F442233

General Info

Members Datasets Scaffolds Average Seq Length
430 247 860 146

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0003792|Ga0496119_0003792_1850_2290
Length 141
Sequence MAIKTDAVGKSWPSTTYQVGREKIKEYATVLGIENPVHFDVGAAREAGFRDVVAPPMFAVVYSMQALDPEVGMNFATMVHGGQTFEWGEPACSGDEITTTAKCISIDEKLGNGFYVFETISVNGAGAEVVRGTWTNIVRGV

Samples

Sample ID Description Type Environment
1 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
128 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 0
Rhizoplane 9.53
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496119_0003792 3300048922 Bacteria 15458
2 JGI24746J21847_1000516 3300001977 Bacteria 5795
3 JGI24751J29686_10038121 3300002459 Bacteria 995
4 rootL2_10273478 3300003322 Bacteria 1529
5 Ga0070683_100005111 3300005329 Bacteria 10909
6 Ga0070683_100077794 3300005329 Bacteria 3102
7 Ga0070683_101252499 3300005329 Bacteria 713
8 Ga0070677_10000082 3300005333 Bacteria 30305
9 Ga0070666_10122694 3300005335 Bacteria 1802
10 Ga0070666_10215568 3300005335 Bacteria 1353
11 Ga0070680_101799226 3300005336 Bacteria 531
12 Ga0070682_100000017 3300005337 Bacteria 235228
13 Ga0068868_100000033 3300005338 Bacteria 75402
14 Ga0070689_100115196 3300005340 Bacteria 2142
15 Ga0070661_100000121 3300005344 Bacteria 65344
16 Ga0070661_101407745 3300005344 Bacteria 587
17 Ga0070668_100001145 3300005347 Bacteria 18672
18 Ga0070668_100164783 3300005347 Bacteria 1801
19 Ga0070669_100203553 3300005353 Bacteria 1559
20 Ga0070674_100000002 3300005356 Bacteria 271088
21 Ga0070674_100000009 3300005356 Bacteria 143336
22 Ga0070714_100152320 3300005435 Bacteria 2085
23 Ga0070714_100660812 3300005435 Bacteria 1007
24 Ga0070711_100003868 3300005439 Bacteria 8792
25 Ga0070700_100453888 3300005441 Bacteria 976
26 Ga0070700_100883141 3300005441 Bacteria 727
27 Ga0070663_100000065 3300005455 Bacteria 45157
28 Ga0070663_100382503 3300005455 Bacteria 1146
29 Ga0070678_100012972 3300005456 Bacteria 5204
30 Ga0070678_100035649 3300005456 Bacteria 3476
31 Ga0070662_100000002 3300005457 Bacteria 253208
32 Ga0070681_10230121 3300005458 Bacteria 1768
33 Ga0070681_10396679 3300005458 Bacteria 1291
34 Ga0068867_100004390 3300005459 Bacteria 9921
35 Ga0070679_100002020 3300005530 Bacteria 18198
36 Ga0070679_100170416 3300005530 Bacteria 2150
37 Ga0070679_100385516 3300005530 Bacteria 1348
38 Ga0070684_100010013 3300005535 Bacteria 7496
39 Ga0070684_100011008 3300005535 Bacteria 7195
40 Ga0070684_100862836 3300005535 Bacteria 847
41 Ga0068853_100025426 3300005539 Bacteria 4968
42 Ga0070686_100029755 3300005544 Bacteria 3326
43 Ga0070693_100000406 3300005547 Bacteria 19495
44 Ga0070665_100000040 3300005548 Bacteria 305480
45 Ga0070665_100003676 3300005548 Bacteria 16257
46 Ga0068855_100242393 3300005563 Bacteria 2014
47 Ga0068855_100256173 3300005563 Bacteria 1951
48 Ga0070664_100381821 3300005564 Bacteria 1286
49 Ga0068854_100117494 3300005578 Unclassified 2014
50 Ga0068856_100000237 3300005614 Bacteria 59854
51 Ga0068856_100003571 3300005614 Bacteria 15652
52 Ga0068856_100017715 3300005614 Bacteria 6908
53 Ga0068852_100000002 3300005616 Bacteria 268221
54 Ga0068864_100000015 3300005618 Bacteria 303368
55 Ga0068866_10000003 3300005718 Bacteria 281675
56 Ga0068866_10000036 3300005718 Bacteria 51111
57 Ga0068861_100068033 3300005719 Bacteria 2751
58 Ga0068851_10060758 3300005834 Bacteria 1935
59 Ga0068863_100001187 3300005841 Bacteria 26004
60 Ga0068858_100000156 3300005842 Bacteria 72781
61 Ga0068860_100004826 3300005843 Bacteria 13732
62 Ga0068862_101295642 3300005844 Bacteria 730
63 Ga0081455_10042559 3300005937 Bacteria 3982
64 Ga0081455_10406052 3300005937 Bacteria 944
65 Ga0081540_1157397 3300005983 Bacteria 887
66 Ga0075365_10049928 3300006038 Bacteria 2758
67 Ga0075365_10118597 3300006038 Bacteria 1824
68 Ga0075365_10921484 3300006038 Bacteria 616
69 Ga0075368_10140541 3300006042 Bacteria 1006
70 Ga0075363_100122194 3300006048 Bacteria 1455
71 Ga0075363_100627828 3300006048 Bacteria 645
72 Ga0075364_10039119 3300006051 Bacteria 3074
