F442227
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 207 | 860 | 394 |
Family's Representative Sequence
| Representative Sequence | 3300046809|Ga0495600_0119229|Ga0495600_0119229_50_1381 |
| Length | 443 |
| Sequence | MSSSTCCRAALCFVILGWAPIASILSATIEAIAEVVNAIALNRRMRYRLHDRFVAEIVLDNVSKVFSGGVVAVDGVSLTIESGEFLVLVGPSGCGKSTLLRMIAGLEEVTAGAISIGDADVTDLAPRSRDIAMVFQNYALYPHMTVRQNLGYGLKVRKTPKREIAQRVERAAQLLGLDELLDRRPGALSGGQRQRVAMGRAIVREPKAFLMDEPLSNLDAKLRVSMRAQLSALHARLATTTIYVTHDQIEAMTLGHRVAVMRDGRIQQVDTPQELYARPTNLYVAAFIGSPAMNLVEAEFEGGSLRFGGYAIPLPTGQTPPTGRVIAGIRPEAFEDDAFAEASLPRIAVNVEVVEELGADTHVLFSVAAPRVEASEVRAASGDEDTQLAAVEGSLFTARVDPGTSAKPGSRLQLAVDASRFHYFDAETGLRLEPDRALAALAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 33 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 45 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 70 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 71 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 72 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 73 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 74 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 75 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 76 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 77 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 78 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 79 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 81 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 82 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 83 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 85 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 86 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 88 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 89 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 91 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 92 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 93 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 95 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 96 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 97 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 100 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 101 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 102 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 106 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 107 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 108 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 109 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 110 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 165 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 204 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 207 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.3 |
| Metatranscriptomes | 0.47 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.47 |
| Nodule | 0.23 |
| Rhizoplane | 10 |
| Rhizosphere | 88.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495600_0119229 | 3300046809 | Bacteria | 1716 |
| 2 | JGI25406J46586_10001840 | 3300003203 | Bacteria | 9961 |
| 3 | Ga0070658_10003344 | 3300005327 | Bacteria | 13231 |
| 4 | Ga0070658_10016363 | 3300005327 | Bacteria | 5935 |
| 5 | Ga0070683_100006721 | 3300005329 | Bacteria | 9659 |
| 6 | Ga0070683_100060469 | 3300005329 | Bacteria | 3521 |
| 7 | Ga0070683_100230091 | 3300005329 | Bacteria | 1762 |
| 8 | Ga0070683_100340711 | 3300005329 | Bacteria | 1428 |
| 9 | Ga0070682_100002388 | 3300005337 | Bacteria | 10398 |
| 10 | Ga0068868_100106561 | 3300005338 | Bacteria | 2274 |
| 11 | Ga0070660_100061328 | 3300005339 | Bacteria | 2920 |
| 12 | Ga0070660_100114736 | 3300005339 | Bacteria | 2146 |
| 13 | Ga0070687_100104402 | 3300005343 | Bacteria | 1593 |
| 14 | Ga0070659_100057212 | 3300005366 | Bacteria | 3074 |
| 15 | Ga0070709_10039368 | 3300005434 | Bacteria | 2900 |
| 16 | Ga0070709_10041435 | 3300005434 | Bacteria | 2837 |
| 17 | Ga0070709_10070313 | 3300005434 | Bacteria | 2256 |
| 18 | Ga0070714_100086778 | 3300005435 | Bacteria | 2735 |
| 19 | Ga0070714_100144630 | 3300005435 | Bacteria | 2137 |
| 20 | Ga0070714_100250184 | 3300005435 | Bacteria | 1638 |
| 21 | Ga0070713_100047115 | 3300005436 | Bacteria | 3541 |
| 22 | Ga0070713_100216418 | 3300005436 | Bacteria | 1736 |
| 23 | Ga0070710_10009552 | 3300005437 | Bacteria | 4749 |
| 24 | Ga0070711_100116570 | 3300005439 | Bacteria | 1968 |
| 25 | Ga0070705_100086932 | 3300005440 | Bacteria | 1937 |
| 26 | Ga0070663_100036155 | 3300005455 | Bacteria | 3431 |
| 27 | Ga0070678_100007811 | 3300005456 | Bacteria | 6364 |
| 28 | Ga0070681_10007120 | 3300005458 | Bacteria | 10893 |
| 29 | Ga0070681_10009081 | 3300005458 | Bacteria | 9773 |
| 30 | Ga0070681_10145309 | 3300005458 | Bacteria | 2301 |
| 31 | Ga0070707_100003358 | 3300005468 | Bacteria | 15111 |
| 32 | Ga0070698_100018511 | 3300005471 | Bacteria | 7334 |
| 33 | Ga0070679_100148268 | 3300005530 | Bacteria | 2323 |
| 34 | Ga0070684_100008287 | 3300005535 | Bacteria | 8119 |
| 35 | Ga0070695_100000074 | 3300005545 | Bacteria | 40508 |
| 36 | Ga0070695_100041360 | 3300005545 | Bacteria | 2921 |
| 37 | Ga0068855_100135623 | 3300005563 | Bacteria | 2808 |
| 38 | Ga0068856_100156668 | 3300005614 | Bacteria | 2288 |
| 39 | Ga0081455_10001540 | 3300005937 | Bacteria | 28386 |
| 40 | Ga0081539_10000288 | 3300005985 | Bacteria | 113905 |
| 41 | Ga0070717_10002047 | 3300006028 | Bacteria | 14124 |
| 42 | Ga0075365_10066671 | 3300006038 | Bacteria | 2416 |
