371 |
| 104 | Ga0105237_10001855 | 3300009545 | Bacteria | 27072 |
| 105 | Ga0105237_10002699 | 3300009545 | Bacteria | 21706 |
| 106 | Ga0105237_10003021 | 3300009545 | Bacteria | 20301 |
| 107 | Ga0105237_10003749 | 3300009545 | Bacteria | 17908 |
| 108 | Ga0105237_10007138 | 3300009545 | Bacteria | 12276 |
| 109 | Ga0105237_10103258 | 3300009545 | Bacteria | 2842 |
| 110 | Ga0105237_10103812 | 3300009545 | Bacteria | 2834 |
| 111 | Ga0105238_10003185 | 3300009551 | Bacteria | 16373 |
| 112 | Ga0105238_10016846 | 3300009551 | Bacteria | 7412 |
| 113 | Ga0105238_10188094 | 3300009551 | Bacteria | 2041 |
| 114 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 115 | Ga0105239_10000042 | 3300010375 | Bacteria | 199662 |
| 116 | Ga0105239_10000079 | 3300010375 | Bacteria | 135513 |
| 117 | Ga0105239_10001594 | 3300010375 | Bacteria | 29975 |
| 118 | Ga0105239_10002289 | 3300010375 | Bacteria | 24463 |
| 119 | Ga0105239_10007964 | 3300010375 | Bacteria | 12104 |
| 120 | Ga0105239_10008882 | 3300010375 | Bacteria | 11375 |
| 121 | Ga0105239_10015875 | 3300010375 | Bacteria | 8336 |
| 122 | Ga0105239_10019439 | 3300010375 | Bacteria | 7499 |
| 123 | Ga0105239_10032740 | 3300010375 | Bacteria | 5712 |
| 124 | Ga0105239_10044904 | 3300010375 | Bacteria | 4843 |
| 125 | Ga0105239_10053336 | 3300010375 | Bacteria | 4436 |
| 126 | Ga0105239_10056437 | 3300010375 | Bacteria | 4308 |
| 127 | Ga0105239_10098630 | 3300010375 | Bacteria | 3230 |
| 128 | Ga0105239_10101063 | 3300010375 | Bacteria | 3190 |
| 129 | Ga0157373_10000223 | 3300013100 | Bacteria | 46516 |
| 130 | Ga0157373_10018449 | 3300013100 | Bacteria | 5079 |
| 131 | Ga0157371_10000051 | 3300013102 | Bacteria | 180272 |
| 132 | Ga0157371_10000622 | 3300013102 | Bacteria | 42231 |
| 133 | Ga0157371_10001433 | 3300013102 | Bacteria | 24766 |
| 134 | Ga0157371_10032101 | 3300013102 | Bacteria | 3780 |
| 135 | Ga0157370_10000695 | 3300013104 | Bacteria | 42043 |
| 136 | Ga0157370_10004105 | 3300013104 | Bacteria | 16885 |
| 137 | Ga0157370_10031278 | 3300013104 | Bacteria | 5208 |
| 138 | Ga0157370_10045526 | 3300013104 | Bacteria | 4209 |
| 139 | Ga0157370_10047374 | 3300013104 | Bacteria | 4121 |
| 140 | Ga0157370_10152094 | 3300013104 | Bacteria | 2153 |
| 141 | Ga0157369_10000033 | 3300013105 | Bacteria | 201124 |
| 142 | Ga0157369_10000165 | 3300013105 | Bacteria | 93924 |
| 143 | Ga0157369_10036312 | 3300013105 | Bacteria | 5400 |
| 144 | Ga0157369_10059614 | 3300013105 | Bacteria | 4115 |
| 145 | Ga0157369_10062176 | 3300013105 | Bacteria | 4024 |
| 146 | Ga0157374_10000003 | 3300013296 | Bacteria | 854471 |
| 147 | Ga0157374_10000130 | 3300013296 | Bacteria | 68718 |
| 148 | Ga0157374_10001204 | 3300013296 | Bacteria | 22127 |
| 149 | Ga0157374_10003721 | 3300013296 | Bacteria | 12819 |
| 150 | Ga0157378_10011920 | 3300013297 | Bacteria | 7613 |
| 151 | Ga0157378_10023601 | 3300013297 | Bacteria | 5410 |
| 152 | Ga0163162_10000064 | 3300013306 | Bacteria | 103542 |
| 153 | Ga0163162_10000453 | 3300013306 | Bacteria | 37951 |
| 154 | Ga0163162_10014886 | 3300013306 | Bacteria | 7596 |
| 155 | Ga0163162_10028857 | 3300013306 | Bacteria | 5492 |
| 156 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 157 | Ga0157372_10001064 | 3300013307 | Bacteria | 30014 |
| 158 | Ga0157372_10001219 | 3300013307 | Bacteria | 27839 |
| 159 | Ga0157372_10005160 | 3300013307 | Bacteria | 13886 |
| 160 | Ga0157372_10029773 | 3300013307 | Bacteria | 5966 |
| 161 | Ga0157372_10103085 | 3300013307 | Bacteria | 3260 |
| 162 | Ga0157372_10264678 | 3300013307 | Bacteria | 1997 |
| 163 | Ga0157372_10313843 | 3300013307 | Bacteria | 1825 |
| 164 | Ga0157375_10007870 | 3300013308 | Bacteria | 9328 |
| 165 | Ga0157375_10016311 | 3300013308 | Bacteria | 6668 |
| 166 | Ga0163163_10138888 | 3300014325 | Bacteria | 2472 |
| 167 | Ga0157377_10112178 | 3300014745 | Bacteria | 1640 |
| 168 | Ga0157376_10034937 | 3300014969 | Bacteria | 4062 |
| 169 | Ga0157376_10168474 | 3300014969 | Bacteria | 1992 |
| 170 | Ga0182006_1000168 | 3300015261 | Bacteria | 69340 |
| 171 | Ga0182006_1000353 | 3300015261 | Bacteria | 38632 |
| 172 | Ga0182007_10000015 | 3300015262 | Bacteria | 207893 |
| 173 | Ga0183373_1005 | 3300015682 | Bacteria | 351562 |
| 174 | Ga0163161_10000178 | 3300017792 | Bacteria | 58130 |
| 175 | Ga0163161_10000215 | 3300017792 | Bacteria | 52730 |
| 176 | Ga0163161_10000331 | 3300017792 | Bacteria | 40390 |