73 Ga0075364_10325955 3300006051 Bacteria 1046
74 Ga0075364_10669280 3300006051 Bacteria 709
75 Ga0070715_10000001 3300006163 Bacteria 693690
76 Ga0070712_100077517 3300006175 Bacteria 2396
77 Ga0075430_100144120 3300006846 Bacteria 1984
78 Ga0075431_100003809 3300006847 Bacteria 14662
79 Ga0075431_100214239 3300006847 Bacteria 1966
80 Ga0075433_10009335 3300006852 Bacteria 7842
81 Ga0075434_100306331 3300006871 Bacteria 1609
82 Ga0105250_10222617 3300009092 Bacteria 800
83 Ga0105240_11425260 3300009093 Bacteria 728
84 Ga0111539_10512681 3300009094 Bacteria 1397
85 Ga0105245_10000201 3300009098 Bacteria 57152
86 Ga0105245_10006128 3300009098 Bacteria 10578
87 Ga0105247_10229602 3300009101 Bacteria 1260
88 Ga0105247_11522994 3300009101 Bacteria 546
89 Ga0114129_12289170 3300009147 Bacteria 649
90 Ga0105243_10065299 3300009148 Bacteria 2923
91 Ga0105243_11368475 3300009148 Bacteria 727
92 Ga0105242_10024452 3300009176 Bacteria 4771
93 Ga0105248_10000175 3300009177 Bacteria 74795
94 Ga0105237_10905475 3300009545 Bacteria 889
95 Ga0105238_10000009 3300009551 Bacteria 288729
96 Ga0105238_10535101 3300009551 Bacteria 1175
97 Ga0105249_10000050 3300009553 Bacteria 169617
98 Ga0105249_12155998 3300009553 Bacteria 630
99 Ga0105239_10637320 3300010375 Bacteria 1217
100 Ga0105239_10829214 3300010375 Bacteria 1060
101 Ga0105239_11552515 3300010375 Bacteria 765
102 Ga0105246_10122598 3300011119 Bacteria 1929
103 Ga0157370_10009925 3300013104 Bacteria 10084
104 Ga0157374_10013622 3300013296 Bacteria 7103
105 Ga0157374_10418024 3300013296 Bacteria 1339
106 Ga0157378_10098914 3300013297 Bacteria 2661
107 Ga0157378_10826779 3300013297 Bacteria 953
108 Ga0163162_11426264 3300013306 Bacteria 788
109 Ga0157372_10535423 3300013307 Bacteria 1365
110 Ga0157372_12362999 3300013307 Bacteria 610
111 Ga0157375_10000584 3300013308 Bacteria 32509
112 Ga0157375_11002868 3300013308 Bacteria 975
113 Ga0163163_10174037 3300014325 Bacteria 2199
114 Ga0163163_10741586 3300014325 Bacteria 1045
115 Ga0157380_10001197 3300014326 Bacteria 16794
116 Ga0157380_10139726 3300014326 Bacteria 2079
117 Ga0157379_10013140 3300014968 Bacteria 7250
118 Ga0157379_10941904 3300014968 Bacteria 821
119 Ga0157376_10134188 3300014969 Bacteria 2213
120 Ga0207656_10043544 3300025321 Bacteria 1914
121 Ga0207682_10000018 3300025893 Bacteria 66215
122 Ga0207642_10000002 3300025899 Bacteria 658166
123 Ga0207642_10000377 3300025899 Bacteria 13379
124 Ga0207680_10007438 3300025903 Bacteria 5339
125 Ga0207680_10024487 3300025903 Bacteria 3314
126 Ga0207680_10258557 3300025903 Bacteria 1204
127 Ga0207685_10000005 3300025905 Bacteria 289944
128 Ga0207705_10289941 3300025909 Bacteria 1254
129 Ga0207684_10655767 3300025910 Bacteria 894
130 Ga0207654_10560532 3300025911 Bacteria 812
131 Ga0207707_10020589 3300025912 Bacteria 5762
132 Ga0207707_10291485 3300025912 Bacteria 1412
133 Ga0207695_11320161 3300025913 Bacteria 602
134 Ga0207671_10129317 3300025914 Bacteria 1937
135 Ga0207693_10082967 3300025915 Bacteria 2510
136 Ga0207663_10001006 3300025916 Bacteria 12904
137 Ga0207660_11055421 3300025917 Bacteria 662
138 Ga0207649_10000003 3300025920 Bacteria 388908
139 Ga0207649_10209542 3300025920 Bacteria 1382
140 Ga0207652_10011749 3300025921 Bacteria 7068
141 Ga0207652_10015740 3300025921 Bacteria 6160
142 Ga0207694_10000004 3300025924 Bacteria 967075
143 Ga0207687_10000015 3300025927 Bacteria 261701
144 Ga0207687_10000020 3300025927 Bacteria 228407
145 Ga0207687_10001695 3300025927 Bacteria 15197
146 Ga0207687_10966782 3300025927 Bacteria 730
147 Ga0207664_10228180 3300025929 Bacteria 1618
148 Ga0207706_10000001 3300025933 Bacteria 423014
149 Ga0207686_10042696 3300025934 Bacteria 2774
150 Ga0207709_10072697 3300025935 Bacteria 2188
151 Ga0207670_10522488 3300025936 Bacteria 966
152 Ga0207669_10000001 3300025937 Bacteria 377747
153 Ga0207669_10000003 3300025937 Bacteria 252239
154 Ga0207669_11403585 3300025937 Bacteria 595
155 Ga0207665_10116247 3300025939 Bacteria 1885
156 Ga0207711_10000006 3300025941 Bacteria 792692