| 43 | Ga0070716_100022259 | 3300006173 | Bacteria | 3347 |
| 44 | Ga0070716_100042699 | 3300006173 | Bacteria | 2532 |
| 45 | Ga0070712_100006697 | 3300006175 | Bacteria | 7164 |
| 46 | Ga0070712_100102913 | 3300006175 | Bacteria | 2116 |
| 47 | Ga0075433_10060703 | 3300006852 | Bacteria | 3311 |
| 48 | Ga0075434_100014918 | 3300006871 | Bacteria | 7434 |
| 49 | Ga0075434_100016546 | 3300006871 | Bacteria | 7091 |
| 50 | Ga0075436_100002474 | 3300006914 | Bacteria | 12715 |
| 51 | Ga0075435_100030475 | 3300007076 | Bacteria | 4242 |
| 52 | Ga0105245_10014324 | 3300009098 | Bacteria | 6909 |
| 53 | Ga0114129_10353004 | 3300009147 | Bacteria | 1947 |
| 54 | Ga0105243_10069487 | 3300009148 | Bacteria | 2841 |
| 55 | Ga0105249_10118685 | 3300009553 | Bacteria | 2511 |
| 56 | Ga0157369_10269320 | 3300013105 | Bacteria | 1775 |
| 57 | Ga0157374_10107364 | 3300013296 | Bacteria | 2683 |
| 58 | Ga0157374_10189447 | 3300013296 | Bacteria | 2012 |
| 59 | Ga0157374_10234290 | 3300013296 | Bacteria | 1804 |
| 60 | Ga0163162_10126967 | 3300013306 | Bacteria | 2657 |
| 61 | Ga0157372_10156812 | 3300013307 | Bacteria | 2630 |
| 62 | Ga0157372_10395629 | 3300013307 | Bacteria | 1610 |
| 63 | Ga0182008_10020470 | 3300014497 | Bacteria | 3406 |
| 64 | Ga0206356_10491546 | 3300020070 | Bacteria | 1653 |
| 65 | Ga0206353_10027309 | 3300020082 | Bacteria | 5577 |
| 66 | Ga0207692_10035412 | 3300025898 | Bacteria | 2425 |
| 67 | Ga0207692_10076695 | 3300025898 | Bacteria | 1776 |
| 68 | Ga0207688_10037088 | 3300025901 | Bacteria | 2703 |
| 69 | Ga0207699_10043162 | 3300025906 | Bacteria | 2618 |
| 70 | Ga0207699_10080030 | 3300025906 | Bacteria | 2023 |
| 71 | Ga0207645_10114627 | 3300025907 | Bacteria | 1746 |
| 72 | Ga0207705_10052887 | 3300025909 | Bacteria | 2925 |
| 73 | Ga0207695_10055316 | 3300025913 | Bacteria | 4136 |
| 74 | Ga0207695_10166193 | 3300025913 | Bacteria | 2135 |
| 75 | Ga0207693_10003726 | 3300025915 | Bacteria | 12990 |
| 76 | Ga0207693_10005566 | 3300025915 | Bacteria | 10480 |
| 77 | Ga0207693_10022282 | 3300025915 | Bacteria | 5034 |
| 78 | Ga0207663_10008683 | 3300025916 | Bacteria | 5331 |
| 79 | Ga0207657_10003380 | 3300025919 | Bacteria | 17064 |
| 80 | Ga0207657_10039520 | 3300025919 | Bacteria | 4191 |
| 81 | Ga0207657_10040289 | 3300025919 | Bacteria | 4141 |
| 82 | Ga0207652_10060206 | 3300025921 | Bacteria | 3276 |
| 83 | Ga0207646_10000936 | 3300025922 | Bacteria | 37493 |
| 84 | Ga0207646_10120705 | 3300025922 | Bacteria | 2355 |
| 85 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 86 | Ga0207664_10010242 | 3300025929 | Bacteria | 6621 |
| 87 | Ga0207664_10058133 | 3300025929 | Bacteria | 3076 |
| 88 | Ga0207690_10253855 | 3300025932 | Bacteria | 1359 |
| 89 | Ga0207709_10057162 | 3300025935 | Bacteria | 2418 |
| 90 | Ga0207665_10000230 | 3300025939 | Bacteria | 38061 |
| 91 | Ga0207661_10001542 | 3300025944 | Bacteria | 15663 |
| 92 | Ga0207661_10026856 | 3300025944 | Bacteria | 4392 |
| 93 | Ga0207661_10079732 | 3300025944 | Bacteria | 2699 |
| 94 | Ga0207651_10147690 | 3300025960 | Bacteria | 1826 |
| 95 | Ga0207678_10060063 | 3300026067 | Bacteria | 3270 |
| 96 | Ga0207702_10061960 | 3300026078 | Bacteria | 3192 |
| 97 | Ga0207702_10124464 | 3300026078 | Bacteria | 2312 |
| 98 | Ga0207641_10164099 | 3300026088 | Bacteria | 2022 |
| 99 | Ga0207683_10005880 | 3300026121 | Bacteria | 10521 |
| 100 | Ga0207683_10010861 | 3300026121 | Bacteria | 7766 |
| 101 | Ga0265336_10001660 | 3300028666 | Bacteria | 9836 |
| 102 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 103 | Ga0265338_10003587 | 3300028800 | Bacteria | 21674 |
| 104 | Ga0265327_10004631 | 3300031251 | Bacteria | 12068 |
| 105 | Ga0307513_10000717 | 3300031456 | Bacteria | 47556 |
| 106 | Ga0307416_100011409 | 3300032002 | Bacteria | 5925 |
| 107 | Ga0373948_0005507 | 3300034817 | Bacteria | 2057 |
| 108 | Ga0373958_0001534 | 3300034819 | Bacteria | 3117 |
| 109 | Ga0373938_0002109 | 3300034957 | Bacteria | 3200 |
| 110 | Ga0373928_0001522 | 3300035084 | Bacteria | 4506 |
| 111 | Ga0373940_0012859 | 3300035088 | Bacteria | 2012 |
| 112 | Ga0373951_0006803 | 3300035091 | Bacteria | 2611 |
| 113 | Ga0373952_0012697 | 3300035092 | Bacteria | 1661 |
| 114 | Ga0373941_0001207 | 3300035115 | Bacteria | 5410 |
| 115 | Ga0373945_0011195 | 3300035116 | Bacteria | 2963 |
| 116 | Ga0373954_0054315 | 3300035118 | Bacteria | 1884 |
| 117 | Ga0373943_0001155 | 3300035170 | Bacteria | 11791 |
| 118 | Ga0373946_0008282 | 3300035171 | Bacteria | 3816 |
| 119 | Ga0373946_0037304 | 3300035171 | Bacteria | 1974 |
| 120 | Ga0373962_0005245 | 3300035242 | Bacteria | 3133 |
| 121 | Ga0373931_0004018 | 3300035691 | Bacteria | 6663 |
| 122 | Ga0373931_0030389 | 3300035691 | Bacteria | 2781 |
| 123 | Ga0373935_0062985 | 3300035692 | Bacteria | 2376 |
| 124 | Ga0373935_0156346 | 3300035692 | Bacteria | 1551 |
| 125 | Ga0373927_0022806 | 3300035695 | Bacteria | 4100 |
| 126 | Ga0373947_0000358 | 3300035725 | Bacteria | 25937 |
| 127 | Ga0373947_0008453 | 3300035725 | Bacteria | 5932 |
| 128 | Ga0373937_0000364 | 3300036401 | Bacteria | 42155 |
| 129 | Ga0373925_0009039 | 3300037068 | Bacteria | 7253 |
| 130 | Ga0373925_0109210 | 3300037068 | Bacteria | 2135 |
| 131 | Ga0373925_0294404 | 3300037068 | Bacteria | 1309 |
| 132 | Ga0395899_0057720 | 3300037312 | Bacteria | 2864 |
| 133 | Ga0395900_0067563 | 3300037418 | Bacteria | 3672 |
| 134 | Ga0395900_0067788 | 3300037418 | Bacteria | 3666 |
