F442227

General Info

Members Datasets Scaffolds Average Seq Length
430 207 860 394

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0119229|Ga0495600_0119229_50_1381
Length 443
Sequence MSSSTCCRAALCFVILGWAPIASILSATIEAIAEVVNAIALNRRMRYRLHDRFVAEIVLDNVSKVFSGGVVAVDGVSLTIESGEFLVLVGPSGCGKSTLLRMIAGLEEVTAGAISIGDADVTDLAPRSRDIAMVFQNYALYPHMTVRQNLGYGLKVRKTPKREIAQRVERAAQLLGLDELLDRRPGALSGGQRQRVAMGRAIVREPKAFLMDEPLSNLDAKLRVSMRAQLSALHARLATTTIYVTHDQIEAMTLGHRVAVMRDGRIQQVDTPQELYARPTNLYVAAFIGSPAMNLVEAEFEGGSLRFGGYAIPLPTGQTPPTGRVIAGIRPEAFEDDAFAEASLPRIAVNVEVVEELGADTHVLFSVAAPRVEASEVRAASGDEDTQLAAVEGSLFTARVDPGTSAKPGSRLQLAVDASRFHYFDAETGLRLEPDRALAALAN

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
76 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
77 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
78 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
82 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.47
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0.23
Rhizoplane 10
Rhizosphere 88.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0119229 3300046809 Bacteria 1716
2 JGI25406J46586_10001840 3300003203 Bacteria 9961
3 Ga0070658_10003344 3300005327 Bacteria 13231
4 Ga0070658_10016363 3300005327 Bacteria 5935
5 Ga0070683_100006721 3300005329 Bacteria 9659
6 Ga0070683_100060469 3300005329 Bacteria 3521
7 Ga0070683_100230091 3300005329 Bacteria 1762
8 Ga0070683_100340711 3300005329 Bacteria 1428
9 Ga0070682_100002388 3300005337 Bacteria 10398
10 Ga0068868_100106561 3300005338 Bacteria 2274
11 Ga0070660_100061328 3300005339 Bacteria 2920
12 Ga0070660_100114736 3300005339 Bacteria 2146
13 Ga0070687_100104402 3300005343 Bacteria 1593
14 Ga0070659_100057212 3300005366 Bacteria 3074
15 Ga0070709_10039368 3300005434 Bacteria 2900
16 Ga0070709_10041435 3300005434 Bacteria 2837
17 Ga0070709_10070313 3300005434 Bacteria 2256
18 Ga0070714_100086778 3300005435 Bacteria 2735
19 Ga0070714_100144630 3300005435 Bacteria 2137
20 Ga0070714_100250184 3300005435 Bacteria 1638
21 Ga0070713_100047115 3300005436 Bacteria 3541
22 Ga0070713_100216418 3300005436 Bacteria 1736
23 Ga0070710_10009552 3300005437 Bacteria 4749
24 Ga0070711_100116570 3300005439 Bacteria 1968
25 Ga0070705_100086932 3300005440 Bacteria 1937
26 Ga0070663_100036155 3300005455 Bacteria 3431
27 Ga0070678_100007811 3300005456 Bacteria 6364
28 Ga0070681_10007120 3300005458 Bacteria 10893
29 Ga0070681_10009081 3300005458 Bacteria 9773
30 Ga0070681_10145309 3300005458 Bacteria 2301
31 Ga0070707_100003358 3300005468 Bacteria 15111
32 Ga0070698_100018511 3300005471 Bacteria 7334
33 Ga0070679_100148268 3300005530 Bacteria 2323
34 Ga0070684_100008287 3300005535 Bacteria 8119
35 Ga0070695_100000074 3300005545 Bacteria 40508
36 Ga0070695_100041360 3300005545 Bacteria 2921
37 Ga0068855_100135623 3300005563 Bacteria 2808
38 Ga0068856_100156668 3300005614 Bacteria 2288
39 Ga0081455_10001540 3300005937 Bacteria 28386
40 Ga0081539_10000288 3300005985 Bacteria 113905
41 Ga0070717_10002047 3300006028 Bacteria 14124
42 Ga0075365_10066671 3300006038 Bacteria 2416
43 Ga0070716_100022259 3300006173 Bacteria 3347
44 Ga0070716_100042699 3300006173 Bacteria 2532
45 Ga0070712_100006697 3300006175 Bacteria 7164
46 Ga0070712_100102913 3300006175 Bacteria 2116
47 Ga0075433_10060703 3300006852 Bacteria 3311
48 Ga0075434_100014918 3300006871 Bacteria 7434
49 Ga0075434_100016546 3300006871 Bacteria 7091
50 Ga0075436_100002474 3300006914 Bacteria 12715
51 Ga0075435_100030475 3300007076 Bacteria 4242
52 Ga0105245_10014324 3300009098 Bacteria 6909
53 Ga0114129_10353004 3300009147 Bacteria 1947
54 Ga0105243_10069487 3300009148 Bacteria 2841
55 Ga0105249_10118685 3300009553 Bacteria 2511
56 Ga0157369_10269320 3300013105 Bacteria 1775
57 Ga0157374_10107364 3300013296 Bacteria 2683
58 Ga0157374_10189447 3300013296 Bacteria 2012
59 Ga0157374_10234290 3300013296 Bacteria 1804
60 Ga0163162_10126967 3300013306 Bacteria 2657
61 Ga0157372_10156812 3300013307 Bacteria 2630
62 Ga0157372_10395629 3300013307 Bacteria 1610
63 Ga0182008_10020470 3300014497 Bacteria 3406
