F442271

General Info

Members Datasets Scaffolds Average Seq Length
430 407 860 288

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2889790730|2889793007
Length 305
Sequence APIAASPTASPATLRRLTDGKALPIAIVVASIVLIWYGFTVYLNAPWQIGLYQRAGAEWTASDLVRDTMAQERPVLPAPHQVVAEMWKTTVETRPTSNRSLLNHAWITLSSTLLGFAIGTTLGVLLAVGIVHNRAMDKSVMPWVIASQTIPILAIAPMIIVVLNAIGLSGILPKALISTYLSFFPVVVGMVKGFRSPEAIQLDLMRTYNASRTQTFFRLRWPSALPFLFTSMKVAVAISLVGAIVGELPTGAVAGLGARLLAGSYYGQTIQIWAALFMAAALAAILVALVGLAQRLVMARMGARP

Samples

Sample ID Description Type Environment
1 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
33 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
34 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
35 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
36 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
37 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
62 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
63 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
71 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
82 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
88 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
111 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
112 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
113 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
114 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
117 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
118 2509276019 Ensifer aridi TW10 Isolate Nodule
119 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
120 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
121 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
122 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
123 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
124 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
125 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
126 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
127 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
128 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
129 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
130 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
131 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
132 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
133 2516143018 Ensifer sp. BR816 Isolate Nodule
134 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
135 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
136 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
137 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
138 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
139 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
140 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
141 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
142 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
143 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
144 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
145 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
146 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
147 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
148 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
149 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
150 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
151 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
152 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
153 2643221557 Ensifer sp. Root558 Isolate Unclassified
154 2643221558 Rhizobium sp. Root149 Isolate Unclassified
155 2643221580 Devosia sp. Root635 Isolate Unclassified
156 2643221607 Rhizobium sp. Root73 Isolate Unclassified
157 2643221610 Ensifer sp. Root74 Isolate Unclassified
158 2643221618 Ensifer sp. Root231 Isolate Unclassified
159 2643221626 Ensifer sp. Root31 Isolate Unclassified
160 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
161 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
162 2643221655 Ensifer sp. Root1252 Isolate Unclassified
163 2643221659 Ensifer sp. Root127 Isolate Unclassified
164 2643221668 Ensifer sp. Root423 Isolate Unclassified
165 2643221675 Ensifer sp. Root1298 Isolate Unclassified
166 2643221680 Ensifer sp. Root1312 Isolate Unclassified
167 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
168 2643221688 Rhizobium sp. Root482 Isolate Unclassified
169 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
170 2643221698 Ensifer sp. Root142 Isolate Unclassified
171 2643221712 Ensifer sp. Root258 Isolate Unclassified
172 2643221718 Rhizobium sp. Root268 Isolate Unclassified
173 2643221723 Ensifer sp. Root278 Isolate Unclassified
174 2643221726 Ensifer sp. Root954 Isolate Unclassified
175 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
176 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
177 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
178 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
179 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
180 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
181 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
182 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
183 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
184 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
185 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
186 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
187 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
188 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
189 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
190 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
191 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
192 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
193 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
194 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
195 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
196 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
197 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
198 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
199 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
200 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
201 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
202 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
203 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
204 2844163670 Ensifer sp. 1H6 Isolate Unclassified
205 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
206 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
207 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
208 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
209 2854911287 Brucella lupini LUP21 Isolate Unclassified
210 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
211 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
212 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
213 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
214 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
215 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
216 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
217 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
218 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
219 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
220 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
221 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
222 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
223 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
224 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
225 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
226 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
227 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
228 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
229 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
230 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
231 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
232 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
233 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
234 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
235 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
236 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
237 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
238 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
239 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
240 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
241 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
242 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
243 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
244 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
245 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
246 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
247 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
248 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
249 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
250 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
251 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
252 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
253 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
254 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
255 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
256 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
257 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
258 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
259 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
260 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
261 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
262 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
263 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
264 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
265 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
266 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