| 135 | Ga0395898_0056694 | 3300037466 | Bacteria | 3819 |
| 136 | Ga0395898_0198633 | 3300037466 | Bacteria | 1915 |
| 137 | Ga0395898_0212358 | 3300037466 | Bacteria | 1846 |
| 138 | Ga0395898_0242695 | 3300037466 | Bacteria | 1718 |
| 139 | Ga0395905_0031148 | 3300037471 | Bacteria | 5022 |
| 140 | Ga0395901_0048911 | 3300038443 | Bacteria | 4391 |
| 141 | Ga0395901_0076608 | 3300038443 | Bacteria | 3489 |
| 142 | Ga0395901_0168902 | 3300038443 | Bacteria | 2295 |
| 143 | Ga0436360_1310220 | 3300039438 | Bacteria | 9054 |
| 144 | Ga0439462_0020094 | 3300042015 | Bacteria | 1741 |
| 145 | Ga0439446_0031846 | 3300042156 | Bacteria | 1527 |
| 146 | Ga0439434_0005935 | 3300042435 | Bacteria | 3566 |
| 147 | Ga0466969_0002616 | 3300044656 | Bacteria | 9633 |
| 148 | Ga0466969_0010463 | 3300044656 | Bacteria | 4917 |
| 149 | Ga0466966_0001789 | 3300044684 | Bacteria | 13940 |
| 150 | Ga0466966_0009182 | 3300044684 | Bacteria | 6546 |
| 151 | Ga0466966_0021152 | 3300044684 | Bacteria | 4272 |
| 152 | Ga0466966_0026672 | 3300044684 | Bacteria | 3771 |
| 153 | Ga0466966_0037508 | 3300044684 | Bacteria | 3125 |
| 154 | Ga0466961_0002650 | 3300044693 | Bacteria | 11103 |
| 155 | Ga0466961_0038267 | 3300044693 | Bacteria | 3076 |
| 156 | Ga0466961_0059779 | 3300044693 | Bacteria | 2423 |
| 157 | Ga0466963_0000046 | 3300044694 | Bacteria | 40452 |
| 158 | Ga0466963_0000441 | 3300044694 | Bacteria | 19205 |
| 159 | Ga0466963_0005765 | 3300044694 | Bacteria | 7282 |
| 160 | Ga0466963_0017805 | 3300044694 | Bacteria | 4433 |
| 161 | Ga0466963_0035121 | 3300044694 | Bacteria | 3265 |
| 162 | Ga0466963_0036561 | 3300044694 | Bacteria | 3203 |
| 163 | Ga0466963_0037417 | 3300044694 | Bacteria | 3168 |
| 164 | Ga0466963_0051688 | 3300044694 | Bacteria | 2724 |
| 165 | Ga0466963_0064642 | 3300044694 | Bacteria | 2451 |
| 166 | Ga0466963_0067125 | 3300044694 | Bacteria | 2406 |
| 167 | Ga0466963_0077825 | 3300044694 | Bacteria | 2241 |
| 168 | Ga0466963_0082010 | 3300044694 | Bacteria | 2185 |
| 169 | Ga0466964_0003167 | 3300044706 | Bacteria | 5977 |
| 170 | Ga0466964_0020856 | 3300044706 | Bacteria | 2527 |
| 171 | Ga0466964_0029754 | 3300044706 | Bacteria | 2158 |
| 172 | Ga0466964_0061892 | 3300044706 | Bacteria | 1559 |
| 173 | Ga0466964_0075341 | 3300044706 | Bacteria | 1436 |
| 174 | Ga0466971_0001393 | 3300044719 | Bacteria | 10146 |
| 175 | Ga0466971_0004418 | 3300044719 | Bacteria | 6068 |
| 176 | Ga0466971_0017706 | 3300044719 | Bacteria | 3154 |
| 177 | Ga0466968_0003196 | 3300044735 | Bacteria | 6044 |
| 178 | Ga0466968_0004624 | 3300044735 | Bacteria | 5147 |
| 179 | Ga0466968_0008392 | 3300044735 | Bacteria | 3954 |
| 180 | Ga0466970_0004799 | 3300044765 | Bacteria | 6676 |
| 181 | Ga0466970_0028025 | 3300044765 | Bacteria | 2959 |
| 182 | Ga0466957_0001177 | 3300044842 | Bacteria | 13587 |
| 183 | Ga0466957_0002541 | 3300044842 | Bacteria | 9818 |
| 184 | Ga0466957_0005722 | 3300044842 | Bacteria | 6990 |
| 185 | Ga0466957_0008856 | 3300044842 | Bacteria | 5731 |
| 186 | Ga0466957_0010231 | 3300044842 | Bacteria | 5374 |
| 187 | Ga0466957_0039908 | 3300044842 | Bacteria | 2833 |
| 188 | Ga0466957_0058809 | 3300044842 | Bacteria | 2355 |
| 189 | Ga0466957_0083504 | 3300044842 | Bacteria | 1993 |
| 190 | Ga0466957_0115678 | 3300044842 | Bacteria | 1705 |
| 191 | Ga0466960_0011618 | 3300044901 | Bacteria | 3692 |
| 192 | Ga0466960_0042682 | 3300044901 | Bacteria | 2154 |
| 193 | Ga0466959_0001490 | 3300045049 | Bacteria | 14375 |
| 194 | Ga0466959_0005274 | 3300045049 | Bacteria | 8830 |
| 195 | Ga0466959_0016428 | 3300045049 | Bacteria | 5408 |
| 196 | Ga0466959_0023513 | 3300045049 | Bacteria | 4560 |
| 197 | Ga0466958_0000140 | 3300045836 | Bacteria | 24688 |
| 198 | Ga0466958_0000412 | 3300045836 | Bacteria | 17617 |
| 199 | Ga0466958_0006211 | 3300045836 | Bacteria | 6484 |
| 200 | Ga0466958_0023354 | 3300045836 | Bacteria | 3629 |
| 201 | Ga0466958_0080630 | 3300045836 | Bacteria | 2002 |
| 202 | Ga0466958_0119748 | 3300045836 | Bacteria | 1647 |
| 203 | Ga0466967_0000270 | 3300045976 | Bacteria | 22873 |
| 204 | Ga0466967_0001844 | 3300045976 | Bacteria | 12752 |
| 205 | Ga0466967_0018823 | 3300045976 | Bacteria | 5534 |
| 206 | Ga0466967_0024209 | 3300045976 | Bacteria | 4988 |
| 207 | Ga0466967_0033961 | 3300045976 | Bacteria | 4323 |
| 208 | Ga0466967_0037619 | 3300045976 | Bacteria | 4143 |
| 209 | Ga0466967_0044524 | 3300045976 | Bacteria | 3850 |
| 210 | Ga0466967_0059806 | 3300045976 | Bacteria | 3374 |
| 211 | Ga0466967_0072775 | 3300045976 | Bacteria | 3081 |
| 212 | Ga0466967_0108174 | 3300045976 | Bacteria | 2551 |
| 213 | Ga0466967_0122485 | 3300045976 | Bacteria | 2405 |
| 214 | Ga0466967_0158831 | 3300045976 | Bacteria | 2120 |
| 215 | Ga0466967_0229194 | 3300045976 | Bacteria | 1768 |
| 216 | Ga0495592_0000050 | 3300046454 | Bacteria | 111971 |
| 217 | Ga0495592_0005364 | 3300046454 | Bacteria | 9464 |
| 218 | Ga0495592_0124745 | 3300046454 | Bacteria | 1808 |
| 219 | Ga0495603_0120752 | 3300046455 | Bacteria | 1527 |
| 220 | Ga0495629_0000769 | 3300046459 | Bacteria | 25883 |
| 221 | Ga0495629_0212862 | 3300046459 | Bacteria | 1334 |
| 222 | Ga0495641_0005449 | 3300046461 | Bacteria | 8598 |
| 223 | Ga0495641_0006387 | 3300046461 | Bacteria | 7650 |
| 224 | Ga0495641_0026485 | 3300046461 | Bacteria | 2828 |
| 225 | Ga0495641_0036390 | 3300046461 | Bacteria | 2313 |
| 226 | Ga0495641_0074956 | 3300046461 | Bacteria | 1517 |