64 Ga0206356_10491546 3300020070 Bacteria 1653
65 Ga0206353_10027309 3300020082 Bacteria 5577
66 Ga0207692_10035412 3300025898 Bacteria 2425
67 Ga0207692_10076695 3300025898 Bacteria 1776
68 Ga0207688_10037088 3300025901 Bacteria 2703
69 Ga0207699_10043162 3300025906 Bacteria 2618
70 Ga0207699_10080030 3300025906 Bacteria 2023
71 Ga0207645_10114627 3300025907 Bacteria 1746
72 Ga0207705_10052887 3300025909 Bacteria 2925
73 Ga0207695_10055316 3300025913 Bacteria 4136
74 Ga0207695_10166193 3300025913 Bacteria 2135
75 Ga0207693_10003726 3300025915 Bacteria 12990
76 Ga0207693_10005566 3300025915 Bacteria 10480
77 Ga0207693_10022282 3300025915 Bacteria 5034
78 Ga0207663_10008683 3300025916 Bacteria 5331
79 Ga0207657_10003380 3300025919 Bacteria 17064
80 Ga0207657_10039520 3300025919 Bacteria 4191
81 Ga0207657_10040289 3300025919 Bacteria 4141
82 Ga0207652_10060206 3300025921 Bacteria 3276
83 Ga0207646_10000936 3300025922 Bacteria 37493
84 Ga0207646_10120705 3300025922 Bacteria 2355
85 Ga0207700_10000004 3300025928 Bacteria 443409
86 Ga0207664_10010242 3300025929 Bacteria 6621
87 Ga0207664_10058133 3300025929 Bacteria 3076
88 Ga0207690_10253855 3300025932 Bacteria 1359
89 Ga0207709_10057162 3300025935 Bacteria 2418
90 Ga0207665_10000230 3300025939 Bacteria 38061
91 Ga0207661_10001542 3300025944 Bacteria 15663
92 Ga0207661_10026856 3300025944 Bacteria 4392
93 Ga0207661_10079732 3300025944 Bacteria 2699
94 Ga0207651_10147690 3300025960 Bacteria 1826
95 Ga0207678_10060063 3300026067 Bacteria 3270
96 Ga0207702_10061960 3300026078 Bacteria 3192
97 Ga0207702_10124464 3300026078 Bacteria 2312
98 Ga0207641_10164099 3300026088 Bacteria 2022
99 Ga0207683_10005880 3300026121 Bacteria 10521
100 Ga0207683_10010861 3300026121 Bacteria 7766
101 Ga0265336_10001660 3300028666 Bacteria 9836
102 Ga0307515_10000017 3300028794 Bacteria 550465
103 Ga0265338_10003587 3300028800 Bacteria 21674
104 Ga0265327_10004631 3300031251 Bacteria 12068
105 Ga0307513_10000717 3300031456 Bacteria 47556
106 Ga0307416_100011409 3300032002 Bacteria 5925
107 Ga0373948_0005507 3300034817 Bacteria 2057
108 Ga0373958_0001534 3300034819 Bacteria 3117
109 Ga0373938_0002109 3300034957 Bacteria 3200
110 Ga0373928_0001522 3300035084 Bacteria 4506
111 Ga0373940_0012859 3300035088 Bacteria 2012
112 Ga0373951_0006803 3300035091 Bacteria 2611
113 Ga0373952_0012697 3300035092 Bacteria 1661
114 Ga0373941_0001207 3300035115 Bacteria 5410
115 Ga0373945_0011195 3300035116 Bacteria 2963
116 Ga0373954_0054315 3300035118 Bacteria 1884
117 Ga0373943_0001155 3300035170 Bacteria 11791
118 Ga0373946_0008282 3300035171 Bacteria 3816
119 Ga0373946_0037304 3300035171 Bacteria 1974
120 Ga0373962_0005245 3300035242 Bacteria 3133
121 Ga0373931_0004018 3300035691 Bacteria 6663
122 Ga0373931_0030389 3300035691 Bacteria 2781
123 Ga0373935_0062985 3300035692 Bacteria 2376
124 Ga0373935_0156346 3300035692 Bacteria 1551
125 Ga0373927_0022806 3300035695 Bacteria 4100
126 Ga0373947_0000358 3300035725 Bacteria 25937
127 Ga0373947_0008453 3300035725 Bacteria 5932
128 Ga0373937_0000364 3300036401 Bacteria 42155
129 Ga0373925_0009039 3300037068 Bacteria 7253
130 Ga0373925_0109210 3300037068 Bacteria 2135
131 Ga0373925_0294404 3300037068 Bacteria 1309
132 Ga0395899_0057720 3300037312 Bacteria 2864
133 Ga0395900_0067563 3300037418 Bacteria 3672
134 Ga0395900_0067788 3300037418 Bacteria 3666
135 Ga0395898_0056694 3300037466 Bacteria 3819
136 Ga0395898_0198633 3300037466 Bacteria 1915
137 Ga0395898_0212358 3300037466 Bacteria 1846
138 Ga0395898_0242695 3300037466 Bacteria 1718
139 Ga0395905_0031148 3300037471 Bacteria 5022
140 Ga0395901_0048911 3300038443 Bacteria 4391
141 Ga0395901_0076608 3300038443 Bacteria 3489
142 Ga0395901_0168902 3300038443 Bacteria 2295
143 Ga0436360_1310220 3300039438 Bacteria 9054
144 Ga0439462_0020094 3300042015 Bacteria 1741
145 Ga0439446_0031846 3300042156 Bacteria 1527
146 Ga0439434_0005935 3300042435 Bacteria 3566
147 Ga0466969_0002616 3300044656 Bacteria 9633
148 Ga0466969_0010463 3300044656 Bacteria 4917