| 177 | Ga0206356_10180947 | 3300020070 | Bacteria | 1736 |
| 178 | Ga0206352_10142486 | 3300020078 | Bacteria | 2173 |
| 179 | Ga0213872_10013848 | 3300021361 | Bacteria | 3770 |
| 180 | Ga0213876_10000546 | 3300021384 | Bacteria | 28155 |
| 181 | Ga0224712_10053999 | 3300022467 | Bacteria | 1575 |
| 182 | Ga0209436_102713 | 3300025208 | Bacteria | 5115 |
| 183 | Ga0207427_100208 | 3300025231 | Bacteria | 53345 |
| 184 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 185 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 186 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 187 | Ga0209026_1000305 | 3300025250 | Bacteria | 53618 |
| 188 | Ga0209026_1002307 | 3300025250 | Bacteria | 7270 |
| 189 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 190 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 191 | Ga0209233_1002811 | 3300025261 | Bacteria | 6250 |
| 192 | Ga0209455_1002548 | 3300025272 | Bacteria | 6968 |
| 193 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 194 | Ga0209676_1003582 | 3300025292 | Bacteria | 9371 |
| 195 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 196 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 197 | Ga0209050_1000258 | 3300025298 | Bacteria | 113741 |
| 198 | Ga0207426_1015505 | 3300025302 | Bacteria | 2761 |
| 199 | Ga0207656_10018679 | 3300025321 | Bacteria | 2732 |
| 200 | Ga0207647_10000093 | 3300025904 | Bacteria | 68094 |
| 201 | Ga0207647_10000494 | 3300025904 | Bacteria | 31578 |
| 202 | Ga0207647_10049626 | 3300025904 | Bacteria | 2602 |
| 203 | Ga0207645_10000585 | 3300025907 | Bacteria | 30250 |
| 204 | Ga0207645_10027220 | 3300025907 | Bacteria | 3693 |
| 205 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 206 | Ga0207654_10002822 | 3300025911 | Bacteria | 8815 |
| 207 | Ga0207654_10006865 | 3300025911 | Bacteria | 5729 |
| 208 | Ga0207654_10009641 | 3300025911 | Bacteria | 4910 |
| 209 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 210 | Ga0207695_10000039 | 3300025913 | Bacteria | 454801 |
| 211 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 212 | Ga0207695_10000990 | 3300025913 | Bacteria | 50315 |
| 213 | Ga0207695_10002972 | 3300025913 | Bacteria | 24457 |
| 214 | Ga0207695_10021056 | 3300025913 | Bacteria | 7449 |
| 215 | Ga0207695_10036314 | 3300025913 | Bacteria | 5330 |
| 216 | Ga0207695_10052864 | 3300025913 | Bacteria | 4252 |
| 217 | Ga0207695_10103369 | 3300025913 | Bacteria | 2840 |
| 218 | Ga0207695_10181431 | 3300025913 | Bacteria | 2026 |
| 219 | Ga0207671_10000424 | 3300025914 | Bacteria | 58429 |
| 220 | Ga0207671_10000657 | 3300025914 | Bacteria | 45082 |
| 221 | Ga0207671_10001714 | 3300025914 | Bacteria | 24751 |
| 222 | Ga0207671_10003844 | 3300025914 | Bacteria | 14692 |
| 223 | Ga0207671_10004413 | 3300025914 | Bacteria | 13479 |
| 224 | Ga0207671_10004886 | 3300025914 | Bacteria | 12600 |
| 225 | Ga0207671_10006359 | 3300025914 | Bacteria | 10534 |
| 226 | Ga0207671_10029190 | 3300025914 | Bacteria | 4119 |
| 227 | Ga0207671_10029206 | 3300025914 | Bacteria | 4118 |
| 228 | Ga0207652_10012750 | 3300025921 | Bacteria | 6795 |
| 229 | Ga0207694_10002351 | 3300025924 | Bacteria | 15472 |
| 230 | Ga0207694_10006989 | 3300025924 | Bacteria | 8566 |
| 231 | Ga0207694_10084022 | 3300025924 | Bacteria | 2504 |
| 232 | Ga0207706_10000243 | 3300025933 | Bacteria | 59842 |
| 233 | Ga0207686_10017457 | 3300025934 | Bacteria | 4045 |
| 234 | Ga0207709_10000010 | 3300025935 | Bacteria | 601305 |
| 235 | Ga0207704_10000011 | 3300025938 | Bacteria | 180140 |
| 236 | Ga0207665_10061359 | 3300025939 | Bacteria | 2548 |
| 237 | Ga0207661_10022438 | 3300025944 | Bacteria | 4755 |
| 238 | Ga0207661_10027170 | 3300025944 | Bacteria | 4369 |
| 239 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 240 | Ga0207667_10000229 | 3300025949 | Bacteria | 78821 |
| 241 | Ga0207667_10001845 | 3300025949 | Bacteria | 26612 |
| 242 | Ga0207667_10006679 | 3300025949 | Bacteria | 13945 |
| 243 | Ga0207667_10063906 | 3300025949 | Bacteria | 3845 |
| 244 | Ga0207651_10023776 | 3300025960 | Bacteria | 3777 |
| 245 | Ga0207640_10024141 | 3300025981 | Bacteria | 3664 |
| 246 | Ga0207677_10020815 | 3300026023 | Bacteria | 3993 |
| 247 | Ga0207639_10008167 | 3300026041 | Bacteria | 7159 |
| 248 | Ga0207639_10011872 | 3300026041 | Bacteria | 6058 |
| 249 | Ga0207702_10004829 | 3300026078 | Bacteria | 11875 |