| 227 | Ga0495651_0000004 | 3300046462 | Bacteria | 177080 |
| 228 | Ga0495651_0005047 | 3300046462 | Bacteria | 10081 |
| 229 | Ga0495651_0031384 | 3300046462 | Bacteria | 4143 |
| 230 | Ga0495651_0059464 | 3300046462 | Bacteria | 2930 |
| 231 | Ga0495651_0082704 | 3300046462 | Bacteria | 2422 |
| 232 | Ga0495653_0002246 | 3300046463 | Bacteria | 15275 |
| 233 | Ga0495653_0019331 | 3300046463 | Bacteria | 5525 |
| 234 | Ga0495653_0021994 | 3300046463 | Bacteria | 5160 |
| 235 | Ga0495653_0066511 | 3300046463 | Bacteria | 2711 |
| 236 | Ga0495653_0136435 | 3300046463 | Bacteria | 1730 |
| 237 | Ga0495580_0021128 | 3300046472 | Bacteria | 4806 |
| 238 | Ga0495580_0109251 | 3300046472 | Bacteria | 1920 |
| 239 | Ga0495582_0000498 | 3300046473 | Bacteria | 21485 |
| 240 | Ga0495639_0002465 | 3300046475 | Bacteria | 8084 |
| 241 | Ga0495639_0004267 | 3300046475 | Bacteria | 6133 |
| 242 | Ga0495662_0011652 | 3300046476 | Bacteria | 4297 |
| 243 | Ga0495664_0026918 | 3300046477 | Bacteria | 3351 |
| 244 | Ga0495664_0035050 | 3300046477 | Bacteria | 2954 |
| 245 | Ga0495608_0008439 | 3300046511 | Bacteria | 7218 |
| 246 | Ga0495608_0014661 | 3300046511 | Bacteria | 5438 |
| 247 | Ga0495618_0002772 | 3300046514 | Bacteria | 11140 |
| 248 | Ga0495618_0131313 | 3300046514 | Bacteria | 1603 |
| 249 | Ga0495628_0001466 | 3300046516 | Bacteria | 21651 |
| 250 | Ga0495628_0016703 | 3300046516 | Bacteria | 6119 |
| 251 | Ga0495628_0129532 | 3300046516 | Bacteria | 1931 |
| 252 | Ga0495628_0159875 | 3300046516 | Bacteria | 1712 |
| 253 | Ga0495630_0049913 | 3300046517 | Bacteria | 3131 |
| 254 | Ga0495630_0059760 | 3300046517 | Bacteria | 2860 |
| 255 | Ga0495630_0077336 | 3300046517 | Bacteria | 2509 |
| 256 | Ga0495630_0119886 | 3300046517 | Bacteria | 1996 |
| 257 | Ga0495666_0024495 | 3300046526 | Bacteria | 2981 |
| 258 | Ga0495652_0000047 | 3300046529 | Bacteria | 121525 |
| 259 | Ga0495652_0030346 | 3300046529 | Bacteria | 4742 |
| 260 | Ga0495652_0039032 | 3300046529 | Bacteria | 4107 |
| 261 | Ga0495652_0117451 | 3300046529 | Bacteria | 2128 |
| 262 | Ga0495652_0133586 | 3300046529 | Bacteria | 1961 |
| 263 | Ga0495665_0002657 | 3300046531 | Bacteria | 9648 |
| 264 | Ga0495665_0008402 | 3300046531 | Bacteria | 5599 |
| 265 | Ga0495640_0035199 | 3300046533 | Bacteria | 3544 |
| 266 | Ga0495640_0049367 | 3300046533 | Bacteria | 2902 |
| 267 | Ga0495640_0073135 | 3300046533 | Bacteria | 2295 |
| 268 | Ga0495587_0000103 | 3300046536 | Bacteria | 64471 |
| 269 | Ga0495587_0013870 | 3300046536 | Bacteria | 5060 |
| 270 | Ga0495587_0060200 | 3300046536 | Bacteria | 2227 |
| 271 | Ga0495587_0073440 | 3300046536 | Bacteria | 1987 |
| 272 | Ga0495645_0000028 | 3300046543 | Bacteria | 113461 |
| 273 | Ga0495645_0032826 | 3300046543 | Bacteria | 3787 |
| 274 | Ga0495645_0042967 | 3300046543 | Bacteria | 3296 |
| 275 | Ga0495645_0073000 | 3300046543 | Bacteria | 2472 |
| 276 | Ga0495667_0016060 | 3300046559 | Bacteria | 5060 |
| 277 | Ga0495667_0050358 | 3300046559 | Bacteria | 2750 |
| 278 | Ga0495634_0014160 | 3300046642 | Bacteria | 5755 |
| 279 | Ga0495634_0039094 | 3300046642 | Bacteria | 3232 |
| 280 | Ga0495634_0133123 | 3300046642 | Bacteria | 1583 |
| 281 | Ga0495635_0031034 | 3300046663 | Bacteria | 3712 |
| 282 | Ga0495635_0037686 | 3300046663 | Bacteria | 3347 |
| 283 | Ga0495635_0110871 | 3300046663 | Bacteria | 1874 |
| 284 | Ga0495659_0038290 | 3300046664 | Bacteria | 1702 |
| 285 | Ga0495657_0038366 | 3300046675 | Bacteria | 3297 |
| 286 | Ga0495657_0040475 | 3300046675 | Bacteria | 3196 |
| 287 | Ga0495657_0042940 | 3300046675 | Bacteria | 3084 |
| 288 | Ga0495657_0045564 | 3300046675 | Bacteria | 2976 |
| 289 | Ga0495599_0000059 | 3300046678 | Bacteria | 75747 |
| 290 | Ga0495599_0031161 | 3300046678 | Bacteria | 3347 |
| 291 | Ga0495599_0064959 | 3300046678 | Bacteria | 2280 |
| 292 | Ga0495623_0000082 | 3300046679 | Bacteria | 56315 |
| 293 | Ga0495623_0025141 | 3300046679 | Bacteria | 3836 |
| 294 | Ga0495646_0001107 | 3300046680 | Bacteria | 15705 |
| 295 | Ga0495647_0000192 | 3300046681 | Bacteria | 16221 |
| 296 | Ga0495647_0036507 | 3300046681 | Bacteria | 1850 |
| 297 | Ga0495658_0002701 | 3300046683 | Bacteria | 8938 |
| 298 | Ga0495658_0002845 | 3300046683 | Bacteria | 8693 |
| 299 | Ga0495613_0002655 | 3300046689 | Bacteria | 13431 |
| 300 | Ga0495613_0016666 | 3300046689 | Bacteria | 5470 |
| 301 | Ga0495613_0093266 | 3300046689 | Bacteria | 2180 |
| 302 | Ga0495624_0008998 | 3300046690 | Bacteria | 6941 |
| 303 | Ga0495624_0009930 | 3300046690 | Bacteria | 6578 |
| 304 | Ga0495624_0057683 | 3300046690 | Bacteria | 2441 |
| 305 | Ga0495624_0112719 | 3300046690 | Bacteria | 1672 |
| 306 | Ga0495624_0119473 | 3300046690 | Bacteria | 1619 |
| 307 | Ga0495600_0025456 | 3300046809 | Bacteria | 3814 |
| 308 | Ga0495600_0083188 | 3300046809 | Bacteria | 2089 |
| 309 | Ga0495600_0115618 | 3300046809 | Bacteria | 1746 |
| 310 | Ga0495581_0001176 | 3300047315 | Bacteria | 14348 |
| 311 | Ga0495581_0011276 | 3300047315 | Bacteria | 5168 |
| 312 | Ga0495581_0041542 | 3300047315 | Bacteria | 2662 |
| 313 | Ga0495604_0000489 | 3300047317 | Bacteria | 34803 |
| 314 | Ga0495604_0041906 | 3300047317 | Bacteria | 3589 |
| 315 | Ga0495604_0088088 | 3300047317 | Bacteria | 2310 |
| 316 | Ga0495674_0012179 | 3300047319 | Bacteria | 8106 |
| 317 | Ga0495674_0028314 | 3300047319 | Bacteria | 5111 |
| 318 | Ga0495674_0039151 | 3300047319 | Bacteria | 4250 |