157 Ga0207711_10101206 3300025941 Bacteria 2550
158 Ga0207661_10009225 3300025944 Bacteria 7070
159 Ga0207661_10009386 3300025944 Bacteria 7014
160 Ga0207661_10092868 3300025944 Bacteria 2517
161 Ga0207679_10311534 3300025945 Bacteria 1360
162 Ga0207667_10189094 3300025949 Bacteria 2113
163 Ga0207651_10001383 3300025960 Bacteria 10988
164 Ga0207712_10000019 3300025961 Bacteria 317060
165 Ga0207712_10488614 3300025961 Bacteria 1050
166 Ga0207640_10083999 3300025981 Bacteria 2185
167 Ga0207658_10002662 3300025986 Bacteria 12941
168 Ga0207658_10193597 3300025986 Bacteria 1692
169 Ga0207677_10002270 3300026023 Bacteria 10097
170 Ga0207703_10000704 3300026035 Bacteria 33055
171 Ga0207639_10036439 3300026041 Bacteria 3645
172 Ga0207678_10000253 3300026067 Bacteria 48388
173 Ga0207678_11052003 3300026067 Bacteria 721
174 Ga0207708_10384130 3300026075 Bacteria 1158
175 Ga0207708_10746526 3300026075 Unclassified 840
176 Ga0207702_10000251 3300026078 Bacteria 62222
177 Ga0207702_10002325 3300026078 Bacteria 18164
178 Ga0207702_10018073 3300026078 Bacteria 5833
179 Ga0207702_10217649 3300026078 Bacteria 1779
180 Ga0207702_10959157 3300026078 Bacteria 848
181 Ga0207641_10000827 3300026088 Bacteria 32939
182 Ga0207648_10008149 3300026089 Bacteria 10188
183 Ga0207676_10000018 3300026095 Bacteria 306375
184 Ga0207675_100801634 3300026118 Bacteria 955
185 Ga0207683_10013570 3300026121 Bacteria 6950
186 Ga0207683_10148883 3300026121 Bacteria 2112
187 Ga0207698_10000004 3300026142 Bacteria 313614
188 Ga0209813_10142164 3300027866 Bacteria 853
189 Ga0268266_10000045 3300028379 Bacteria 312955
190 Ga0268266_10000491 3300028379 Bacteria 56615
191 Ga0268266_10001210 3300028379 Bacteria 31835
192 Ga0268266_12372414 3300028379 Bacteria 501
193 Ga0268265_10110742 3300028380 Bacteria 2241
194 Ga0268265_11939312 3300028380 Bacteria 596
195 Ga0316576_10039140 3300031727 Bacteria 3403
196 Ga0316578_10228041 3300031728 Bacteria 1119
197 Ga0316574_0075593 3300035398 Bacteria 2133
198 Ga0373947_0663523 3300035725 Bacteria 711
199 Ga0373937_0644600 3300036401 Bacteria 1005
200 Ga0451853_3960444 3300041512 Bacteria 5734
201 Ga0439459_0102608 3300042438 Bacteria 702
202 Ga0466963_0000127 3300044694 Bacteria 28865
203 Ga0466960_0270196 3300044901 Bacteria 950
204 Ga0466960_0340744 3300044901 Bacteria 853
205 Ga0466967_0172081 3300045976 Bacteria 2038
206 Ga0466967_1981223 3300045976 Bacteria 579
207 Ga0495592_0069782 3300046454 Bacteria 2562
208 Ga0495592_0210973 3300046454 Bacteria 1304
209 Ga0495629_0004716 3300046459 Bacteria 10215
210 Ga0495629_0250233 3300046459 Bacteria 1219
211 Ga0495629_0447260 3300046459 Bacteria 875
212 Ga0495638_0027318 3300046460 Bacteria 3695
213 Ga0495641_0000214 3300046461 Bacteria 44992
214 Ga0495641_0192014 3300046461 Bacteria 915
215 Ga0495651_0051355 3300046462 Bacteria 3179
216 Ga0495651_0169163 3300046462 Bacteria 1558
217 Ga0495651_0196049 3300046462 Bacteria 1417
218 Ga0495653_0102454 3300046463 Bacteria 2071
219 Ga0495582_0000009 3300046473 Bacteria 123633
220 Ga0495639_0038529 3300046475 Bacteria 2147
221 Ga0495662_0007572 3300046476 Bacteria 5359
222 Ga0495662_0301393 3300046476 Bacteria 788
223 Ga0495664_0183943 3300046477 Bacteria 1267
224 Ga0495606_0000017 3300046507 Bacteria 284549
225 Ga0495610_0031729 3300046512 Bacteria 2754
226 Ga0495620_0004866 3300046515 Bacteria 7536
227 Ga0495628_0020460 3300046516 Bacteria 5456
228 Ga0495628_0078369 3300046516 Bacteria 2570
229 Ga0495630_0000060 3300046517 Bacteria 90021
230 Ga0495637_0161555 3300046520 Bacteria 840
231 Ga0495586_0014277 3300046535 Bacteria 4220
232 Ga0495586_0458442 3300046535 Bacteria 735
233 Ga0495587_0128311 3300046536 Bacteria 1450
234 Ga0495621_0001490 3300046539 Bacteria 6076
235 Ga0495645_0005265 3300046543 Bacteria 8861
236 Ga0495645_0649640 3300046543 Unclassified 644
237 Ga0495656_0000800 3300046615 Bacteria 10185
238 Ga0495634_0000059 3300046642 Bacteria 88314
239 Ga0495634_0019243 3300046642 Bacteria 4852
240 Ga0495634_0097746 3300046642 Bacteria 1900