149 Ga0466966_0001789 3300044684 Bacteria 13940
150 Ga0466966_0009182 3300044684 Bacteria 6546
151 Ga0466966_0021152 3300044684 Bacteria 4272
152 Ga0466966_0026672 3300044684 Bacteria 3771
153 Ga0466966_0037508 3300044684 Bacteria 3125
154 Ga0466961_0002650 3300044693 Bacteria 11103
155 Ga0466961_0038267 3300044693 Bacteria 3076
156 Ga0466961_0059779 3300044693 Bacteria 2423
157 Ga0466963_0000046 3300044694 Bacteria 40452
158 Ga0466963_0000441 3300044694 Bacteria 19205
159 Ga0466963_0005765 3300044694 Bacteria 7282
160 Ga0466963_0017805 3300044694 Bacteria 4433
161 Ga0466963_0035121 3300044694 Bacteria 3265
162 Ga0466963_0036561 3300044694 Bacteria 3203
163 Ga0466963_0037417 3300044694 Bacteria 3168
164 Ga0466963_0051688 3300044694 Bacteria 2724
165 Ga0466963_0064642 3300044694 Bacteria 2451
166 Ga0466963_0067125 3300044694 Bacteria 2406
167 Ga0466963_0077825 3300044694 Bacteria 2241
168 Ga0466963_0082010 3300044694 Bacteria 2185
169 Ga0466964_0003167 3300044706 Bacteria 5977
170 Ga0466964_0020856 3300044706 Bacteria 2527
171 Ga0466964_0029754 3300044706 Bacteria 2158
172 Ga0466964_0061892 3300044706 Bacteria 1559
173 Ga0466964_0075341 3300044706 Bacteria 1436
174 Ga0466971_0001393 3300044719 Bacteria 10146
175 Ga0466971_0004418 3300044719 Bacteria 6068
176 Ga0466971_0017706 3300044719 Bacteria 3154
177 Ga0466968_0003196 3300044735 Bacteria 6044
178 Ga0466968_0004624 3300044735 Bacteria 5147
179 Ga0466968_0008392 3300044735 Bacteria 3954
180 Ga0466970_0004799 3300044765 Bacteria 6676
181 Ga0466970_0028025 3300044765 Bacteria 2959
182 Ga0466957_0001177 3300044842 Bacteria 13587
183 Ga0466957_0002541 3300044842 Bacteria 9818
184 Ga0466957_0005722 3300044842 Bacteria 6990
185 Ga0466957_0008856 3300044842 Bacteria 5731
186 Ga0466957_0010231 3300044842 Bacteria 5374
187 Ga0466957_0039908 3300044842 Bacteria 2833
188 Ga0466957_0058809 3300044842 Bacteria 2355
189 Ga0466957_0083504 3300044842 Bacteria 1993
190 Ga0466957_0115678 3300044842 Bacteria 1705
191 Ga0466960_0011618 3300044901 Bacteria 3692
192 Ga0466960_0042682 3300044901 Bacteria 2154
193 Ga0466959_0001490 3300045049 Bacteria 14375
194 Ga0466959_0005274 3300045049 Bacteria 8830
195 Ga0466959_0016428 3300045049 Bacteria 5408
196 Ga0466959_0023513 3300045049 Bacteria 4560
197 Ga0466958_0000140 3300045836 Bacteria 24688
198 Ga0466958_0000412 3300045836 Bacteria 17617
199 Ga0466958_0006211 3300045836 Bacteria 6484
200 Ga0466958_0023354 3300045836 Bacteria 3629
201 Ga0466958_0080630 3300045836 Bacteria 2002
202 Ga0466958_0119748 3300045836 Bacteria 1647
203 Ga0466967_0000270 3300045976 Bacteria 22873
204 Ga0466967_0001844 3300045976 Bacteria 12752
205 Ga0466967_0018823 3300045976 Bacteria 5534
206 Ga0466967_0024209 3300045976 Bacteria 4988
207 Ga0466967_0033961 3300045976 Bacteria 4323
208 Ga0466967_0037619 3300045976 Bacteria 4143
209 Ga0466967_0044524 3300045976 Bacteria 3850
210 Ga0466967_0059806 3300045976 Bacteria 3374
211 Ga0466967_0072775 3300045976 Bacteria 3081
212 Ga0466967_0108174 3300045976 Bacteria 2551
213 Ga0466967_0122485 3300045976 Bacteria 2405
214 Ga0466967_0158831 3300045976 Bacteria 2120
215 Ga0466967_0229194 3300045976 Bacteria 1768
216 Ga0495592_0000050 3300046454 Bacteria 111971
217 Ga0495592_0005364 3300046454 Bacteria 9464
218 Ga0495592_0124745 3300046454 Bacteria 1808
219 Ga0495603_0120752 3300046455 Bacteria 1527
220 Ga0495629_0000769 3300046459 Bacteria 25883
221 Ga0495629_0212862 3300046459 Bacteria 1334
222 Ga0495641_0005449 3300046461 Bacteria 8598
223 Ga0495641_0006387 3300046461 Bacteria 7650
224 Ga0495641_0026485 3300046461 Bacteria 2828
225 Ga0495641_0036390 3300046461 Bacteria 2313
226 Ga0495641_0074956 3300046461 Bacteria 1517
227 Ga0495651_0000004 3300046462 Bacteria 177080
228 Ga0495651_0005047 3300046462 Bacteria 10081
229 Ga0495651_0031384 3300046462 Bacteria 4143
230 Ga0495651_0059464 3300046462 Bacteria 2930
231 Ga0495651_0082704 3300046462 Bacteria 2422
232 Ga0495653_0002246 3300046463 Bacteria 15275
233 Ga0495653_0019331 3300046463 Bacteria 5525
234 Ga0495653_0021994 3300046463 Bacteria 5160