| 319 | Ga0495674_0285842 | 3300047319 | Bacteria | 1350 |
| 320 | Ga0495676_0002838 | 3300047321 | Bacteria | 15613 |
| 321 | Ga0495676_0037166 | 3300047321 | Bacteria | 4056 |
| 322 | Ga0495680_0002258 | 3300047322 | Bacteria | 19853 |
| 323 | Ga0495680_0003274 | 3300047322 | Bacteria | 16061 |
| 324 | Ga0495680_0008086 | 3300047322 | Bacteria | 9590 |
| 325 | Ga0495680_0051388 | 3300047322 | Bacteria | 3218 |
| 326 | Ga0495680_0080563 | 3300047322 | Bacteria | 2460 |
| 327 | Ga0495680_0084333 | 3300047322 | Bacteria | 2394 |
| 328 | Ga0495675_0000020 | 3300047444 | Bacteria | 111526 |
| 329 | Ga0495675_0069454 | 3300047444 | Bacteria | 2225 |
| 330 | Ga0495684_0020390 | 3300047471 | Bacteria | 5108 |
| 331 | Ga0495684_0020392 | 3300047471 | Bacteria | 5108 |
| 332 | Ga0495684_0072988 | 3300047471 | Bacteria | 2607 |
| 333 | Ga0495686_0000296 | 3300047472 | Bacteria | 86346 |
| 334 | Ga0495593_0003732 | 3300047673 | Bacteria | 9084 |
| 335 | Ga0495602_0002220 | 3300048088 | Bacteria | 19610 |
| 336 | Ga0495602_0097739 | 3300048088 | Bacteria | 2418 |
| 337 | Ga0495614_0004160 | 3300048089 | Bacteria | 6516 |
| 338 | Ga0495614_0013201 | 3300048089 | Bacteria | 3624 |
| 339 | Ga0496101_0010442 | 3300048904 | Bacteria | 6133 |
| 340 | Ga0496101_0092490 | 3300048904 | Bacteria | 2252 |
| 341 | Ga0496101_0259765 | 3300048904 | Bacteria | 1354 |
| 342 | Ga0496102_0020008 | 3300048905 | Bacteria | 5905 |
| 343 | Ga0496103_0003882 | 3300048906 | Bacteria | 9093 |
| 344 | Ga0496103_0005371 | 3300048906 | Bacteria | 7674 |
| 345 | Ga0496103_0044108 | 3300048906 | Bacteria | 2747 |
| 346 | Ga0496103_0076015 | 3300048906 | Bacteria | 2107 |
| 347 | Ga0496104_0015777 | 3300048907 | Bacteria | 6851 |
| 348 | Ga0496104_0031673 | 3300048907 | Bacteria | 4918 |
| 349 | Ga0496104_0039283 | 3300048907 | Bacteria | 4431 |
| 350 | Ga0496104_0082456 | 3300048907 | Bacteria | 3066 |
| 351 | Ga0496104_0172216 | 3300048907 | Bacteria | 2075 |
| 352 | Ga0496104_0198049 | 3300048907 | Bacteria | 1920 |
| 353 | Ga0496104_0200670 | 3300048907 | Bacteria | 1907 |
| 354 | Ga0496105_0007136 | 3300048908 | Bacteria | 8618 |
| 355 | Ga0496105_0031343 | 3300048908 | Bacteria | 4358 |
| 356 | Ga0496105_0102171 | 3300048908 | Bacteria | 2367 |
| 357 | Ga0496106_0144532 | 3300048909 | Bacteria | 1873 |
| 358 | Ga0496106_0149531 | 3300048909 | Bacteria | 1841 |
| 359 | Ga0496107_0031826 | 3300048910 | Bacteria | 3766 |
| 360 | Ga0496107_0050490 | 3300048910 | Bacteria | 2998 |
| 361 | Ga0496108_0008971 | 3300048911 | Bacteria | 8106 |
| 362 | Ga0496108_0020213 | 3300048911 | Bacteria | 5472 |
| 363 | Ga0496109_0008668 | 3300048912 | Bacteria | 8655 |
| 364 | Ga0496109_0018578 | 3300048912 | Bacteria | 6108 |
| 365 | Ga0496109_0091554 | 3300048912 | Bacteria | 2812 |
| 366 | Ga0496110_0009470 | 3300048913 | Bacteria | 7887 |
| 367 | Ga0496110_0115767 | 3300048913 | Bacteria | 2413 |
| 368 | Ga0496110_0298842 | 3300048913 | Bacteria | 1466 |
| 369 | Ga0496111_0000576 | 3300048914 | Bacteria | 19160 |
| 370 | Ga0496111_0025136 | 3300048914 | Bacteria | 4200 |
| 371 | Ga0496112_0126214 | 3300048915 | Bacteria | 2529 |
| 372 | Ga0496113_0030173 | 3300048916 | Bacteria | 3922 |
| 373 | Ga0496113_0041413 | 3300048916 | Bacteria | 3399 |
| 374 | Ga0496113_0136371 | 3300048916 | Bacteria | 1928 |
| 375 | Ga0496114_0019365 | 3300048917 | Bacteria | 5515 |
| 376 | Ga0496114_0076025 | 3300048917 | Bacteria | 2829 |
| 377 | Ga0496114_0144038 | 3300048917 | Bacteria | 2065 |
| 378 | Ga0496114_0205877 | 3300048917 | Bacteria | 1724 |
| 379 | Ga0496115_0016896 | 3300048918 | Bacteria | 5565 |
| 380 | Ga0496115_0023517 | 3300048918 | Bacteria | 4781 |
| 381 | Ga0496115_0136294 | 3300048918 | Bacteria | 2024 |
| 382 | Ga0501036_0050111 | 3300049572 | Bacteria | 3536 |
| 383 | Ga0501038_0063587 | 3300049574 | Bacteria | 3149 |
| 384 | Ga0501041_0128823 | 3300049577 | Bacteria | 1576 |
| 385 | Ga0501046_0029351 | 3300049580 | Bacteria | 4471 |
| 386 | Ga0501047_0026084 | 3300049581 | Bacteria | 5620 |
| 387 | Ga0501048_0047337 | 3300049582 | Bacteria | 3068 |
| 388 | Ga0501067_0024238 | 3300049583 | Bacteria | 3365 |
| 389 | Ga0501067_0029270 | 3300049583 | Bacteria | 3052 |
| 390 | Ga0501068_0041224 | 3300049584 | Bacteria | 2774 |
| 391 | Ga0501069_0076042 | 3300049585 | Bacteria | 1887 |
| 392 | Ga0501070_0046302 | 3300049586 | Bacteria | 3617 |
| 393 | Ga0501071_0005257 | 3300049587 | Bacteria | 8300 |
| 394 | Ga0501072_0051623 | 3300049588 | Bacteria | 3237 |
| 395 | Ga0501074_0022248 | 3300049590 | Bacteria | 4607 |
| 396 | Ga0501074_0036133 | 3300049590 | Bacteria | 3579 |
| 397 | Ga0501075_0048504 | 3300049591 | Bacteria | 3191 |
| 398 | Ga0501076_0027758 | 3300049592 | Bacteria | 4390 |
| 399 | Ga0501076_0094008 | 3300049592 | Bacteria | 2413 |
| 400 | Ga0501076_0161520 | 3300049592 | Bacteria | 1825 |
| 401 | Ga0501077_0051916 | 3300049593 | Bacteria | 2604 |
| 402 | Ga0501079_0022037 | 3300049741 | Bacteria | 4881 |
| 403 | Ga0501080_0134282 | 3300049742 | Bacteria | 2290 |
| 404 | Ga0501045_0039468 | 3300049824 | Bacteria | 3435 |
| 405 | nmdc:mga05p37_375946_c1 | 3300050507 | Bacteria | 1666 |
| 406 | nmdc:mga0n895_12912_c1 | 3300050512 | Bacteria | 7508 |
| 407 | nmdc:mga0rr50_86802_c1 | 3300050513 | Bacteria | 2428 |
| 408 | nmdc:mga08x19_20640_c1 | 3300050514 | Bacteria | 4057 |
| 409 | nmdc:mga0a205_13652_c1 | 3300050515 | Bacteria | 7567 |
| 410 | nmdc:mga0a205_138854_c1 | 3300050515 | Bacteria | 2331 |