241 Ga0495625_0328155 3300046660 Unclassified 973
242 Ga0495635_0000057 3300046663 Bacteria 67714
243 Ga0495635_0379077 3300046663 Bacteria 941
244 Ga0495588_0000229 3300046674 Bacteria 50351
245 Ga0495588_0158256 3300046674 Bacteria 1198
246 Ga0495657_0053901 3300046675 Bacteria 2689
247 Ga0495657_0075691 3300046675 Bacteria 2188
248 Ga0495599_0013261 3300046678 Bacteria 5092
249 Ga0495646_0162194 3300046680 Bacteria 1237
250 Ga0495646_0516298 3300046680 Unclassified 612
251 Ga0495647_0010858 3300046681 Bacteria 3110
252 Ga0495647_0058853 3300046681 Bacteria 1511
253 Ga0495647_0076212 3300046681 Bacteria 1351
254 Ga0495658_0000002 3300046683 Bacteria 309651
255 Ga0495658_0017135 3300046683 Bacteria 3738
256 Ga0495669_0012895 3300046684 Bacteria 3558
257 Ga0495669_0025492 3300046684 Bacteria 2579
258 Ga0495613_0004788 3300046689 Bacteria 10154
259 Ga0495613_0266809 3300046689 Bacteria 1191
260 Ga0495624_0118693 3300046690 Bacteria 1625
261 Ga0495624_0141498 3300046690 Bacteria 1473
262 Ga0495670_0746940 3300046691 Bacteria 534
263 Ga0495600_0165169 3300046809 Bacteria 1430
264 Ga0495660_0149200 3300046810 Bacteria 1156
265 Ga0495604_0000100 3300047317 Bacteria 72995
266 Ga0495604_0296075 3300047317 Bacteria 1088
267 Ga0495676_0000346 3300047321 Bacteria 37821
268 Ga0495676_0008907 3300047321 Bacteria 9166
269 Ga0495676_0041908 3300047321 Bacteria 3764
270 Ga0495676_0310513 3300047321 Bacteria 1061
271 Ga0495680_0000312 3300047322 Bacteria 54495
272 Ga0495680_0003619 3300047322 Bacteria 15122
273 Ga0495686_0132026 3300047472 Bacteria 1480
274 Ga0495602_0334433 3300048088 Bacteria 1097
275 Ga0496100_0000001 3300048903 Bacteria 530179
276 Ga0496100_0000010 3300048903 Bacteria 205204
277 Ga0496100_0518916 3300048903 Bacteria 919
278 Ga0496101_0000004 3300048904 Bacteria 331599
279 Ga0496101_0000025 3300048904 Bacteria 205204
280 Ga0496101_0363722 3300048904 Bacteria 1137
281 Ga0496102_0123681 3300048905 Bacteria 2417
282 Ga0496102_0556951 3300048905 Bacteria 1069
283 Ga0496103_0068876 3300048906 Bacteria 2211
284 Ga0496104_0000024 3300048907 Bacteria 229913
285 Ga0496104_0019269 3300048907 Bacteria 6240
286 Ga0496105_0000013 3300048908 Bacteria 229894
287 Ga0496105_0069629 3300048908 Bacteria 2908
288 Ga0496105_0205764 3300048908 Bacteria 1605
289 Ga0496106_0000012 3300048909 Bacteria 205158
290 Ga0496106_0008407 3300048909 Bacteria 7634
291 Ga0496106_0121876 3300048909 Bacteria 2039
292 Ga0496107_0000002 3300048910 Bacteria 320871
293 Ga0496107_0000010 3300048910 Bacteria 205188
294 Ga0496107_0036920 3300048910 Bacteria 3506
295 Ga0496108_0000006 3300048911 Bacteria 469473
296 Ga0496108_0115941 3300048911 Bacteria 2294
297 Ga0496108_0386040 3300048911 Bacteria 1223
298 Ga0496109_0000004 3300048912 Bacteria 404818
299 Ga0496109_1365088 3300048912 Bacteria 644
300 Ga0496110_0070708 3300048913 Bacteria 3093
301 Ga0496110_0147510 3300048913 Bacteria 2129
302 Ga0496110_0341644 3300048913 Bacteria 1364
303 Ga0496110_0718370 3300048913 Bacteria 901
304 Ga0496110_1485804 3300048913 Bacteria 587
305 Ga0496111_0122749 3300048914 Bacteria 1919
306 Ga0496111_0231807 3300048914 Bacteria 1371
307 Ga0496111_0632391 3300048914 Bacteria 782
308 Ga0496111_0726522 3300048914 Bacteria 721
309 Ga0496112_0000006 3300048915 Bacteria 365227
310 Ga0496113_0042961 3300048916 Bacteria 3342
311 Ga0496113_0505320 3300048916 Bacteria 970
312 Ga0496113_0510050 3300048916 Bacteria 965
313 Ga0496114_0114718 3300048917 Bacteria 2310
314 Ga0496114_0160207 3300048917 Bacteria 1956
315 Ga0496114_1164357 3300048917 Bacteria 657
316 Ga0496116_0000257 3300048919 Bacteria 93214
317 Ga0496117_0006062 3300048920 Bacteria 12411
318 Ga0496117_0213951 3300048920 Bacteria 1078
319 Ga0496118_0005497 3300048921 Bacteria 14381
320 Ga0496118_0051150 3300048921 Bacteria 3163
321 Ga0496119_0026965 3300048922 Bacteria 3967
322 Ga0496120_0009134 3300048923 Bacteria 7071
323 Ga0496120_0064758 3300048923 Bacteria 2028
324 Ga0496121_0010139 3300048924 Bacteria 10675