| 250 | Ga0207702_10130296 | 3300026078 | Bacteria | 2263 |
| 251 | Ga0207648_10001014 | 3300026089 | Bacteria | 31612 |
| 252 | Ga0207648_10046823 | 3300026089 | Bacteria | 3791 |
| 253 | Ga0207674_10000801 | 3300026116 | Bacteria | 40866 |
| 254 | Ga0207674_10036564 | 3300026116 | Bacteria | 5114 |
| 255 | Ga0207683_10008234 | 3300026121 | Bacteria | 8919 |
| 256 | Ga0207698_10001995 | 3300026142 | Bacteria | 12019 |
| 257 | Ga0207698_10215368 | 3300026142 | Bacteria | 1731 |
| 258 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 259 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 260 | Ga0268264_10000052 | 3300028381 | Bacteria | 321218 |
| 261 | Ga0268264_10022012 | 3300028381 | Bacteria | 5201 |
| 262 | Ga0268264_10088667 | 3300028381 | Bacteria | 2663 |
| 263 | Ga0268264_10281261 | 3300028381 | Bacteria | 1559 |
| 264 | Ga0307517_10004416 | 3300028786 | Bacteria | 21602 |
| 265 | Ga0307515_10000076 | 3300028794 | Bacteria | 228736 |
| 266 | Ga0307515_10001207 | 3300028794 | Bacteria | 59017 |
| 267 | Ga0307515_10001331 | 3300028794 | Bacteria | 55969 |
| 268 | Ga0307515_10001361 | 3300028794 | Bacteria | 55260 |
| 269 | Ga0265338_10029950 | 3300028800 | Bacteria | 5381 |
| 270 | Ga0307511_10000367 | 3300030521 | Bacteria | 48024 |
| 271 | Ga0316176_1031671 | 3300030732 | Bacteria | 50195 |
| 272 | Ga0316183_1007327 | 3300030742 | Bacteria | 68568 |
| 273 | Ga0265327_10015699 | 3300031251 | Bacteria | 4867 |
| 274 | Ga0307513_10090619 | 3300031456 | Bacteria | 3118 |
| 275 | Ga0265313_10023552 | 3300031595 | Bacteria | 3315 |
| 276 | Ga0307508_10001839 | 3300031616 | Bacteria | 23472 |
| 277 | Ga0307514_10055758 | 3300031649 | Bacteria | 3036 |
| 278 | Ga0316579_10020254 | 3300031691 | Bacteria | 2948 |
| 279 | Ga0307516_10001688 | 3300031730 | Bacteria | 30411 |
| 280 | Ga0307405_10000038 | 3300031731 | Bacteria | 86305 |
| 281 | Ga0307407_10000005 | 3300031903 | Bacteria | 233125 |
| 282 | Ga0307412_10067671 | 3300031911 | Bacteria | 2426 |
| 283 | Ga0307409_100051659 | 3300031995 | Bacteria | 3147 |
| 284 | Ga0307409_100077071 | 3300031995 | Bacteria | 2676 |
| 285 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 286 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 287 | Ga0307510_10001439 | 3300033180 | Bacteria | 26186 |
| 288 | Ga0307510_10027516 | 3300033180 | Bacteria | 6514 |
| 289 | Ga0373927_0070933 | 3300035695 | Bacteria | 2255 |
| 290 | Ga0395899_0000121 | 3300037312 | Bacteria | 125324 |
| 291 | Ga0395899_0000461 | 3300037312 | Bacteria | 46076 |
| 292 | Ga0395899_0001870 | 3300037312 | Bacteria | 17378 |
| 293 | Ga0395899_0124661 | 3300037312 | Bacteria | 1843 |
| 294 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 295 | Ga0395900_0000358 | 3300037418 | Bacteria | 66350 |
| 296 | Ga0395900_0084893 | 3300037418 | Bacteria | 3254 |
| 297 | Ga0395898_0070220 | 3300037466 | Bacteria | 3387 |
| 298 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 299 | Ga0395905_0001101 | 3300037471 | Bacteria | 33997 |
| 300 | Ga0395905_0005047 | 3300037471 | Bacteria | 13596 |
| 301 | Ga0395901_0000117 | 3300038443 | Bacteria | 105071 |
| 302 | Ga0395901_0075658 | 3300038443 | Bacteria | 3512 |
| 303 | Ga0436365_1030238 | 3300039437 | Bacteria | 41914 |
| 304 | Ga0436361_1054104 | 3300039447 | Bacteria | 8064 |
| 305 | Ga0439465_0018172 | 3300041413 | Bacteria | 2197 |
| 306 | Ga0439448_0016317 | 3300042005 | Bacteria | 2259 |
| 307 | Ga0439455_0023206 | 3300042012 | Bacteria | 1492 |
| 308 | Ga0439457_012683 | 3300042014 | Bacteria | 1898 |
| 309 | Ga0451577_0048588 | 3300042876 | Bacteria | 3790 |
| 310 | Ga0466972_0000015 | 3300044658 | Bacteria | 210687 |
| 311 | Ga0466972_0000950 | 3300044658 | Bacteria | 13952 |
| 312 | Ga0466972_0068407 | 3300044658 | Bacteria | 1696 |
| 313 | Ga0466961_0100195 | 3300044693 | Unclassified | 1825 |
| 314 | Ga0466964_0018977 | 3300044706 | Bacteria | 2642 |
| 315 | Ga0466971_0027990 | 3300044719 | Unclassified | 2523 |
| 316 | Ga0466957_0000015 | 3300044842 | Bacteria | 68333 |
| 317 | Ga0466957_0012253 | 3300044842 | Bacteria | 4963 |
| 318 | Ga0466957_0037334 | 3300044842 | Unclassified | 2925 |
| 319 | Ga0466959_0014760 | 3300045049 | Bacteria | 5686 |
| 320 | Ga0466958_0018279 | 3300045836 | Bacteria | 4067 |
| 321 | Ga0495638_0068247 | 3300046460 | Bacteria | 2181 |
| 322 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 323 | Ga0495585_0000448 | 3300046492 | Bacteria | 39402 |