235 Ga0495653_0066511 3300046463 Bacteria 2711
236 Ga0495653_0136435 3300046463 Bacteria 1730
237 Ga0495580_0021128 3300046472 Bacteria 4806
238 Ga0495580_0109251 3300046472 Bacteria 1920
239 Ga0495582_0000498 3300046473 Bacteria 21485
240 Ga0495639_0002465 3300046475 Bacteria 8084
241 Ga0495639_0004267 3300046475 Bacteria 6133
242 Ga0495662_0011652 3300046476 Bacteria 4297
243 Ga0495664_0026918 3300046477 Bacteria 3351
244 Ga0495664_0035050 3300046477 Bacteria 2954
245 Ga0495608_0008439 3300046511 Bacteria 7218
246 Ga0495608_0014661 3300046511 Bacteria 5438
247 Ga0495618_0002772 3300046514 Bacteria 11140
248 Ga0495618_0131313 3300046514 Bacteria 1603
249 Ga0495628_0001466 3300046516 Bacteria 21651
250 Ga0495628_0016703 3300046516 Bacteria 6119
251 Ga0495628_0129532 3300046516 Bacteria 1931
252 Ga0495628_0159875 3300046516 Bacteria 1712
253 Ga0495630_0049913 3300046517 Bacteria 3131
254 Ga0495630_0059760 3300046517 Bacteria 2860
255 Ga0495630_0077336 3300046517 Bacteria 2509
256 Ga0495630_0119886 3300046517 Bacteria 1996
257 Ga0495666_0024495 3300046526 Bacteria 2981
258 Ga0495652_0000047 3300046529 Bacteria 121525
259 Ga0495652_0030346 3300046529 Bacteria 4742
260 Ga0495652_0039032 3300046529 Bacteria 4107
261 Ga0495652_0117451 3300046529 Bacteria 2128
262 Ga0495652_0133586 3300046529 Bacteria 1961
263 Ga0495665_0002657 3300046531 Bacteria 9648
264 Ga0495665_0008402 3300046531 Bacteria 5599
265 Ga0495640_0035199 3300046533 Bacteria 3544
266 Ga0495640_0049367 3300046533 Bacteria 2902
267 Ga0495640_0073135 3300046533 Bacteria 2295
268 Ga0495587_0000103 3300046536 Bacteria 64471
269 Ga0495587_0013870 3300046536 Bacteria 5060
270 Ga0495587_0060200 3300046536 Bacteria 2227
271 Ga0495587_0073440 3300046536 Bacteria 1987
272 Ga0495645_0000028 3300046543 Bacteria 113461
273 Ga0495645_0032826 3300046543 Bacteria 3787
274 Ga0495645_0042967 3300046543 Bacteria 3296
275 Ga0495645_0073000 3300046543 Bacteria 2472
276 Ga0495667_0016060 3300046559 Bacteria 5060
277 Ga0495667_0050358 3300046559 Bacteria 2750
278 Ga0495634_0014160 3300046642 Bacteria 5755
279 Ga0495634_0039094 3300046642 Bacteria 3232
280 Ga0495634_0133123 3300046642 Bacteria 1583
281 Ga0495635_0031034 3300046663 Bacteria 3712
282 Ga0495635_0037686 3300046663 Bacteria 3347
283 Ga0495635_0110871 3300046663 Bacteria 1874
284 Ga0495659_0038290 3300046664 Bacteria 1702
285 Ga0495657_0038366 3300046675 Bacteria 3297
286 Ga0495657_0040475 3300046675 Bacteria 3196
287 Ga0495657_0042940 3300046675 Bacteria 3084
288 Ga0495657_0045564 3300046675 Bacteria 2976
289 Ga0495599_0000059 3300046678 Bacteria 75747
290 Ga0495599_0031161 3300046678 Bacteria 3347
291 Ga0495599_0064959 3300046678 Bacteria 2280
292 Ga0495623_0000082 3300046679 Bacteria 56315
293 Ga0495623_0025141 3300046679 Bacteria 3836
294 Ga0495646_0001107 3300046680 Bacteria 15705
295 Ga0495647_0000192 3300046681 Bacteria 16221
296 Ga0495647_0036507 3300046681 Bacteria 1850
297 Ga0495658_0002701 3300046683 Bacteria 8938
298 Ga0495658_0002845 3300046683 Bacteria 8693
299 Ga0495613_0002655 3300046689 Bacteria 13431
300 Ga0495613_0016666 3300046689 Bacteria 5470
301 Ga0495613_0093266 3300046689 Bacteria 2180
302 Ga0495624_0008998 3300046690 Bacteria 6941
303 Ga0495624_0009930 3300046690 Bacteria 6578
304 Ga0495624_0057683 3300046690 Bacteria 2441
305 Ga0495624_0112719 3300046690 Bacteria 1672
306 Ga0495624_0119473 3300046690 Bacteria 1619
307 Ga0495600_0025456 3300046809 Bacteria 3814
308 Ga0495600_0083188 3300046809 Bacteria 2089
309 Ga0495600_0115618 3300046809 Bacteria 1746
310 Ga0495581_0001176 3300047315 Bacteria 14348
311 Ga0495581_0011276 3300047315 Bacteria 5168
312 Ga0495581_0041542 3300047315 Bacteria 2662
313 Ga0495604_0000489 3300047317 Bacteria 34803
314 Ga0495604_0041906 3300047317 Bacteria 3589
315 Ga0495604_0088088 3300047317 Bacteria 2310
316 Ga0495674_0012179 3300047319 Bacteria 8106
317 Ga0495674_0028314 3300047319 Bacteria 5111
318 Ga0495674_0039151 3300047319 Bacteria 4250
319 Ga0495674_0285842 3300047319 Bacteria 1350