325 Ga0496121_0077558 3300048924 Bacteria 2645
326 Ga0496121_0169476 3300048924 Bacteria 1588
327 Ga0496124_0846606 3300048927 Bacteria 561
328 Ga0496125_0055663 3300048928 Bacteria 3220
329 Ga0496125_0116794 3300048928 Bacteria 1915
330 Ga0496125_0220800 3300048928 Bacteria 1221
331 Ga0496125_0389677 3300048928 Bacteria 818
332 Ga0496126_0062881 3300048929 Bacteria 3328
333 Ga0496126_0297475 3300048929 Bacteria 1333
334 Ga0496126_0344918 3300048929 Bacteria 1219
335 Ga0496126_0672289 3300048929 Bacteria 808
336 Ga0501031_0000682 3300049568 Bacteria 20260
337 Ga0501032_0033562 3300049569 Bacteria 3515
338 Ga0501032_0406470 3300049569 Bacteria 874
339 Ga0501033_0000534 3300049570 Bacteria 35503
340 Ga0501034_0003560 3300049571 Bacteria 17700
341 Ga0501034_0075794 3300049571 Bacteria 3370
342 Ga0501034_0166673 3300049571 Bacteria 2171
343 Ga0501034_0348581 3300049571 Bacteria 1409
344 Ga0501034_1203223 3300049571 Bacteria 636
345 Ga0501036_0000680 3300049572 Bacteria 25035
346 Ga0501036_0525534 3300049572 Bacteria 984
347 Ga0501037_0000719 3300049573 Bacteria 25133
348 Ga0501038_0001734 3300049574 Bacteria 20296
349 Ga0501039_0181732 3300049575 Bacteria 1654
350 Ga0501039_0212804 3300049575 Bacteria 1520
351 Ga0501040_0233834 3300049576 Bacteria 1309
352 Ga0501042_0074542 3300049578 Bacteria 2429
353 Ga0501043_0000291 3300049579 Bacteria 45276
354 Ga0501043_0331193 3300049579 Bacteria 1159
355 Ga0501046_0001836 3300049580 Bacteria 20241
356 Ga0501046_0658707 3300049580 Bacteria 740
357 Ga0501047_0000313 3300049581 Bacteria 55964
358 Ga0501047_0004429 3300049581 Bacteria 13226
359 Ga0501047_0036397 3300049581 Bacteria 4757
360 Ga0501047_0082792 3300049581 Bacteria 3084
361 Ga0501047_0115397 3300049581 Bacteria 2567
362 Ga0501047_0647324 3300049581 Bacteria 876
363 Ga0501048_0008340 3300049582 Bacteria 7835
364 Ga0501067_0255268 3300049583 Bacteria 976
365 Ga0501068_0082306 3300049584 Bacteria 1977
366 Ga0501068_0126626 3300049584 Bacteria 1595
367 Ga0501068_0767728 3300049584 Bacteria 631
368 Ga0501068_0781001 3300049584 Bacteria 626
369 Ga0501069_0008174 3300049585 Bacteria 5495
370 Ga0501069_0027529 3300049585 Bacteria 3114
371 Ga0501070_0000308 3300049586 Bacteria 44689
372 Ga0501070_0003118 3300049586 Bacteria 14437
373 Ga0501070_0149165 3300049586 Bacteria 1929
374 Ga0501071_0163090 3300049587 Bacteria 1666
375 Ga0501072_0111716 3300049588 Bacteria 2175
376 Ga0501072_0158471 3300049588 Bacteria 1805
377 Ga0501072_0338581 3300049588 Bacteria 1195
378 Ga0501073_0036767 3300049589 Bacteria 3478
379 Ga0501073_0273097 3300049589 Bacteria 1166
380 Ga0501074_0024186 3300049590 Bacteria 4415
381 Ga0501074_0123888 3300049590 Bacteria 1848
382 Ga0501074_0145248 3300049590 Bacteria 1696
383 Ga0501076_0128727 3300049592 Bacteria 2052
384 Ga0501079_0026475 3300049741 Bacteria 4446
385 Ga0501079_0147464 3300049741 Bacteria 1834
386 Ga0501079_0322253 3300049741 Bacteria 1210
387 Ga0501080_0048663 3300049742 Bacteria 3945
388 Ga0501080_0114240 3300049742 Bacteria 2503
389 Ga0501080_0447440 3300049742 Bacteria 1158
390 Ga0501081_0790254 3300049743 Bacteria 714
391 Ga0501083_0008321 3300049744 Bacteria 7337
392 Ga0501083_0011546 3300049744 Bacteria 6195
393 Ga0501083_0044916 3300049744 Bacteria 2990
394 Ga0501035_0000736 3300049822 Bacteria 35413
395 Ga0501044_0000211 3300049823 Bacteria 73920
396 Ga0501044_0057786 3300049823 Bacteria 3980
397 Ga0501044_0752754 3300049823 Bacteria 856
398 Ga0501045_0374336 3300049824 Bacteria 1060
399 Ga0501045_0464467 3300049824 Bacteria 941
400 Ga0501045_0798937 3300049824 Bacteria 695
401 Ga0501045_0906406 3300049824 Bacteria 648
402 nmdc:mga03n38_13318_c1 3300050490 Bacteria 3120
403 nmdc:mga00v17_20105_c1 3300050491 Bacteria 3821
404 nmdc:mga00v17_710667_c1 3300050491 Bacteria 644
405 nmdc:mga0yw44_30815_c2 3300050492 Bacteria 1811
406 nmdc:mga0yw44_381896_c1 3300050492 Unclassified 951
407 nmdc:mga0yw44_871223_c1 3300050492 Bacteria 611
408 nmdc:mga0yw44_89776_c1 3300050492 Bacteria 1940
409 nmdc:mga04h51_166100_c1 3300050495 Bacteria 852