| 324 | Ga0495585_0023273 | 3300046492 | Bacteria | 3555 |
| 325 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 326 | Ga0495606_0005009 | 3300046507 | Bacteria | 12914 |
| 327 | Ga0495606_0005602 | 3300046507 | Bacteria | 11940 |
| 328 | Ga0495606_0047678 | 3300046507 | Bacteria | 2823 |
| 329 | Ga0495610_0000151 | 3300046512 | Bacteria | 76854 |
| 330 | Ga0495610_0000334 | 3300046512 | Bacteria | 49810 |
| 331 | Ga0495610_0006882 | 3300046512 | Bacteria | 7703 |
| 332 | Ga0495616_0047442 | 3300046513 | Bacteria | 2163 |
| 333 | Ga0495631_0013832 | 3300046518 | Bacteria | 3908 |
| 334 | Ga0495632_0045362 | 3300046519 | Bacteria | 2190 |
| 335 | Ga0495644_0003932 | 3300046523 | Bacteria | 5848 |
| 336 | Ga0495648_0001850 | 3300046524 | Bacteria | 20297 |
| 337 | Ga0495648_0005656 | 3300046524 | Bacteria | 10344 |
| 338 | Ga0495609_0016585 | 3300046538 | Bacteria | 3431 |
| 339 | Ga0495622_0023249 | 3300046557 | Bacteria | 2890 |
| 340 | Ga0495633_0000177 | 3300046558 | Bacteria | 82953 |
| 341 | Ga0495668_0000207 | 3300046616 | Bacteria | 85136 |
| 342 | Ga0495668_0011638 | 3300046616 | Bacteria | 5261 |
| 343 | Ga0495611_0000761 | 3300046648 | Bacteria | 18065 |
| 344 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 345 | Ga0495625_0005804 | 3300046660 | Bacteria | 11149 |
| 346 | Ga0495625_0014987 | 3300046660 | Bacteria | 6159 |
| 347 | Ga0495625_0040978 | 3300046660 | Bacteria | 3373 |
| 348 | Ga0495661_0000579 | 3300046665 | Bacteria | 37896 |
| 349 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 350 | Ga0495649_0055515 | 3300046694 | Bacteria | 2140 |
| 351 | Ga0495687_000039 | 3300047443 | Bacteria | 245077 |
| 352 | Ga0495687_001584 | 3300047443 | Bacteria | 20599 |
| 353 | Ga0495687_001870 | 3300047443 | Bacteria | 18236 |
| 354 | Ga0495686_0000046 | 3300047472 | Bacteria | 281963 |
| 355 | Ga0495686_0000052 | 3300047472 | Bacteria | 262622 |
| 356 | Ga0495686_0006150 | 3300047472 | Bacteria | 9282 |
| 357 | Ga0495686_0032424 | 3300047472 | Bacteria | 3382 |
| 358 | Ga0495614_0014276 | 3300048089 | Bacteria | 3480 |
| 359 | Ga0496115_0018532 | 3300048918 | Bacteria | 5347 |
| 360 | Ga0496115_0085092 | 3300048918 | Bacteria | 2579 |
| 361 | Ga0496116_0021166 | 3300048919 | Bacteria | 4911 |
| 362 | Ga0496117_0013605 | 3300048920 | Bacteria | 7087 |
| 363 | Ga0496118_0069734 | 3300048921 | Bacteria | 2544 |
| 364 | Ga0496122_0008079 | 3300048925 | Bacteria | 11471 |
| 365 | Ga0496123_0042756 | 3300048926 | Bacteria | 3122 |
| 366 | Ga0501306_006170 | 3300049127 | Bacteria | 1398 |
| 367 | Ga0501319_000472 | 3300049535 | Bacteria | 1928 |
| 368 | Ga0501202_008465 | 3300049652 | Bacteria | 1875 |
| 369 | Ga0501202_008878 | 3300049652 | Bacteria | 1839 |
| 370 | Ga0501217_015247 | 3300049661 | Bacteria | 1747 |
| 371 | Ga0501242_000474 | 3300049674 | Bacteria | 3526 |
| 372 | Ga0501250_000127 | 3300049680 | Bacteria | 4152 |
| 373 | Ga0501257_003846 | 3300049686 | Bacteria | 3248 |
| 374 | Ga0501259_001527 | 3300049688 | Bacteria | 3855 |
| 375 | Ga0501225_0002275 | 3300049705 | Bacteria | 5938 |
| 376 | Ga0501225_0007151 | 3300049705 | Bacteria | 3240 |
| 377 | Ga0501225_0023413 | 3300049705 | Bacteria | 1701 |
| 378 | Ga0501245_005924 | 3300049708 | Bacteria | 1700 |
| 379 | Ga0501080_0062394 | 3300049742 | Bacteria | 3469 |
| 380 | Ga0501266_001073 | 3300049763 | Bacteria | 3525 |
| 381 | Ga0501268_002540 | 3300049765 | Bacteria | 2411 |
| 382 | Ga0501269_001294 | 3300049766 | Bacteria | 3344 |
| 383 | Ga0501270_001325 | 3300049767 | Bacteria | 2344 |
| 384 | nmdc:mga0k408_256_c2 | 3300050493 | Bacteria | 19110 |
| 385 | nmdc:mga0k408_7792_c1 | 3300050493 | Bacteria | 5726 |
| 386 | nmdc:mga0k408_884_c1 | 3300050493 | Bacteria | 16424 |
| 387 | Ga0500578_0098408 | 3300053086 | Bacteria | 1853 |
| 388 | Ga0500644_0000146 | 3300053088 | Bacteria | 44082 |
| 389 | Ga0500583_0000044 | 3300053092 | Bacteria | 81138 |
| 390 | Ga0500583_0000584 | 3300053092 | Bacteria | 10971 |
| 391 | Ga0500583_0003888 | 3300053092 | Bacteria | 4785 |
| 392 | Ga0500556_0004339 | 3300053104 | Bacteria | 4040 |
| 393 | Ga0500608_005054 | 3300053122 | Bacteria | 5187 |
| 394 | Ga0500618_000124 | 3300053125 | Bacteria | 63455 |
| 395 | Ga0500618_002701 | 3300053125 | Bacteria | 6480 |
| 396 | Ga0500642_0031322 | 3300053130 | Bacteria | 2221 |