320 Ga0495676_0002838 3300047321 Bacteria 15613
321 Ga0495676_0037166 3300047321 Bacteria 4056
322 Ga0495680_0002258 3300047322 Bacteria 19853
323 Ga0495680_0003274 3300047322 Bacteria 16061
324 Ga0495680_0008086 3300047322 Bacteria 9590
325 Ga0495680_0051388 3300047322 Bacteria 3218
326 Ga0495680_0080563 3300047322 Bacteria 2460
327 Ga0495680_0084333 3300047322 Bacteria 2394
328 Ga0495675_0000020 3300047444 Bacteria 111526
329 Ga0495675_0069454 3300047444 Bacteria 2225
330 Ga0495684_0020390 3300047471 Bacteria 5108
331 Ga0495684_0020392 3300047471 Bacteria 5108
332 Ga0495684_0072988 3300047471 Bacteria 2607
333 Ga0495686_0000296 3300047472 Bacteria 86346
334 Ga0495593_0003732 3300047673 Bacteria 9084
335 Ga0495602_0002220 3300048088 Bacteria 19610
336 Ga0495602_0097739 3300048088 Bacteria 2418
337 Ga0495614_0004160 3300048089 Bacteria 6516
338 Ga0495614_0013201 3300048089 Bacteria 3624
339 Ga0496101_0010442 3300048904 Bacteria 6133
340 Ga0496101_0092490 3300048904 Bacteria 2252
341 Ga0496101_0259765 3300048904 Bacteria 1354
342 Ga0496102_0020008 3300048905 Bacteria 5905
343 Ga0496103_0003882 3300048906 Bacteria 9093
344 Ga0496103_0005371 3300048906 Bacteria 7674
345 Ga0496103_0044108 3300048906 Bacteria 2747
346 Ga0496103_0076015 3300048906 Bacteria 2107
347 Ga0496104_0015777 3300048907 Bacteria 6851
348 Ga0496104_0031673 3300048907 Bacteria 4918
349 Ga0496104_0039283 3300048907 Bacteria 4431
350 Ga0496104_0082456 3300048907 Bacteria 3066
351 Ga0496104_0172216 3300048907 Bacteria 2075
352 Ga0496104_0198049 3300048907 Bacteria 1920
353 Ga0496104_0200670 3300048907 Bacteria 1907
354 Ga0496105_0007136 3300048908 Bacteria 8618
355 Ga0496105_0031343 3300048908 Bacteria 4358
356 Ga0496105_0102171 3300048908 Bacteria 2367
357 Ga0496106_0144532 3300048909 Bacteria 1873
358 Ga0496106_0149531 3300048909 Bacteria 1841
359 Ga0496107_0031826 3300048910 Bacteria 3766
360 Ga0496107_0050490 3300048910 Bacteria 2998
361 Ga0496108_0008971 3300048911 Bacteria 8106
362 Ga0496108_0020213 3300048911 Bacteria 5472
363 Ga0496109_0008668 3300048912 Bacteria 8655
364 Ga0496109_0018578 3300048912 Bacteria 6108
365 Ga0496109_0091554 3300048912 Bacteria 2812
366 Ga0496110_0009470 3300048913 Bacteria 7887
367 Ga0496110_0115767 3300048913 Bacteria 2413
368 Ga0496110_0298842 3300048913 Bacteria 1466
369 Ga0496111_0000576 3300048914 Bacteria 19160
370 Ga0496111_0025136 3300048914 Bacteria 4200
371 Ga0496112_0126214 3300048915 Bacteria 2529
372 Ga0496113_0030173 3300048916 Bacteria 3922
373 Ga0496113_0041413 3300048916 Bacteria 3399
374 Ga0496113_0136371 3300048916 Bacteria 1928
375 Ga0496114_0019365 3300048917 Bacteria 5515
376 Ga0496114_0076025 3300048917 Bacteria 2829
377 Ga0496114_0144038 3300048917 Bacteria 2065
378 Ga0496114_0205877 3300048917 Bacteria 1724
379 Ga0496115_0016896 3300048918 Bacteria 5565
380 Ga0496115_0023517 3300048918 Bacteria 4781
381 Ga0496115_0136294 3300048918 Bacteria 2024
382 Ga0501036_0050111 3300049572 Bacteria 3536
383 Ga0501038_0063587 3300049574 Bacteria 3149
384 Ga0501041_0128823 3300049577 Bacteria 1576
385 Ga0501046_0029351 3300049580 Bacteria 4471
386 Ga0501047_0026084 3300049581 Bacteria 5620
387 Ga0501048_0047337 3300049582 Bacteria 3068
388 Ga0501067_0024238 3300049583 Bacteria 3365
389 Ga0501067_0029270 3300049583 Bacteria 3052
390 Ga0501068_0041224 3300049584 Bacteria 2774
391 Ga0501069_0076042 3300049585 Bacteria 1887
392 Ga0501070_0046302 3300049586 Bacteria 3617
393 Ga0501071_0005257 3300049587 Bacteria 8300
394 Ga0501072_0051623 3300049588 Bacteria 3237
395 Ga0501074_0022248 3300049590 Bacteria 4607
396 Ga0501074_0036133 3300049590 Bacteria 3579
397 Ga0501075_0048504 3300049591 Bacteria 3191
398 Ga0501076_0027758 3300049592 Bacteria 4390
399 Ga0501076_0094008 3300049592 Bacteria 2413
400 Ga0501076_0161520 3300049592 Bacteria 1825
401 Ga0501077_0051916 3300049593 Bacteria 2604
402 Ga0501079_0022037 3300049741 Bacteria 4881
403 Ga0501080_0134282 3300049742 Bacteria 2290
404 Ga0501045_0039468 3300049824 Bacteria 3435
405 nmdc:mga05p37_375946_c1 3300050507 Bacteria 1666