410 nmdc:mga0qj67_378863_c1 3300050509 Bacteria 1143
411 nmdc:mga06r32_277242_c1 3300050510 Bacteria 1664
412 nmdc:mga06r32_290079_c1 3300050510 Bacteria 1623
413 nmdc:mga0n895_305215_c1 3300050512 Bacteria 1613
414 nmdc:mga0a205_7810_c1 3300050515 Bacteria 9715
415 Ga0495601_0000261 3300053077 Bacteria 28454
416 Ga0495601_0013682 3300053077 Bacteria 4880
417 Ga0495601_1000044 3300053077 Unclassified 526
418 Ga0495612_0000880 3300053078 Bacteria 12262
419 Ga0495612_0008451 3300053078 Bacteria 4175
420 Ga0495612_0074948 3300053078 Bacteria 1415
421 Ga0495595_0413264 3300053084 Bacteria 684
422 Ga0495619_0000010 3300053085 Bacteria 302390
423 Ga0495619_0000765 3300053085 Bacteria 20982
424 Ga0495619_0002751 3300053085 Bacteria 11480
425 Ga0495619_0005241 3300053085 Bacteria 8218
426 Ga0500566_0000943 3300053094 Bacteria 16679
427 Ga0500554_007652 3300053102 Bacteria 2497
428 Ga0500595_009661 3300053119 Bacteria 3883
429 Ga0500614_068854 3300053123 Bacteria 967
430 Ga0501082_0064322 3300060353 Bacteria 3159
431 Ga0496119_0003792
432 JGI24746J21847_1000516
433 JGI24751J29686_10038121
434 rootL2_10273478
435 Ga0070683_100005111
436 Ga0070683_100077794
437 Ga0070683_101252499
438 Ga0070677_10000082
439 Ga0070666_10122694
440 Ga0070666_10215568
441 Ga0070680_101799226
442 Ga0070682_100000017
443 Ga0068868_100000033
444 Ga0070689_100115196
445 Ga0070661_100000121
446 Ga0070661_101407745
447 Ga0070668_100001145
448 Ga0070668_100164783
449 Ga0070669_100203553
450 Ga0070674_100000002
451 Ga0070674_100000009
452 Ga0070714_100152320
453 Ga0070714_100660812
454 Ga0070711_100003868
455 Ga0070700_100453888
456 Ga0070700_100883141
457 Ga0070663_100000065
458 Ga0070663_100382503
459 Ga0070678_100012972
460 Ga0070678_100035649
461 Ga0070662_100000002
462 Ga0070681_10230121
463 Ga0070681_10396679
464 Ga0068867_100004390
465 Ga0070679_100002020
466 Ga0070679_100170416
467 Ga0070679_100385516
468 Ga0070684_100010013
469 Ga0070684_100011008
470 Ga0070684_100862836
471 Ga0068853_100025426
472 Ga0070686_100029755
473 Ga0070693_100000406
474 Ga0070665_100000040
475 Ga0070665_100003676
476 Ga0068855_100242393
477 Ga0068855_100256173
478 Ga0070664_100381821
479 Ga0068854_100117494
480 Ga0068856_100000237
481 Ga0068856_100003571
482 Ga0068856_100017715
483 Ga0068852_100000002
484 Ga0068864_100000015
485 Ga0068866_10000003
486 Ga0068866_10000036
487 Ga0068861_100068033
488 Ga0068851_10060758
489 Ga0068863_100001187
490 Ga0068858_100000156
491 Ga0068860_100004826
492 Ga0068862_101295642
493 Ga0081455_10042559
494 Ga0081455_10406052
495 Ga0081540_1157397
496 Ga0075365_10049928
497 Ga0075365_10118597
498 Ga0075365_10921484
499 Ga0075368_10140541
500 Ga0075363_100122194
501 Ga0075363_100627828
502 Ga0075364_10039119
503 Ga0075364_10325955
504 Ga0075364_10669280
505 Ga0070715_10000001
506 Ga0070712_100077517
507 Ga0075430_100144120
508 Ga0075431_100003809
509 Ga0075431_100214239
510 Ga0075433_10009335
511 Ga0075434_100306331
512 Ga0105250_10222617
513 Ga0105240_11425260
514 Ga0111539_10512681
515 Ga0105245_10000201
516 Ga0105245_10006128
517 Ga0105247_10229602
518 Ga0105247_11522994
519 Ga0114129_12289170
520 Ga0105243_10065299
521 Ga0105243_11368475
522 Ga0105242_10024452
523 Ga0105248_10000175
524 Ga0105237_10905475
525 Ga0105238_10000009
526 Ga0105238_10535101
527 Ga0105249_10000050
528 Ga0105249_12155998
529 Ga0105239_10637320
530 Ga0105239_10829214
531 Ga0105239_11552515
532 Ga0105246_10122598
533 Ga0157370_10009925
534 Ga0157374_10013622
535 Ga0157374_10418024
536 Ga0157378_10098914
537 Ga0157378_10826779
538 Ga0163162_11426264
539 Ga0157372_10535423
540 Ga0157372_12362999
541 Ga0157375_10000584
542 Ga0157375_11002868
543 Ga0163163_10174037
544 Ga0163163_10741586
545 Ga0157380_10001197
546 Ga0157380_10139726
547 Ga0157379_10013140
548 Ga0157379_10941904
549 Ga0157376_10134188
550 Ga0207656_10043544
551 Ga0207682_10000018
552 Ga0207642_10000002
553 Ga0207642_10000377
554 Ga0207680_10007438
555 Ga0207680_10024487
556 Ga0207680_10258557
557 Ga0207685_10000005