| 397 | Ga0500652_075126 | 3300053131 | Bacteria | 1404 |
| 398 | Ga0500604_0003566 | 3300053151 | Bacteria | 4188 |
| 399 | Ga0500616_0001419 | 3300053153 | Bacteria | 23106 |
| 400 | Ga0500622_0000991 | 3300053156 | Bacteria | 23992 |
| 401 | Ga0500622_0002447 | 3300053156 | Bacteria | 13387 |
| 402 | Ga0500622_0009023 | 3300053156 | Bacteria | 5541 |
| 403 | Ga0500622_0083577 | 3300053156 | Bacteria | 1595 |
| 404 | Ga0500622_0095710 | 3300053156 | Bacteria | 1468 |
| 405 | Ga0500661_006301 | 3300055283 | Unclassified | 2209 |
| 406 | 2599478217 | 2599185184 | Bacteria | 6430550 |
| 407 | 2722727602 | 2721755487 | Bacteria | 6357185 |
| 408 | 2738730073 | 2738541278 | Bacteria | 9755573 |
| 409 | 2738855549 | 2738541302 | Bacteria | 5944758 |
| 410 | 2739300489 | 2738543023 | Bacteria | 6767879 |
| 411 | 2739589979 | 2739367651 | Bacteria | 6359826 |
| 412 | 2819548601 | 2818991437 | Bacteria | 5805520 |
| 413 | 2842722697 | 2842722452 | Bacteria | 6263924 |
| 414 | 2842905580 | 2842903701 | Bacteria | 6986368 |
| 415 | 2842913467 | 2842909656 | Bacteria | 6185908 |
| 416 | 2849283940 | 2849281842 | Bacteria | 6065644 |
| 417 | 2852623364 | 2852623160 | Bacteria | 4376875 |
| 418 | 2857630958 | 2857627736 | Bacteria | 5625397 |
| 419 | 2884937759 | 2884933994 | Bacteria | 4535041 |
| 420 | 2902049816 | 2902048731 | Bacteria | 4976191 |
| 421 | 2904781668 | 2904780799 | Bacteria | 5840761 |
| 422 | 2919177622 | 2919177583 | Bacteria | 5641607 |
| 423 | 2919438918 | 2919437846 | Bacteria | 6199444 |
| 424 | 2928080733 | 2928078545 | Bacteria | 6534839 |
| 425 | 2928150958 | 2928147474 | Bacteria | 6512076 |
| 426 | 2932082885 | 2932082852 | Bacteria | 6563563 |
| 427 | 2945999626 | 2945997725 | Bacteria | 6404843 |
| 428 | 2954016368 | 2954016120 | Bacteria | 6446024 |
| 429 | 2977236145 | 2977232053 | Bacteria | 5485925 |
| 430 | 8003014756 | 8003014200 | Bacteria | 4059994 |
| 431 | Ga0395900_0008366 | |||
| 432 | JGI24737J22298_10000110 | |||
| 433 | JGI24737J22298_10003483 | |||
| 434 | JGI24735J21928_10000004 | |||
| 435 | JGI25162J39368_1000017 | |||
| 436 | JGI25162J39368_1000342 | |||
| 437 | JGI25152J39213_1000067 | |||
| 438 | JGI25150J39212_1000001 | |||
| 439 | JGI25151J46595_10000005 | |||
| 440 | JGI25165J46597_1001336 | |||
| 441 | JGI25153J46596_10000040 | |||
| 442 | rootH1_10018005 | |||
| 443 | rootH2_10001334 | |||
| 444 | rootH2_10028071 | |||
| 445 | rootH2_10029493 | |||
| 446 | rootH2_10047367 | |||
| 447 | rootH2_10076352 | |||
| 448 | rootL2_10091047 | |||
| 449 | rootH1_10002464 | |||
| 450 | rootH1_10006939 | |||
| 451 | Ga0055536_1000049 | |||
| 452 | Ga0055530_10001497 | |||
| 453 | Ga0058863_11920111 | |||
| 454 | Ga0058862_12251515 | |||
| 455 | Ga0065165_1006758 | |||
| 456 | Ga0065714_10003376 | |||
| 457 | Ga0065714_10064453 | |||
| 458 | Ga0065714_10064880 | |||
| 459 | Ga0065714_10068070 | |||
| 460 | Ga0065714_10086150 | |||
| 461 | Ga0070658_10000019 | |||
| 462 | Ga0070658_10094675 | |||
| 463 | Ga0070658_10172543 | |||
| 464 | Ga0070676_10000038 | |||
| 465 | Ga0070676_10011160 | |||
| 466 | Ga0070683_100001459 | |||
| 467 | Ga0070683_100033104 | |||
| 468 | Ga0070666_10028643 | |||
| 469 | Ga0068868_100031929 | |||
| 470 | Ga0068868_100076913 | |||
| 471 | Ga0068868_100102624 | |||
| 472 | Ga0070660_100095447 | |||
| 473 | Ga0070691_10010073 | |||
| 474 | Ga0070673_100011398 | |||
| 475 | Ga0070659_100068355 | |||
| 476 | Ga0070659_100071202 | |||
| 477 | Ga0070663_100003783 | |||
| 478 | Ga0070662_100000464 | |||
| 479 | Ga0070681_10034844 | |||
| 480 | Ga0068867_100000255 | |||
| 481 | Ga0068867_100026605 | |||
| 482 | Ga0070685_10014905 | |||
| 483 | Ga0070684_100234458 | |||
| 484 | Ga0068853_100001443 | |||
| 485 | Ga0068853_100032860 | |||
| 486 | Ga0070693_100021034 | |||
| 487 | Ga0070665_100000003 | |||
| 488 | Ga0070665_100000074 | |||
| 489 | Ga0068855_100000073 | |||
| 490 | Ga0068855_100000086 | |||
| 491 | Ga0068855_100005249 | |||
| 492 | Ga0068855_100032255 | |||
| 493 | Ga0068855_100131442 | |||
| 494 | Ga0068857_100003719 | |||
| 495 | Ga0068857_100013211 | |||
| 496 | Ga0068854_100020154 | |||
| 497 | Ga0068856_100001137 | |||
| 498 | Ga0068856_100026426 | |||
| 499 | Ga0068856_100027517 | |||
| 500 | Ga0068856_100074592 | |||
| 501 | Ga0068856_100105588 | |||
| 502 | Ga0068852_100000937 | |||
| 503 | Ga0068852_100001089 | |||
| 504 | Ga0068852_100065146 | |||
| 505 | Ga0068852_100093285 | |||