406 nmdc:mga0n895_12912_c1 3300050512 Bacteria 7508
407 nmdc:mga0rr50_86802_c1 3300050513 Bacteria 2428
408 nmdc:mga08x19_20640_c1 3300050514 Bacteria 4057
409 nmdc:mga0a205_13652_c1 3300050515 Bacteria 7567
410 nmdc:mga0a205_138854_c1 3300050515 Bacteria 2331
411 Ga0495601_0001606 3300053077 Bacteria 12464
412 Ga0495601_0044400 3300053077 Bacteria 2794
413 Ga0495601_0059965 3300053077 Bacteria 2413
414 Ga0495601_0113434 3300053077 Bacteria 1756
415 Ga0495612_0006098 3300053078 Bacteria 4960
416 Ga0495612_0053620 3300053078 Bacteria 1660
417 Ga0495595_0026660 3300053084 Bacteria 2569
418 Ga0495595_0037748 3300053084 Bacteria 2198
419 Ga0495619_0003277 3300053085 Bacteria 10468
420 Ga0495619_0004352 3300053085 Bacteria 9034
421 Ga0495619_0006577 3300053085 Bacteria 7351
422 Ga0495619_0027737 3300053085 Bacteria 3651
423 Ga0495619_0075377 3300053085 Bacteria 2264
424 Ga0495619_0130856 3300053085 Bacteria 1724
425 Ga0500636_0171106 3300053177 Bacteria 1175
426 Ga0501084_0006342 3300054114 Bacteria 9718
427 Ga0501082_0019239 3300060353 Bacteria 5886
428 Ga0466962_0003048 3300061719 Bacteria 7989
429 Ga0466962_0042633 3300061719 Bacteria 2172
430 8024489049 8024486573 Bacteria 6540512
431 Ga0495600_0119229
432 JGI25406J46586_10001840
433 Ga0070658_10003344
434 Ga0070658_10016363
435 Ga0070683_100006721
436 Ga0070683_100060469
437 Ga0070683_100230091
438 Ga0070683_100340711
439 Ga0070682_100002388
440 Ga0068868_100106561
441 Ga0070660_100061328
442 Ga0070660_100114736
443 Ga0070687_100104402
444 Ga0070659_100057212
445 Ga0070709_10039368
446 Ga0070709_10041435
447 Ga0070709_10070313
448 Ga0070714_100086778
449 Ga0070714_100144630
450 Ga0070714_100250184
451 Ga0070713_100047115
452 Ga0070713_100216418
453 Ga0070710_10009552
454 Ga0070711_100116570
455 Ga0070705_100086932
456 Ga0070663_100036155
457 Ga0070678_100007811
458 Ga0070681_10007120
459 Ga0070681_10009081
460 Ga0070681_10145309
461 Ga0070707_100003358
462 Ga0070698_100018511
463 Ga0070679_100148268
464 Ga0070684_100008287
465 Ga0070695_100000074
466 Ga0070695_100041360
467 Ga0068855_100135623
468 Ga0068856_100156668
469 Ga0081455_10001540
470 Ga0081539_10000288
471 Ga0070717_10002047
472 Ga0075365_10066671
473 Ga0070716_100022259
474 Ga0070716_100042699
475 Ga0070712_100006697
476 Ga0070712_100102913
477 Ga0075433_10060703
478 Ga0075434_100014918
479 Ga0075434_100016546
480 Ga0075436_100002474
481 Ga0075435_100030475
482 Ga0105245_10014324
483 Ga0114129_10353004
484 Ga0105243_10069487
485 Ga0105249_10118685
486 Ga0157369_10269320
487 Ga0157374_10107364
488 Ga0157374_10189447
489 Ga0157374_10234290
490 Ga0163162_10126967
491 Ga0157372_10156812
492 Ga0157372_10395629
493 Ga0182008_10020470
494 Ga0206356_10491546
495 Ga0206353_10027309
496 Ga0207692_10035412
497 Ga0207692_10076695
498 Ga0207688_10037088
499 Ga0207699_10043162
500 Ga0207699_10080030
501 Ga0207645_10114627
502 Ga0207705_10052887
503 Ga0207695_10055316
504 Ga0207695_10166193
505 Ga0207693_10003726
506 Ga0207693_10005566
507 Ga0207693_10022282
508 Ga0207663_10008683
509 Ga0207657_10003380
510 Ga0207657_10039520
511 Ga0207657_10040289
512 Ga0207652_10060206
513 Ga0207646_10000936
514 Ga0207646_10120705
515 Ga0207700_10000004
516 Ga0207664_10010242
517 Ga0207664_10058133
518 Ga0207690_10253855
519 Ga0207709_10057162
520 Ga0207665_10000230
521 Ga0207661_10001542
522 Ga0207661_10026856
523 Ga0207661_10079732
524 Ga0207651_10147690
525 Ga0207678_10060063
526 Ga0207702_10061960
527 Ga0207702_10124464
528 Ga0207641_10164099
529 Ga0207683_10005880
530 Ga0207683_10010861
531 Ga0265336_10001660
532 Ga0307515_10000017
533 Ga0265338_10003587
534 Ga0265327_10004631
535 Ga0307513_10000717
536 Ga0307416_100011409
537 Ga0373948_0005507
538 Ga0373958_0001534
539 Ga0373938_0002109
540 Ga0373928_0001522
541 Ga0373940_0012859
542 Ga0373951_0006803
543 Ga0373952_0012697
544 Ga0373941_0001207
545 Ga0373945_0011195
546 Ga0373954_0054315
547 Ga0373943_0001155
548 Ga0373946_0008282
549 Ga0373946_0037304
550 Ga0373962_0005245
551 Ga0373931_0004018
552 Ga0373931_0030389