558 Ga0207705_10289941
559 Ga0207684_10655767
560 Ga0207654_10560532
561 Ga0207707_10020589
562 Ga0207707_10291485
563 Ga0207695_11320161
564 Ga0207671_10129317
565 Ga0207693_10082967
566 Ga0207663_10001006
567 Ga0207660_11055421
568 Ga0207649_10000003
569 Ga0207649_10209542
570 Ga0207652_10011749
571 Ga0207652_10015740
572 Ga0207694_10000004
573 Ga0207687_10000015
574 Ga0207687_10000020
575 Ga0207687_10001695
576 Ga0207687_10966782
577 Ga0207664_10228180
578 Ga0207706_10000001
579 Ga0207686_10042696
580 Ga0207709_10072697
581 Ga0207670_10522488
582 Ga0207669_10000001
583 Ga0207669_10000003
584 Ga0207669_11403585
585 Ga0207665_10116247
586 Ga0207711_10000006
587 Ga0207711_10101206
588 Ga0207661_10009225
589 Ga0207661_10009386
590 Ga0207661_10092868
591 Ga0207679_10311534
592 Ga0207667_10189094
593 Ga0207651_10001383
594 Ga0207712_10000019
595 Ga0207712_10488614
596 Ga0207640_10083999
597 Ga0207658_10002662
598 Ga0207658_10193597
599 Ga0207677_10002270
600 Ga0207703_10000704
601 Ga0207639_10036439
602 Ga0207678_10000253
603 Ga0207678_11052003
604 Ga0207708_10384130
605 Ga0207708_10746526
606 Ga0207702_10000251
607 Ga0207702_10002325
608 Ga0207702_10018073
609 Ga0207702_10217649
610 Ga0207702_10959157
611 Ga0207641_10000827
612 Ga0207648_10008149
613 Ga0207676_10000018
614 Ga0207675_100801634
615 Ga0207683_10013570
616 Ga0207683_10148883
617 Ga0207698_10000004
618 Ga0209813_10142164
619 Ga0268266_10000045
620 Ga0268266_10000491
621 Ga0268266_10001210
622 Ga0268266_12372414
623 Ga0268265_10110742
624 Ga0268265_11939312
625 Ga0316576_10039140
626 Ga0316578_10228041
627 Ga0316574_0075593
628 Ga0373947_0663523
629 Ga0373937_0644600
630 Ga0451853_3960444
631 Ga0439459_0102608
632 Ga0466963_0000127
633 Ga0466960_0270196
634 Ga0466960_0340744
635 Ga0466967_0172081
636 Ga0466967_1981223
637 Ga0495592_0069782
638 Ga0495592_0210973
639 Ga0495629_0004716
640 Ga0495629_0250233
641 Ga0495629_0447260
642 Ga0495638_0027318
643 Ga0495641_0000214
644 Ga0495641_0192014
645 Ga0495651_0051355
646 Ga0495651_0169163
647 Ga0495651_0196049
648 Ga0495653_0102454
649 Ga0495582_0000009
650 Ga0495639_0038529
651 Ga0495662_0007572
652 Ga0495662_0301393
653 Ga0495664_0183943
654 Ga0495606_0000017
655 Ga0495610_0031729
656 Ga0495620_0004866
657 Ga0495628_0020460
658 Ga0495628_0078369
659 Ga0495630_0000060
660 Ga0495637_0161555
661 Ga0495586_0014277
662 Ga0495586_0458442
663 Ga0495587_0128311
664 Ga0495621_0001490
665 Ga0495645_0005265
666 Ga0495645_0649640
667 Ga0495656_0000800
668 Ga0495634_0000059
669 Ga0495634_0019243
670 Ga0495634_0097746
671 Ga0495625_0328155
672 Ga0495635_0000057
673 Ga0495635_0379077
674 Ga0495588_0000229
675 Ga0495588_0158256
676 Ga0495657_0053901
677 Ga0495657_0075691
678 Ga0495599_0013261
679 Ga0495646_0162194
680 Ga0495646_0516298
681 Ga0495647_0010858
682 Ga0495647_0058853
683 Ga0495647_0076212
684 Ga0495658_0000002
685 Ga0495658_0017135
686 Ga0495669_0012895
687 Ga0495669_0025492
688 Ga0495613_0004788
689 Ga0495613_0266809
690 Ga0495624_0118693
691 Ga0495624_0141498
692 Ga0495670_0746940
693 Ga0495600_0165169
694 Ga0495660_0149200
695 Ga0495604_0000100
696 Ga0495604_0296075
697 Ga0495676_0000346
698 Ga0495676_0008907
699 Ga0495676_0041908
700 Ga0495676_0310513
701 Ga0495680_0000312
702 Ga0495680_0003619
703 Ga0495686_0132026
704 Ga0495602_0334433
705 Ga0496100_0000001
706 Ga0496100_0000010
707 Ga0496100_0518916
708 Ga0496101_0000004
709 Ga0496101_0000025
710 Ga0496101_0363722
711 Ga0496102_0123681
712 Ga0496102_0556951
713 Ga0496103_0068876
714 Ga0496104_0000024
715 Ga0496104_0019269
716 Ga0496105_0000013
717 Ga0496105_0069629
718 Ga0496105_0205764
719 Ga0496106_0000012
720 Ga0496106_0008407
721 Ga0496106_0121876
722 Ga0496107_0000002
723 Ga0496107_0000010
724 Ga0496107_0036920
725 Ga0496108_0000006
726 Ga0496108_0115941
727 Ga0496108_0386040
728 Ga0496109_0000004
729 Ga0496109_1365088
730 Ga0496110_0070708
731 Ga0496110_0147510
732 Ga0496110_0341644
733 Ga0496110_0718370
734 Ga0496110_1485804
735 Ga0496111_0122749
736 Ga0496111_0231807