| 506 | Ga0068851_10005158 | |||
| 507 | Ga0068860_100000110 | |||
| 508 | Ga0068860_100129222 | |||
| 509 | Ga0075366_10000577 | |||
| 510 | Ga0075366_10003825 | |||
| 511 | Ga0075366_10004460 | |||
| 512 | Ga0097621_100000241 | |||
| 513 | Ga0097621_100020810 | |||
| 514 | Ga0068871_100000499 | |||
| 515 | Ga0068871_100006779 | |||
| 516 | Ga0068865_100000022 | |||
| 517 | Ga0105244_10013507 | |||
| 518 | Ga0105240_10000010 | |||
| 519 | Ga0105240_10000253 | |||
| 520 | Ga0105240_10000418 | |||
| 521 | Ga0105240_10000448 | |||
| 522 | Ga0105240_10018127 | |||
| 523 | Ga0105240_10020548 | |||
| 524 | Ga0105240_10057496 | |||
| 525 | Ga0105240_10156171 | |||
| 526 | Ga0105240_10227633 | |||
| 527 | Ga0105241_10001498 | |||
| 528 | Ga0105241_10002955 | |||
| 529 | Ga0105241_10003853 | |||
| 530 | Ga0105241_10009914 | |||
| 531 | Ga0105237_10000065 | |||
| 532 | Ga0105237_10000137 | |||
| 533 | Ga0105237_10001288 | |||
| 534 | Ga0105237_10001855 | |||
| 535 | Ga0105237_10002699 | |||
| 536 | Ga0105237_10003021 | |||
| 537 | Ga0105237_10003749 | |||
| 538 | Ga0105237_10007138 | |||
| 539 | Ga0105237_10103258 | |||
| 540 | Ga0105237_10103812 | |||
| 541 | Ga0105238_10003185 | |||
| 542 | Ga0105238_10016846 | |||
| 543 | Ga0105238_10188094 | |||
| 544 | Ga0105239_10000005 | |||
| 545 | Ga0105239_10000042 | |||
| 546 | Ga0105239_10000079 | |||
| 547 | Ga0105239_10001594 | |||
| 548 | Ga0105239_10002289 | |||
| 549 | Ga0105239_10007964 | |||
| 550 | Ga0105239_10008882 | |||
| 551 | Ga0105239_10015875 | |||
| 552 | Ga0105239_10019439 | |||
| 553 | Ga0105239_10032740 | |||
| 554 | Ga0105239_10044904 | |||
| 555 | Ga0105239_10053336 | |||
| 556 | Ga0105239_10056437 | |||
| 557 | Ga0105239_10098630 | |||
| 558 | Ga0105239_10101063 | |||
| 559 | Ga0157373_10000223 | |||
| 560 | Ga0157373_10018449 | |||
| 561 | Ga0157371_10000051 | |||
| 562 | Ga0157371_10000622 | |||
| 563 | Ga0157371_10001433 | |||
| 564 | Ga0157371_10032101 | |||
| 565 | Ga0157370_10000695 | |||
| 566 | Ga0157370_10004105 | |||
| 567 | Ga0157370_10031278 | |||
| 568 | Ga0157370_10045526 | |||
| 569 | Ga0157370_10047374 | |||
| 570 | Ga0157370_10152094 | |||
| 571 | Ga0157369_10000033 | |||
| 572 | Ga0157369_10000165 | |||
| 573 | Ga0157369_10036312 | |||
| 574 | Ga0157369_10059614 | |||
| 575 | Ga0157369_10062176 | |||
| 576 | Ga0157374_10000003 | |||
| 577 | Ga0157374_10000130 | |||
| 578 | Ga0157374_10001204 | |||
| 579 | Ga0157374_10003721 | |||
| 580 | Ga0157378_10011920 | |||
| 581 | Ga0157378_10023601 | |||
| 582 | Ga0163162_10000064 | |||
| 583 | Ga0163162_10000453 | |||
| 584 | Ga0163162_10014886 | |||
| 585 | Ga0163162_10028857 | |||
| 586 | Ga0157372_10000021 | |||
| 587 | Ga0157372_10001064 | |||
| 588 | Ga0157372_10001219 | |||
| 589 | Ga0157372_10005160 | |||
| 590 | Ga0157372_10029773 | |||
| 591 | Ga0157372_10103085 | |||
| 592 | Ga0157372_10264678 | |||
| 593 | Ga0157372_10313843 | |||
| 594 | Ga0157375_10007870 | |||
| 595 | Ga0157375_10016311 | |||
| 596 | Ga0163163_10138888 | |||
| 597 | Ga0157377_10112178 | |||
| 598 | Ga0157376_10034937 | |||
| 599 | Ga0157376_10168474 | |||
| 600 | Ga0182006_1000168 | |||
| 601 | Ga0182006_1000353 | |||
| 602 | Ga0182007_10000015 | |||
| 603 | Ga0183373_1005 | |||
| 604 | Ga0163161_10000178 | |||
| 605 | Ga0163161_10000215 | |||
| 606 | Ga0163161_10000331 | |||
| 607 | Ga0206356_10180947 | |||
| 608 | Ga0206352_10142486 | |||
| 609 | Ga0213872_10013848 | |||
| 610 | Ga0213876_10000546 | |||
| 611 | Ga0224712_10053999 | |||
| 612 | Ga0209436_102713 | |||
| 613 | Ga0207427_100208 | |||
| 614 | Ga0209437_100024 | |||
| 615 | Ga0209437_100052 | |||
| 616 | Ga0207425_1000002 | |||
| 617 | Ga0209026_1000305 | |||
| 618 | Ga0209026_1002307 | |||
| 619 | Ga0209129_1000002 | |||
| 620 | Ga0209233_1000067 | |||
| 621 | Ga0209233_1002811 | |||
| 622 | Ga0209455_1002548 | |||
| 623 | Ga0209676_1000001 | |||
| 624 | Ga0209676_1003582 | |||
| 625 | Ga0209025_1000004 | |||
| 626 | Ga0209758_1000006 | |||
| 627 | Ga0209050_1000258 | |||
| 628 | Ga0207426_1015505 | |||
| 629 | Ga0207656_10018679 | |||
| 630 | Ga0207647_10000093 | |||
| 631 | Ga0207647_10000494 | |||
| 632 | Ga0207647_10049626 | |||
| 633 | Ga0207645_10000585 | |||
| 634 | Ga0207645_10027220 | |||
| 635 | Ga0207705_10000069 | |||
| 636 | Ga0207654_10002822 | |||
| 637 | Ga0207654_10006865 | |||
| 638 | Ga0207654_10009641 | |||