553 Ga0373935_0062985
554 Ga0373935_0156346
555 Ga0373927_0022806
556 Ga0373947_0000358
557 Ga0373947_0008453
558 Ga0373937_0000364
559 Ga0373925_0009039
560 Ga0373925_0109210
561 Ga0373925_0294404
562 Ga0395899_0057720
563 Ga0395900_0067563
564 Ga0395900_0067788
565 Ga0395898_0056694
566 Ga0395898_0198633
567 Ga0395898_0212358
568 Ga0395898_0242695
569 Ga0395905_0031148
570 Ga0395901_0048911
571 Ga0395901_0076608
572 Ga0395901_0168902
573 Ga0436360_1310220
574 Ga0439462_0020094
575 Ga0439446_0031846
576 Ga0439434_0005935
577 Ga0466969_0002616
578 Ga0466969_0010463
579 Ga0466966_0001789
580 Ga0466966_0009182
581 Ga0466966_0021152
582 Ga0466966_0026672
583 Ga0466966_0037508
584 Ga0466961_0002650
585 Ga0466961_0038267
586 Ga0466961_0059779
587 Ga0466963_0000046
588 Ga0466963_0000441
589 Ga0466963_0005765
590 Ga0466963_0017805
591 Ga0466963_0035121
592 Ga0466963_0036561
593 Ga0466963_0037417
594 Ga0466963_0051688
595 Ga0466963_0064642
596 Ga0466963_0067125
597 Ga0466963_0077825
598 Ga0466963_0082010
599 Ga0466964_0003167
600 Ga0466964_0020856
601 Ga0466964_0029754
602 Ga0466964_0061892
603 Ga0466964_0075341
604 Ga0466971_0001393
605 Ga0466971_0004418
606 Ga0466971_0017706
607 Ga0466968_0003196
608 Ga0466968_0004624
609 Ga0466968_0008392
610 Ga0466970_0004799
611 Ga0466970_0028025
612 Ga0466957_0001177
613 Ga0466957_0002541
614 Ga0466957_0005722
615 Ga0466957_0008856
616 Ga0466957_0010231
617 Ga0466957_0039908
618 Ga0466957_0058809
619 Ga0466957_0083504
620 Ga0466957_0115678
621 Ga0466960_0011618
622 Ga0466960_0042682
623 Ga0466959_0001490
624 Ga0466959_0005274
625 Ga0466959_0016428
626 Ga0466959_0023513
627 Ga0466958_0000140
628 Ga0466958_0000412
629 Ga0466958_0006211
630 Ga0466958_0023354
631 Ga0466958_0080630
632 Ga0466958_0119748
633 Ga0466967_0000270
634 Ga0466967_0001844
635 Ga0466967_0018823
636 Ga0466967_0024209
637 Ga0466967_0033961
638 Ga0466967_0037619
639 Ga0466967_0044524
640 Ga0466967_0059806
641 Ga0466967_0072775
642 Ga0466967_0108174
643 Ga0466967_0122485
644 Ga0466967_0158831
645 Ga0466967_0229194
646 Ga0495592_0000050
647 Ga0495592_0005364
648 Ga0495592_0124745
649 Ga0495603_0120752
650 Ga0495629_0000769
651 Ga0495629_0212862
652 Ga0495641_0005449
653 Ga0495641_0006387
654 Ga0495641_0026485
655 Ga0495641_0036390
656 Ga0495641_0074956
657 Ga0495651_0000004
658 Ga0495651_0005047
659 Ga0495651_0031384
660 Ga0495651_0059464
661 Ga0495651_0082704
662 Ga0495653_0002246
663 Ga0495653_0019331
664 Ga0495653_0021994
665 Ga0495653_0066511
666 Ga0495653_0136435
667 Ga0495580_0021128
668 Ga0495580_0109251
669 Ga0495582_0000498
670 Ga0495639_0002465
671 Ga0495639_0004267
672 Ga0495662_0011652
673 Ga0495664_0026918
674 Ga0495664_0035050
675 Ga0495608_0008439
676 Ga0495608_0014661
677 Ga0495618_0002772
678 Ga0495618_0131313
679 Ga0495628_0001466
680 Ga0495628_0016703
681 Ga0495628_0129532
682 Ga0495628_0159875
683 Ga0495630_0049913
684 Ga0495630_0059760
685 Ga0495630_0077336
686 Ga0495630_0119886
687 Ga0495666_0024495
688 Ga0495652_0000047
689 Ga0495652_0030346
690 Ga0495652_0039032
691 Ga0495652_0117451
692 Ga0495652_0133586
693 Ga0495665_0002657
694 Ga0495665_0008402
695 Ga0495640_0035199
696 Ga0495640_0049367
697 Ga0495640_0073135
698 Ga0495587_0000103
699 Ga0495587_0013870
700 Ga0495587_0060200
701 Ga0495587_0073440
702 Ga0495645_0000028
703 Ga0495645_0032826
704 Ga0495645_0042967
705 Ga0495645_0073000
706 Ga0495667_0016060
707 Ga0495667_0050358
708 Ga0495634_0014160
709 Ga0495634_0039094
710 Ga0495634_0133123
711 Ga0495635_0031034
712 Ga0495635_0037686
713 Ga0495635_0110871
714 Ga0495659_0038290
715 Ga0495657_0038366
716 Ga0495657_0040475
717 Ga0495657_0042940
718 Ga0495657_0045564
719 Ga0495599_0000059
720 Ga0495599_0031161
721 Ga0495599_0064959
722 Ga0495623_0000082
723 Ga0495623_0025141
724 Ga0495646_0001107
725 Ga0495647_0000192
726 Ga0495647_0036507
727 Ga0495658_0002701
728 Ga0495658_0002845
729 Ga0495613_0002655
730 Ga0495613_0016666
731 Ga0495613_0093266
732 Ga0495624_0008998
733 Ga0495624_0009930
734 Ga0495624_0057683
735 Ga0495624_0112719