| 411 | Ga0495601_0001606 | 3300053077 | Bacteria | 12464 |
| 412 | Ga0495601_0044400 | 3300053077 | Bacteria | 2794 |
| 413 | Ga0495601_0059965 | 3300053077 | Bacteria | 2413 |
| 414 | Ga0495601_0113434 | 3300053077 | Bacteria | 1756 |
| 415 | Ga0495612_0006098 | 3300053078 | Bacteria | 4960 |
| 416 | Ga0495612_0053620 | 3300053078 | Bacteria | 1660 |
| 417 | Ga0495595_0026660 | 3300053084 | Bacteria | 2569 |
| 418 | Ga0495595_0037748 | 3300053084 | Bacteria | 2198 |
| 419 | Ga0495619_0003277 | 3300053085 | Bacteria | 10468 |
| 420 | Ga0495619_0004352 | 3300053085 | Bacteria | 9034 |
| 421 | Ga0495619_0006577 | 3300053085 | Bacteria | 7351 |
| 422 | Ga0495619_0027737 | 3300053085 | Bacteria | 3651 |
| 423 | Ga0495619_0075377 | 3300053085 | Bacteria | 2264 |
| 424 | Ga0495619_0130856 | 3300053085 | Bacteria | 1724 |
| 425 | Ga0500636_0171106 | 3300053177 | Bacteria | 1175 |
| 426 | Ga0501084_0006342 | 3300054114 | Bacteria | 9718 |
| 427 | Ga0501082_0019239 | 3300060353 | Bacteria | 5886 |
| 428 | Ga0466962_0003048 | 3300061719 | Bacteria | 7989 |
| 429 | Ga0466962_0042633 | 3300061719 | Bacteria | 2172 |
| 430 | 8024489049 | 8024486573 | Bacteria | 6540512 |
| 431 | Ga0495600_0119229 | |||
| 432 | JGI25406J46586_10001840 | |||
| 433 | Ga0070658_10003344 | |||
| 434 | Ga0070658_10016363 | |||
| 435 | Ga0070683_100006721 | |||
| 436 | Ga0070683_100060469 | |||
| 437 | Ga0070683_100230091 | |||
| 438 | Ga0070683_100340711 | |||
| 439 | Ga0070682_100002388 | |||
| 440 | Ga0068868_100106561 | |||
| 441 | Ga0070660_100061328 | |||
| 442 | Ga0070660_100114736 | |||
| 443 | Ga0070687_100104402 | |||
| 444 | Ga0070659_100057212 | |||
| 445 | Ga0070709_10039368 | |||
| 446 | Ga0070709_10041435 | |||
| 447 | Ga0070709_10070313 | |||
| 448 | Ga0070714_100086778 | |||
| 449 | Ga0070714_100144630 | |||
| 450 | Ga0070714_100250184 | |||
| 451 | Ga0070713_100047115 | |||
| 452 | Ga0070713_100216418 | |||
| 453 | Ga0070710_10009552 | |||
| 454 | Ga0070711_100116570 | |||
| 455 | Ga0070705_100086932 | |||
| 456 | Ga0070663_100036155 | |||
| 457 | Ga0070678_100007811 | |||
| 458 | Ga0070681_10007120 | |||
| 459 | Ga0070681_10009081 | |||
| 460 | Ga0070681_10145309 | |||
| 461 | Ga0070707_100003358 | |||
| 462 | Ga0070698_100018511 | |||
| 463 | Ga0070679_100148268 | |||
| 464 | Ga0070684_100008287 | |||
| 465 | Ga0070695_100000074 | |||
| 466 | Ga0070695_100041360 | |||
| 467 | Ga0068855_100135623 | |||
| 468 | Ga0068856_100156668 | |||
| 469 | Ga0081455_10001540 | |||
| 470 | Ga0081539_10000288 | |||
| 471 | Ga0070717_10002047 | |||
| 472 | Ga0075365_10066671 | |||
| 473 | Ga0070716_100022259 | |||
| 474 | Ga0070716_100042699 | |||
| 475 | Ga0070712_100006697 | |||
| 476 | Ga0070712_100102913 | |||
| 477 | Ga0075433_10060703 | |||
| 478 | Ga0075434_100014918 | |||
| 479 | Ga0075434_100016546 | |||
| 480 | Ga0075436_100002474 | |||
| 481 | Ga0075435_100030475 | |||
| 482 | Ga0105245_10014324 | |||
| 483 | Ga0114129_10353004 | |||
| 484 | Ga0105243_10069487 | |||
| 485 | Ga0105249_10118685 | |||
| 486 | Ga0157369_10269320 | |||
| 487 | Ga0157374_10107364 | |||
| 488 | Ga0157374_10189447 | |||
| 489 | Ga0157374_10234290 | |||
| 490 | Ga0163162_10126967 | |||
| 491 | Ga0157372_10156812 | |||
| 492 | Ga0157372_10395629 | |||
| 493 | Ga0182008_10020470 | |||
| 494 | Ga0206356_10491546 | |||
| 495 | Ga0206353_10027309 | |||
| 496 | Ga0207692_10035412 | |||
| 497 | Ga0207692_10076695 | |||
| 498 | Ga0207688_10037088 | |||
| 499 | Ga0207699_10043162 | |||
| 500 | Ga0207699_10080030 | |||
| 501 | Ga0207645_10114627 | |||
| 502 | Ga0207705_10052887 | |||
| 503 | Ga0207695_10055316 | |||
| 504 | Ga0207695_10166193 | |||
| 505 | Ga0207693_10003726 | |||
| 506 | Ga0207693_10005566 | |||
| 507 | Ga0207693_10022282 | |||
| 508 | Ga0207663_10008683 | |||
| 509 | Ga0207657_10003380 | |||
| 510 | Ga0207657_10039520 | |||
| 511 | Ga0207657_10040289 | |||
| 512 | Ga0207652_10060206 | |||
| 513 | Ga0207646_10000936 | |||
| 514 | Ga0207646_10120705 | |||
| 515 | Ga0207700_10000004 | |||
| 516 | Ga0207664_10010242 | |||
| 517 | Ga0207664_10058133 | |||
| 518 | Ga0207690_10253855 | |||
| 519 | Ga0207709_10057162 | |||
| 520 | Ga0207665_10000230 | |||
| 521 | Ga0207661_10001542 | |||
| 522 | Ga0207661_10026856 | |||
| 523 | Ga0207661_10079732 | |||
| 524 | Ga0207651_10147690 | |||
| 525 | Ga0207678_10060063 | |||
| 526 | Ga0207702_10061960 | |||
| 527 | Ga0207702_10124464 | |||
| 528 | Ga0207641_10164099 | |||
| 529 | Ga0207683_10005880 | |||
| 530 | Ga0207683_10010861 | |||
| 531 | Ga0265336_10001660 | |||
| 532 | Ga0307515_10000017 | |||
| 533 | Ga0265338_10003587 | |||
| 534 | Ga0265327_10004631 | |||
| 535 | Ga0307513_10000717 | |||
| 536 | Ga0307416_100011409 | |||
| 537 | Ga0373948_0005507 | |||
| 538 | Ga0373958_0001534 | |||
| 539 | Ga0373938_0002109 | |||
| 540 | Ga0373928_0001522 | |||
| 541 | Ga0373940_0012859 | |||
| 542 | Ga0373951_0006803 | |||
| 543 | Ga0373952_0012697 | |||
| 544 | Ga0373941_0001207 | |||
| 545 | Ga0373945_0011195 | |||
| 546 | Ga0373954_0054315 | |||
| 547 | Ga0373943_0001155 | |||
| 548 | Ga0373946_0008282 | |||
| 549 | Ga0373946_0037304 | |||
| 550 | Ga0373962_0005245 | |||
| 551 | Ga0373931_0004018 | |||
| 552 | Ga0373931_0030389 | |||
| 553 | Ga0373935_0062985 | |||
| 554 | Ga0373935_0156346 | |||
| 555 | Ga0373927_0022806 | |||
| 556 | Ga0373947_0000358 | |||
| 557 | Ga0373947_0008453 | |||
| 558 | Ga0373937_0000364 | |||
| 559 | Ga0373925_0009039 | |||