| 639 | Ga0207695_10000019 | |||
| 640 | Ga0207695_10000039 | |||
| 641 | Ga0207695_10000073 | |||
| 642 | Ga0207695_10000990 | |||
| 643 | Ga0207695_10002972 | |||
| 644 | Ga0207695_10021056 | |||
| 645 | Ga0207695_10036314 | |||
| 646 | Ga0207695_10052864 | |||
| 647 | Ga0207695_10103369 | |||
| 648 | Ga0207695_10181431 | |||
| 649 | Ga0207671_10000424 | |||
| 650 | Ga0207671_10000657 | |||
| 651 | Ga0207671_10001714 | |||
| 652 | Ga0207671_10003844 | |||
| 653 | Ga0207671_10004413 | |||
| 654 | Ga0207671_10004886 | |||
| 655 | Ga0207671_10006359 | |||
| 656 | Ga0207671_10029190 | |||
| 657 | Ga0207671_10029206 | |||
| 658 | Ga0207652_10012750 | |||
| 659 | Ga0207694_10002351 | |||
| 660 | Ga0207694_10006989 | |||
| 661 | Ga0207694_10084022 | |||
| 662 | Ga0207706_10000243 | |||
| 663 | Ga0207686_10017457 | |||
| 664 | Ga0207709_10000010 | |||
| 665 | Ga0207704_10000011 | |||
| 666 | Ga0207665_10061359 | |||
| 667 | Ga0207661_10022438 | |||
| 668 | Ga0207661_10027170 | |||
| 669 | Ga0207667_10000009 | |||
| 670 | Ga0207667_10000229 | |||
| 671 | Ga0207667_10001845 | |||
| 672 | Ga0207667_10006679 | |||
| 673 | Ga0207667_10063906 | |||
| 674 | Ga0207651_10023776 | |||
| 675 | Ga0207640_10024141 | |||
| 676 | Ga0207677_10020815 | |||
| 677 | Ga0207639_10008167 | |||
| 678 | Ga0207639_10011872 | |||
| 679 | Ga0207702_10004829 | |||
| 680 | Ga0207702_10130296 | |||
| 681 | Ga0207648_10001014 | |||
| 682 | Ga0207648_10046823 | |||
| 683 | Ga0207674_10000801 | |||
| 684 | Ga0207674_10036564 | |||
| 685 | Ga0207683_10008234 | |||
| 686 | Ga0207698_10001995 | |||
| 687 | Ga0207698_10215368 | |||
| 688 | Ga0268266_10000010 | |||
| 689 | Ga0268266_10000078 | |||
| 690 | Ga0268264_10000052 | |||
| 691 | Ga0268264_10022012 | |||
| 692 | Ga0268264_10088667 | |||
| 693 | Ga0268264_10281261 | |||
| 694 | Ga0307517_10004416 | |||
| 695 | Ga0307515_10000076 | |||
| 696 | Ga0307515_10001207 | |||
| 697 | Ga0307515_10001331 | |||
| 698 | Ga0307515_10001361 | |||
| 699 | Ga0265338_10029950 | |||
| 700 | Ga0307511_10000367 | |||
| 701 | Ga0316176_1031671 | |||
| 702 | Ga0316183_1007327 | |||
| 703 | Ga0265327_10015699 | |||
| 704 | Ga0307513_10090619 | |||
| 705 | Ga0265313_10023552 | |||
| 706 | Ga0307508_10001839 | |||
| 707 | Ga0307514_10055758 | |||
| 708 | Ga0316579_10020254 | |||
| 709 | Ga0307516_10001688 | |||
| 710 | Ga0307405_10000038 | |||
| 711 | Ga0307407_10000005 | |||
| 712 | Ga0307412_10067671 | |||
| 713 | Ga0307409_100051659 | |||
| 714 | Ga0307409_100077071 | |||
| 715 | Ga0307416_100000001 | |||
| 716 | Ga0307507_10000034 | |||
| 717 | Ga0307510_10001439 | |||
| 718 | Ga0307510_10027516 | |||
| 719 | Ga0373927_0070933 | |||
| 720 | Ga0395899_0000121 | |||
| 721 | Ga0395899_0000461 | |||
| 722 | Ga0395899_0001870 | |||
| 723 | Ga0395899_0124661 | |||
| 724 | Ga0395900_0000014 | |||
| 725 | Ga0395900_0000358 | |||
| 726 | Ga0395900_0084893 | |||
| 727 | Ga0395898_0070220 | |||
| 728 | Ga0395905_0000037 | |||
| 729 | Ga0395905_0001101 | |||
| 730 | Ga0395905_0005047 | |||
| 731 | Ga0395901_0000117 | |||
| 732 | Ga0395901_0075658 | |||
| 733 | Ga0436365_1030238 | |||
| 734 | Ga0436361_1054104 | |||
| 735 | Ga0439465_0018172 | |||
| 736 | Ga0439448_0016317 | |||
| 737 | Ga0439455_0023206 | |||
| 738 | Ga0439457_012683 | |||
| 739 | Ga0451577_0048588 | |||
| 740 | Ga0466972_0000015 | |||
| 741 | Ga0466972_0000950 | |||
| 742 | Ga0466972_0068407 | |||
| 743 | Ga0466961_0100195 | |||
| 744 | Ga0466964_0018977 | |||
| 745 | Ga0466971_0027990 | |||
| 746 | Ga0466957_0000015 | |||
| 747 | Ga0466957_0012253 | |||
| 748 | Ga0466957_0037334 | |||
| 749 | Ga0466959_0014760 | |||
| 750 | Ga0466958_0018279 | |||
| 751 | Ga0495638_0068247 | |||
| 752 | Ga0495650_0000087 | |||
| 753 | Ga0495585_0000448 | |||
| 754 | Ga0495585_0023273 | |||
| 755 | Ga0495606_0000052 | |||
| 756 | Ga0495606_0005009 | |||
| 757 | Ga0495606_0005602 | |||
| 758 | Ga0495606_0047678 | |||
| 759 | Ga0495610_0000151 | |||
| 760 | Ga0495610_0000334 | |||
| 761 | Ga0495610_0006882 | |||
| 762 | Ga0495616_0047442 | |||
| 763 | Ga0495631_0013832 | |||
| 764 | Ga0495632_0045362 | |||
| 765 | Ga0495644_0003932 | |||
| 766 | Ga0495648_0001850 | |||
| 767 | Ga0495648_0005656 | |||
| 768 | Ga0495609_0016585 | |||
| 769 | Ga0495622_0023249 | |||
| 770 | Ga0495633_0000177 | |||
| 771 | Ga0495668_0000207 | |||
| 772 | Ga0495668_0011638 | |||
| 773 | Ga0495611_0000761 | |||