736 Ga0495624_0119473
737 Ga0495600_0025456
738 Ga0495600_0083188
739 Ga0495600_0115618
740 Ga0495581_0001176
741 Ga0495581_0011276
742 Ga0495581_0041542
743 Ga0495604_0000489
744 Ga0495604_0041906
745 Ga0495604_0088088
746 Ga0495674_0012179
747 Ga0495674_0028314
748 Ga0495674_0039151
749 Ga0495674_0285842
750 Ga0495676_0002838
751 Ga0495676_0037166
752 Ga0495680_0002258
753 Ga0495680_0003274
754 Ga0495680_0008086
755 Ga0495680_0051388
756 Ga0495680_0080563
757 Ga0495680_0084333
758 Ga0495675_0000020
759 Ga0495675_0069454
760 Ga0495684_0020390
761 Ga0495684_0020392
762 Ga0495684_0072988
763 Ga0495686_0000296
764 Ga0495593_0003732
765 Ga0495602_0002220
766 Ga0495602_0097739
767 Ga0495614_0004160
768 Ga0495614_0013201
769 Ga0496101_0010442
770 Ga0496101_0092490
771 Ga0496101_0259765
772 Ga0496102_0020008
773 Ga0496103_0003882
774 Ga0496103_0005371
775 Ga0496103_0044108
776 Ga0496103_0076015
777 Ga0496104_0015777
778 Ga0496104_0031673
779 Ga0496104_0039283
780 Ga0496104_0082456
781 Ga0496104_0172216
782 Ga0496104_0198049
783 Ga0496104_0200670
784 Ga0496105_0007136
785 Ga0496105_0031343
786 Ga0496105_0102171
787 Ga0496106_0144532
788 Ga0496106_0149531
789 Ga0496107_0031826
790 Ga0496107_0050490
791 Ga0496108_0008971
792 Ga0496108_0020213
793 Ga0496109_0008668
794 Ga0496109_0018578
795 Ga0496109_0091554
796 Ga0496110_0009470
797 Ga0496110_0115767
798 Ga0496110_0298842
799 Ga0496111_0000576
800 Ga0496111_0025136
801 Ga0496112_0126214
802 Ga0496113_0030173
803 Ga0496113_0041413
804 Ga0496113_0136371
805 Ga0496114_0019365
806 Ga0496114_0076025
807 Ga0496114_0144038
808 Ga0496114_0205877
809 Ga0496115_0016896
810 Ga0496115_0023517
811 Ga0496115_0136294
812 Ga0501036_0050111
813 Ga0501038_0063587
814 Ga0501041_0128823
815 Ga0501046_0029351
816 Ga0501047_0026084
817 Ga0501048_0047337
818 Ga0501067_0024238
819 Ga0501067_0029270
820 Ga0501068_0041224
821 Ga0501069_0076042
822 Ga0501070_0046302
823 Ga0501071_0005257
824 Ga0501072_0051623
825 Ga0501074_0022248
826 Ga0501074_0036133
827 Ga0501075_0048504
828 Ga0501076_0027758
829 Ga0501076_0094008
830 Ga0501076_0161520
831 Ga0501077_0051916
832 Ga0501079_0022037
833 Ga0501080_0134282
834 Ga0501045_0039468
835 nmdc:mga05p37_375946_c1
836 nmdc:mga0n895_12912_c1
837 nmdc:mga0rr50_86802_c1
838 nmdc:mga08x19_20640_c1
839 nmdc:mga0a205_13652_c1
840 nmdc:mga0a205_138854_c1
841 Ga0495601_0001606
842 Ga0495601_0044400
843 Ga0495601_0059965
844 Ga0495601_0113434
845 Ga0495612_0006098
846 Ga0495612_0053620
847 Ga0495595_0026660
848 Ga0495595_0037748
849 Ga0495619_0003277
850 Ga0495619_0004352
851 Ga0495619_0006577
852 Ga0495619_0027737
853 Ga0495619_0075377
854 Ga0495619_0130856
855 Ga0500636_0171106
856 Ga0501084_0006342
857 Ga0501082_0019239
858 Ga0466962_0003048
859 Ga0466962_0042633
860 8024489049

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

73

216

0.98

PF17850

CysA_C_terminal

CysA C-terminal regulatory domain

294

335

0.95

PF17912

OB_MalK

MalK OB fold domain

289

334

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9512 4 234
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9476 4 214
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9381 4 219
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.938 1 218
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9379 4 377
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.99 3 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 3 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 1 218 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 4 236 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 4 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9984 1 222 GO:0005524
GO:0016887
GO:0055052
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9869 1 243 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A534HSD0-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9832 4 220 GO:0005524
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9808 1 226 GO:0005524
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9765 1 226 GO:0005524
GO:0016887

Map