| 560 | Ga0373925_0109210 | |||
| 561 | Ga0373925_0294404 | |||
| 562 | Ga0395899_0057720 | |||
| 563 | Ga0395900_0067563 | |||
| 564 | Ga0395900_0067788 | |||
| 565 | Ga0395898_0056694 | |||
| 566 | Ga0395898_0198633 | |||
| 567 | Ga0395898_0212358 | |||
| 568 | Ga0395898_0242695 | |||
| 569 | Ga0395905_0031148 | |||
| 570 | Ga0395901_0048911 | |||
| 571 | Ga0395901_0076608 | |||
| 572 | Ga0395901_0168902 | |||
| 573 | Ga0436360_1310220 | |||
| 574 | Ga0439462_0020094 | |||
| 575 | Ga0439446_0031846 | |||
| 576 | Ga0439434_0005935 | |||
| 577 | Ga0466969_0002616 | |||
| 578 | Ga0466969_0010463 | |||
| 579 | Ga0466966_0001789 | |||
| 580 | Ga0466966_0009182 | |||
| 581 | Ga0466966_0021152 | |||
| 582 | Ga0466966_0026672 | |||
| 583 | Ga0466966_0037508 | |||
| 584 | Ga0466961_0002650 | |||
| 585 | Ga0466961_0038267 | |||
| 586 | Ga0466961_0059779 | |||
| 587 | Ga0466963_0000046 | |||
| 588 | Ga0466963_0000441 | |||
| 589 | Ga0466963_0005765 | |||
| 590 | Ga0466963_0017805 | |||
| 591 | Ga0466963_0035121 | |||
| 592 | Ga0466963_0036561 | |||
| 593 | Ga0466963_0037417 | |||
| 594 | Ga0466963_0051688 | |||
| 595 | Ga0466963_0064642 | |||
| 596 | Ga0466963_0067125 | |||
| 597 | Ga0466963_0077825 | |||
| 598 | Ga0466963_0082010 | |||
| 599 | Ga0466964_0003167 | |||
| 600 | Ga0466964_0020856 | |||
| 601 | Ga0466964_0029754 | |||
| 602 | Ga0466964_0061892 | |||
| 603 | Ga0466964_0075341 | |||
| 604 | Ga0466971_0001393 | |||
| 605 | Ga0466971_0004418 | |||
| 606 | Ga0466971_0017706 | |||
| 607 | Ga0466968_0003196 | |||
| 608 | Ga0466968_0004624 | |||
| 609 | Ga0466968_0008392 | |||
| 610 | Ga0466970_0004799 | |||
| 611 | Ga0466970_0028025 | |||
| 612 | Ga0466957_0001177 | |||
| 613 | Ga0466957_0002541 | |||
| 614 | Ga0466957_0005722 | |||
| 615 | Ga0466957_0008856 | |||
| 616 | Ga0466957_0010231 | |||
| 617 | Ga0466957_0039908 | |||
| 618 | Ga0466957_0058809 | |||
| 619 | Ga0466957_0083504 | |||
| 620 | Ga0466957_0115678 | |||
| 621 | Ga0466960_0011618 | |||
| 622 | Ga0466960_0042682 | |||
| 623 | Ga0466959_0001490 | |||
| 624 | Ga0466959_0005274 | |||
| 625 | Ga0466959_0016428 | |||
| 626 | Ga0466959_0023513 | |||
| 627 | Ga0466958_0000140 | |||
| 628 | Ga0466958_0000412 | |||
| 629 | Ga0466958_0006211 | |||
| 630 | Ga0466958_0023354 | |||
| 631 | Ga0466958_0080630 | |||
| 632 | Ga0466958_0119748 | |||
| 633 | Ga0466967_0000270 | |||
| 634 | Ga0466967_0001844 | |||
| 635 | Ga0466967_0018823 | |||
| 636 | Ga0466967_0024209 | |||
| 637 | Ga0466967_0033961 | |||
| 638 | Ga0466967_0037619 | |||
| 639 | Ga0466967_0044524 | |||
| 640 | Ga0466967_0059806 | |||
| 641 | Ga0466967_0072775 | |||
| 642 | Ga0466967_0108174 | |||
| 643 | Ga0466967_0122485 | |||
| 644 | Ga0466967_0158831 | |||
| 645 | Ga0466967_0229194 | |||
| 646 | Ga0495592_0000050 | |||
| 647 | Ga0495592_0005364 | |||
| 648 | Ga0495592_0124745 | |||
| 649 | Ga0495603_0120752 | |||
| 650 | Ga0495629_0000769 | |||
| 651 | Ga0495629_0212862 | |||
| 652 | Ga0495641_0005449 | |||
| 653 | Ga0495641_0006387 | |||
| 654 | Ga0495641_0026485 | |||
| 655 | Ga0495641_0036390 | |||
| 656 | Ga0495641_0074956 | |||
| 657 | Ga0495651_0000004 | |||
| 658 | Ga0495651_0005047 | |||
| 659 | Ga0495651_0031384 | |||
| 660 | Ga0495651_0059464 | |||
| 661 | Ga0495651_0082704 | |||
| 662 | Ga0495653_0002246 | |||
| 663 | Ga0495653_0019331 | |||
| 664 | Ga0495653_0021994 | |||
| 665 | Ga0495653_0066511 | |||
| 666 | Ga0495653_0136435 | |||
| 667 | Ga0495580_0021128 | |||
| 668 | Ga0495580_0109251 | |||
| 669 | Ga0495582_0000498 | |||
| 670 | Ga0495639_0002465 | |||
| 671 | Ga0495639_0004267 | |||
| 672 | Ga0495662_0011652 | |||
| 673 | Ga0495664_0026918 | |||
| 674 | Ga0495664_0035050 | |||
| 675 | Ga0495608_0008439 | |||
| 676 | Ga0495608_0014661 | |||
| 677 | Ga0495618_0002772 | |||
| 678 | Ga0495618_0131313 | |||
| 679 | Ga0495628_0001466 | |||
| 680 | Ga0495628_0016703 | |||
| 681 | Ga0495628_0129532 | |||
| 682 | Ga0495628_0159875 | |||
| 683 | Ga0495630_0049913 | |||
| 684 | Ga0495630_0059760 | |||
| 685 | Ga0495630_0077336 | |||
| 686 | Ga0495630_0119886 | |||
| 687 | Ga0495666_0024495 | |||
| 688 | Ga0495652_0000047 | |||
| 689 | Ga0495652_0030346 | |||
| 690 | Ga0495652_0039032 | |||
| 691 | Ga0495652_0117451 | |||
| 692 | Ga0495652_0133586 | |||
| 693 | Ga0495665_0002657 | |||
| 694 | Ga0495665_0008402 | |||
| 695 | Ga0495640_0035199 | |||
| 696 | Ga0495640_0049367 | |||
| 697 | Ga0495640_0073135 | |||
| 698 | Ga0495587_0000103 | |||
| 699 | Ga0495587_0013870 | |||
| 700 | Ga0495587_0060200 | |||
| 701 | Ga0495587_0073440 | |||
| 702 | Ga0495645_0000028 | |||
| 703 | Ga0495645_0032826 | |||
| 704 | Ga0495645_0042967 | |||
| 705 | Ga0495645_0073000 | |||
| 706 | Ga0495667_0016060 | |||
| 707 | Ga0495667_0050358 | |||
| 708 | Ga0495634_0014160 | |||
| 709 | Ga0495634_0039094 | |||
| 710 | Ga0495634_0133123 | |||
| 711 | Ga0495635_0031034 | |||
| 712 | Ga0495635_0037686 | |||
| 713 | Ga0495635_0110871 | |||
| 714 | Ga0495659_0038290 | |||
| 715 | Ga0495657_0038366 | |||
| 716 | Ga0495657_0040475 | |||
| 717 | Ga0495657_0042940 | |||
| 718 | Ga0495657_0045564 | |||
| 719 | Ga0495599_0000059 | |||
| 720 | Ga0495599_0031161 | |||
| 721 | Ga0495599_0064959 | |||
| 722 | Ga0495623_0000082 | |||
| 723 | Ga0495623_0025141 | |||
| 724 | Ga0495646_0001107 | |||
| 725 | Ga0495647_0000192 | |||
| 726 | Ga0495647_0036507 | |||
| 727 | Ga0495658_0002701 | |||
| 728 | Ga0495658_0002845 | |||
| 729 | Ga0495613_0002655 | |||
| 730 | Ga0495613_0016666 | |||