737 Ga0496111_0632391
738 Ga0496111_0726522
739 Ga0496112_0000006
740 Ga0496113_0042961
741 Ga0496113_0505320
742 Ga0496113_0510050
743 Ga0496114_0114718
744 Ga0496114_0160207
745 Ga0496114_1164357
746 Ga0496116_0000257
747 Ga0496117_0006062
748 Ga0496117_0213951
749 Ga0496118_0005497
750 Ga0496118_0051150
751 Ga0496119_0026965
752 Ga0496120_0009134
753 Ga0496120_0064758
754 Ga0496121_0010139
755 Ga0496121_0077558
756 Ga0496121_0169476
757 Ga0496124_0846606
758 Ga0496125_0055663
759 Ga0496125_0116794
760 Ga0496125_0220800
761 Ga0496125_0389677
762 Ga0496126_0062881
763 Ga0496126_0297475
764 Ga0496126_0344918
765 Ga0496126_0672289
766 Ga0501031_0000682
767 Ga0501032_0033562
768 Ga0501032_0406470
769 Ga0501033_0000534
770 Ga0501034_0003560
771 Ga0501034_0075794
772 Ga0501034_0166673
773 Ga0501034_0348581
774 Ga0501034_1203223
775 Ga0501036_0000680
776 Ga0501036_0525534
777 Ga0501037_0000719
778 Ga0501038_0001734
779 Ga0501039_0181732
780 Ga0501039_0212804
781 Ga0501040_0233834
782 Ga0501042_0074542
783 Ga0501043_0000291
784 Ga0501043_0331193
785 Ga0501046_0001836
786 Ga0501046_0658707
787 Ga0501047_0000313
788 Ga0501047_0004429
789 Ga0501047_0036397
790 Ga0501047_0082792
791 Ga0501047_0115397
792 Ga0501047_0647324
793 Ga0501048_0008340
794 Ga0501067_0255268
795 Ga0501068_0082306
796 Ga0501068_0126626
797 Ga0501068_0767728
798 Ga0501068_0781001
799 Ga0501069_0008174
800 Ga0501069_0027529
801 Ga0501070_0000308
802 Ga0501070_0003118
803 Ga0501070_0149165
804 Ga0501071_0163090
805 Ga0501072_0111716
806 Ga0501072_0158471
807 Ga0501072_0338581
808 Ga0501073_0036767
809 Ga0501073_0273097
810 Ga0501074_0024186
811 Ga0501074_0123888
812 Ga0501074_0145248
813 Ga0501076_0128727
814 Ga0501079_0026475
815 Ga0501079_0147464
816 Ga0501079_0322253
817 Ga0501080_0048663
818 Ga0501080_0114240
819 Ga0501080_0447440
820 Ga0501081_0790254
821 Ga0501083_0008321
822 Ga0501083_0011546
823 Ga0501083_0044916
824 Ga0501035_0000736
825 Ga0501044_0000211
826 Ga0501044_0057786
827 Ga0501044_0752754
828 Ga0501045_0374336
829 Ga0501045_0464467
830 Ga0501045_0798937
831 Ga0501045_0906406
832 nmdc:mga03n38_13318_c1
833 nmdc:mga00v17_20105_c1
834 nmdc:mga00v17_710667_c1
835 nmdc:mga0yw44_30815_c2
836 nmdc:mga0yw44_381896_c1
837 nmdc:mga0yw44_871223_c1
838 nmdc:mga0yw44_89776_c1
839 nmdc:mga04h51_166100_c1
840 nmdc:mga0qj67_378863_c1
841 nmdc:mga06r32_277242_c1
842 nmdc:mga06r32_290079_c1
843 nmdc:mga0n895_305215_c1
844 nmdc:mga0a205_7810_c1
845 Ga0495601_0000261
846 Ga0495601_0013682
847 Ga0495601_1000044
848 Ga0495612_0000880
849 Ga0495612_0008451
850 Ga0495612_0074948
851 Ga0495595_0413264
852 Ga0495619_0000010
853 Ga0495619_0000765
854 Ga0495619_0002751
855 Ga0495619_0005241
856 Ga0500566_0000943
857 Ga0500554_007652
858 Ga0500595_009661
859 Ga0500614_068854
860 Ga0501082_0064322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

4

122

0.9

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

6

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8935 3 144
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.8931 6 144
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.8833 7 146
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.8813 7 143
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.8805 1 144
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8938 6 145 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8806 1 144 3.10.129.10
af_Q5A4W7_1240_1442_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8738 8 145 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8732 8 141 3.10.129.10
2uvaG08 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8646 9 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A537ZWW6-F1-model_v4 MaoC family dehydratase 0.9862 34 146
AF-A0A537ZWW6-F1-model_v4 MaoC family dehydratase 0.9692 34 146
AF-A0A538ICL0-F1-model_v4 MaoC family dehydratase 0.9578 73 146
AF-A0A538AMH9-F1-model_v4 MaoC family dehydratase 0.9556 3 145 GO:0006633
GO:0019171
AF-A0A7Y5XYS2-F1-model_v4 MaoC family dehydratase 0.9541 14 144 GO:0016836

Map