| 774 | Ga0495625_0000008 | |||
| 775 | Ga0495625_0005804 | |||
| 776 | Ga0495625_0014987 | |||
| 777 | Ga0495625_0040978 | |||
| 778 | Ga0495661_0000579 | |||
| 779 | Ga0495649_0000018 | |||
| 780 | Ga0495649_0055515 | |||
| 781 | Ga0495687_000039 | |||
| 782 | Ga0495687_001584 | |||
| 783 | Ga0495687_001870 | |||
| 784 | Ga0495686_0000046 | |||
| 785 | Ga0495686_0000052 | |||
| 786 | Ga0495686_0006150 | |||
| 787 | Ga0495686_0032424 | |||
| 788 | Ga0495614_0014276 | |||
| 789 | Ga0496115_0018532 | |||
| 790 | Ga0496115_0085092 | |||
| 791 | Ga0496116_0021166 | |||
| 792 | Ga0496117_0013605 | |||
| 793 | Ga0496118_0069734 | |||
| 794 | Ga0496122_0008079 | |||
| 795 | Ga0496123_0042756 | |||
| 796 | Ga0501306_006170 | |||
| 797 | Ga0501319_000472 | |||
| 798 | Ga0501202_008465 | |||
| 799 | Ga0501202_008878 | |||
| 800 | Ga0501217_015247 | |||
| 801 | Ga0501242_000474 | |||
| 802 | Ga0501250_000127 | |||
| 803 | Ga0501257_003846 | |||
| 804 | Ga0501259_001527 | |||
| 805 | Ga0501225_0002275 | |||
| 806 | Ga0501225_0007151 | |||
| 807 | Ga0501225_0023413 | |||
| 808 | Ga0501245_005924 | |||
| 809 | Ga0501080_0062394 | |||
| 810 | Ga0501266_001073 | |||
| 811 | Ga0501268_002540 | |||
| 812 | Ga0501269_001294 | |||
| 813 | Ga0501270_001325 | |||
| 814 | nmdc:mga0k408_256_c2 | |||
| 815 | nmdc:mga0k408_7792_c1 | |||
| 816 | nmdc:mga0k408_884_c1 | |||
| 817 | Ga0500578_0098408 | |||
| 818 | Ga0500644_0000146 | |||
| 819 | Ga0500583_0000044 | |||
| 820 | Ga0500583_0000584 | |||
| 821 | Ga0500583_0003888 | |||
| 822 | Ga0500556_0004339 | |||
| 823 | Ga0500608_005054 | |||
| 824 | Ga0500618_000124 | |||
| 825 | Ga0500618_002701 | |||
| 826 | Ga0500642_0031322 | |||
| 827 | Ga0500652_075126 | |||
| 828 | Ga0500604_0003566 | |||
| 829 | Ga0500616_0001419 | |||
| 830 | Ga0500622_0000991 | |||
| 831 | Ga0500622_0002447 | |||
| 832 | Ga0500622_0009023 | |||
| 833 | Ga0500622_0083577 | |||
| 834 | Ga0500622_0095710 | |||
| 835 | Ga0500661_006301 | |||
| 836 | 2599478217 | |||
| 837 | 2722727602 | |||
| 838 | 2738730073 | |||
| 839 | 2738855549 | |||
| 840 | 2739300489 | |||
| 841 | 2739589979 | |||
| 842 | 2819548601 | |||
| 843 | 2842722697 | |||
| 844 | 2842905580 | |||
| 845 | 2842913467 | |||
| 846 | 2849283940 | |||
| 847 | 2852623364 | |||
| 848 | 2857630958 | |||
| 849 | 2884937759 | |||
| 850 | 2902049816 | |||
| 851 | 2904781668 | |||
| 852 | 2919177622 | |||
| 853 | 2919438918 | |||
| 854 | 2928080733 | |||
| 855 | 2928150958 | |||
| 856 | 2932082885 | |||
| 857 | 2945999626 | |||
| 858 | 2954016368 | |||
| 859 | 2977236145 | |||
| 860 | 8003014756 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nwr-assembly1.cif.gz_B | structure of bt1526, a myo-inositol-1-phosphate synthase | 0.9234 | 4 | 428 |
| 7nwr-assembly1.cif.gz_B | structure of bt1526, a myo-inositol-1-phosphate synthase | 0.9192 | 4 | 428 |
| 1p1j-assembly1.cif.gz_B | crystal structure of the 1l-myo-inositol 1-phosphate synthase complexed with nadh | 0.8695 | 11 | 432 |
| 1jki-assembly1.cif.gz_A | myo-inositol-1-phosphate synthase complexed with an inhibitor, 2-deoxy-glucitol-6-phosphate | 0.8635 | 11 | 428 |
| 1vko-assembly1.cif.gz_A | crystal structure of inositol-3-phosphate synthase (ce21227) from caenorhabditis elegans at 2.30 a resolution | 0.8496 | 5 | 437 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6NW00_41_265_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9446 | 71 | 259 | 3.40.50.720 |
| af_A4HW82_1_201_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9427 | 63 | 246 | 3.40.50.720 |
| af_Q4DFC2_1_344_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9209 | 9 | 277 | 3.40.50.720 |
| af_Q8I3Y8_28_377_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9067 | 9 | 288 | 3.40.50.720 |
| af_Q4DDJ2_1_218_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9007 | 9 | 154 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0HFW8-F1-model_v4 | Inositol-3-phosphate synthase | 0.9889 | 115 | 240 |
GO:0004512
GO:0006021 GO:0008654 |
| AF-A0A2V9H342-F1-model_v4 | Inositol-3-phosphate synthase | 0.9834 | 16 | 226 |
GO:0004512
GO:0006021 GO:0008654 |
| AF-A0A4Q3LR54-F1-model_v4 | deleted | 0.9819 | 1 | 244 |
|
| AF-A0A7W1R7H3-F1-model_v4 | Inositol-3-phosphate synthase | 0.9817 | 4 | 220 |
GO:0004512
GO:0006021 GO:0008654 |
| AF-A0A352VHW6-F1-model_v4 | Inositol-3-phosphate synthase | 0.9795 | 4 | 180 |
GO:0004512
GO:0006021 GO:0008654 |