| 731 | Ga0495613_0093266 | |||
| 732 | Ga0495624_0008998 | |||
| 733 | Ga0495624_0009930 | |||
| 734 | Ga0495624_0057683 | |||
| 735 | Ga0495624_0112719 | |||
| 736 | Ga0495624_0119473 | |||
| 737 | Ga0495600_0025456 | |||
| 738 | Ga0495600_0083188 | |||
| 739 | Ga0495600_0115618 | |||
| 740 | Ga0495581_0001176 | |||
| 741 | Ga0495581_0011276 | |||
| 742 | Ga0495581_0041542 | |||
| 743 | Ga0495604_0000489 | |||
| 744 | Ga0495604_0041906 | |||
| 745 | Ga0495604_0088088 | |||
| 746 | Ga0495674_0012179 | |||
| 747 | Ga0495674_0028314 | |||
| 748 | Ga0495674_0039151 | |||
| 749 | Ga0495674_0285842 | |||
| 750 | Ga0495676_0002838 | |||
| 751 | Ga0495676_0037166 | |||
| 752 | Ga0495680_0002258 | |||
| 753 | Ga0495680_0003274 | |||
| 754 | Ga0495680_0008086 | |||
| 755 | Ga0495680_0051388 | |||
| 756 | Ga0495680_0080563 | |||
| 757 | Ga0495680_0084333 | |||
| 758 | Ga0495675_0000020 | |||
| 759 | Ga0495675_0069454 | |||
| 760 | Ga0495684_0020390 | |||
| 761 | Ga0495684_0020392 | |||
| 762 | Ga0495684_0072988 | |||
| 763 | Ga0495686_0000296 | |||
| 764 | Ga0495593_0003732 | |||
| 765 | Ga0495602_0002220 | |||
| 766 | Ga0495602_0097739 | |||
| 767 | Ga0495614_0004160 | |||
| 768 | Ga0495614_0013201 | |||
| 769 | Ga0496101_0010442 | |||
| 770 | Ga0496101_0092490 | |||
| 771 | Ga0496101_0259765 | |||
| 772 | Ga0496102_0020008 | |||
| 773 | Ga0496103_0003882 | |||
| 774 | Ga0496103_0005371 | |||
| 775 | Ga0496103_0044108 | |||
| 776 | Ga0496103_0076015 | |||
| 777 | Ga0496104_0015777 | |||
| 778 | Ga0496104_0031673 | |||
| 779 | Ga0496104_0039283 | |||
| 780 | Ga0496104_0082456 | |||
| 781 | Ga0496104_0172216 | |||
| 782 | Ga0496104_0198049 | |||
| 783 | Ga0496104_0200670 | |||
| 784 | Ga0496105_0007136 | |||
| 785 | Ga0496105_0031343 | |||
| 786 | Ga0496105_0102171 | |||
| 787 | Ga0496106_0144532 | |||
| 788 | Ga0496106_0149531 | |||
| 789 | Ga0496107_0031826 | |||
| 790 | Ga0496107_0050490 | |||
| 791 | Ga0496108_0008971 | |||
| 792 | Ga0496108_0020213 | |||
| 793 | Ga0496109_0008668 | |||
| 794 | Ga0496109_0018578 | |||
| 795 | Ga0496109_0091554 | |||
| 796 | Ga0496110_0009470 | |||
| 797 | Ga0496110_0115767 | |||
| 798 | Ga0496110_0298842 | |||
| 799 | Ga0496111_0000576 | |||
| 800 | Ga0496111_0025136 | |||
| 801 | Ga0496112_0126214 | |||
| 802 | Ga0496113_0030173 | |||
| 803 | Ga0496113_0041413 | |||
| 804 | Ga0496113_0136371 | |||
| 805 | Ga0496114_0019365 | |||
| 806 | Ga0496114_0076025 | |||
| 807 | Ga0496114_0144038 | |||
| 808 | Ga0496114_0205877 | |||
| 809 | Ga0496115_0016896 | |||
| 810 | Ga0496115_0023517 | |||
| 811 | Ga0496115_0136294 | |||
| 812 | Ga0501036_0050111 | |||
| 813 | Ga0501038_0063587 | |||
| 814 | Ga0501041_0128823 | |||
| 815 | Ga0501046_0029351 | |||
| 816 | Ga0501047_0026084 | |||
| 817 | Ga0501048_0047337 | |||
| 818 | Ga0501067_0024238 | |||
| 819 | Ga0501067_0029270 | |||
| 820 | Ga0501068_0041224 | |||
| 821 | Ga0501069_0076042 | |||
| 822 | Ga0501070_0046302 | |||
| 823 | Ga0501071_0005257 | |||
| 824 | Ga0501072_0051623 | |||
| 825 | Ga0501074_0022248 | |||
| 826 | Ga0501074_0036133 | |||
| 827 | Ga0501075_0048504 | |||
| 828 | Ga0501076_0027758 | |||
| 829 | Ga0501076_0094008 | |||
| 830 | Ga0501076_0161520 | |||
| 831 | Ga0501077_0051916 | |||
| 832 | Ga0501079_0022037 | |||
| 833 | Ga0501080_0134282 | |||
| 834 | Ga0501045_0039468 | |||
| 835 | nmdc:mga05p37_375946_c1 | |||
| 836 | nmdc:mga0n895_12912_c1 | |||
| 837 | nmdc:mga0rr50_86802_c1 | |||
| 838 | nmdc:mga08x19_20640_c1 | |||
| 839 | nmdc:mga0a205_13652_c1 | |||
| 840 | nmdc:mga0a205_138854_c1 | |||
| 841 | Ga0495601_0001606 | |||
| 842 | Ga0495601_0044400 | |||
| 843 | Ga0495601_0059965 | |||
| 844 | Ga0495601_0113434 | |||
| 845 | Ga0495612_0006098 | |||
| 846 | Ga0495612_0053620 | |||
| 847 | Ga0495595_0026660 | |||
| 848 | Ga0495595_0037748 | |||
| 849 | Ga0495619_0003277 | |||
| 850 | Ga0495619_0004352 | |||
| 851 | Ga0495619_0006577 | |||
| 852 | Ga0495619_0027737 | |||
| 853 | Ga0495619_0075377 | |||
| 854 | Ga0495619_0130856 | |||
| 855 | Ga0500636_0171106 | |||
| 856 | Ga0501084_0006342 | |||
| 857 | Ga0501082_0019239 | |||
| 858 | Ga0466962_0003048 | |||
| 859 | Ga0466962_0042633 | |||
| 860 | 8024489049 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9512 | 4 | 234 |
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.9476 | 4 | 214 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9381 | 4 | 219 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.938 | 1 | 218 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9379 | 4 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.99 | 3 | 217 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9762 | 3 | 217 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9668 | 1 | 218 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 4 | 236 | 3.40.50.300 |
| af_Q47538_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.966 | 4 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9984 | 1 | 222 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A5J4F8B2-F1-model_v4 | Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) | 0.9869 | 1 | 243 |
GO:0005524
GO:0015419 GO:0016887 GO:0043190 |
| AF-A0A534HSD0-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9832 | 4 | 220 |
GO:0005524
GO:0016887 |
| AF-A0A7J3BDG1-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9808 | 1 | 226 |
GO:0005524
GO:0016887 |
| AF-A0A7J3BDG1-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9765 | 1 | 226 |
GO:0005524
GO:0016887 |