267 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
268 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
269 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
270 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
271 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
272 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
273 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
274 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
275 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
276 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
277 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
278 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
279 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
280 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
281 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
282 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
283 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
284 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
285 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
286 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
287 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
288 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
289 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
290 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
291 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
292 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
293 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
294 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
295 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
296 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
297 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
298 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
299 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
300 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
301 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
302 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
303 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
304 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
305 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
306 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
307 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
308 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
309 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
310 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
311 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
312 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
313 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
314 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
315 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
316 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
317 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
318 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
319 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
320 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
321 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
322 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
323 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
324 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
325 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
326 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
327 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
328 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
329 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
330 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
331 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
332 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
333 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
334 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
335 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
336 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
337 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
338 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
339 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
340 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
341 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
342 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
343 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
344 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
345 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
346 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
347 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
348 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
349 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
350 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
351 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
352 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
353 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
354 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
355 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
356 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
357 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
358 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
359 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
360 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
361 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
362 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
363 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
364 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
365 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
366 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
367 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
368 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
369 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
370 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
371 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
372 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
373 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
374 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
375 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
376 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
377 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
378 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
379 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
380 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
381 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
382 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
383 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
384 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
385 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
386 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
387 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
388 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
389 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
390 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
391 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
392 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
393 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
394 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
395 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
396 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
397 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
398 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
399 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
400 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
401 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
402 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
403 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
404 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
405 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
406 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
407 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 31.63
Metatranscriptomes 0.23
Isolates 68.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 53.26
Rhizoplane 1.16
Rhizosphere 19.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000008 3300002987 Bacteria 172667
2 JGI25160J50197_1000033 3300003354 Bacteria 172667
3 JGI25161J50226_1001306 3300003374 Bacteria 7853
4 Ga0006562J51391_1004059 3300003578 Bacteria 7408
5 Ga0055526_1000653 3300003771 Bacteria 26790
6 Ga0055524_1003306 3300003775 Bacteria 7872
7 Ga0055536_1004025 3300003781 Bacteria 7663
8 Ga0055531_10027789 3300003794 Bacteria 1972
9 Ga0055543_1000026 3300004625 Bacteria 136177
10 Ga0065165_1000178 3300005262 Bacteria 113319
11 Ga0070661_100004986 3300005344 Bacteria 9143
12 Ga0070661_100017373 3300005344 Bacteria 5104
13 Ga0070668_100012105 3300005347 Bacteria 6425
14 Ga0070667_100502757 3300005367 Bacteria 1111
15 Ga0068853_100000271 3300005539 Bacteria 36616
16 Ga0070686_100063210 3300005544 Bacteria 2397
17 Ga0068857_100125082 3300005577 Bacteria 2317
18 Ga0068854_100055149 3300005578 Bacteria 2860
19 Ga0068852_100006113 3300005616 Bacteria 8681
20 Ga0068851_10003553 3300005834 Bacteria 6941
21 Ga0075368_10036869 3300006042 Bacteria 1911
22 Ga0075363_100031257 3300006048 Bacteria 2759
23 Ga0075364_10012404 3300006051 Bacteria 5211
24 Ga0075362_10002360 3300006177 Bacteria 6320
25 Ga0075369_10166470 3300006186 Bacteria 1011
26 Ga0079104_1001481 3300006946 Bacteria 15645
27 Ga0079104_1009204 3300006946 Bacteria 3366
28 Ga0105243_10153629 3300009148 Bacteria 1977
29 Ga0105241_10014223 3300009174 Bacteria 5830
30 Ga0105238_10072179 3300009551 Bacteria 3449
31 Ga0105239_10579818 3300010375 Bacteria 1279
32 Ga0171463_1007 3300013249 Bacteria 301198
33 Ga0157378_10227522 3300013297 Bacteria 1775
34 Ga0183363_1084 3300015690 Bacteria 28436
35 Ga0214544_1000010 3300021320 Bacteria 270164
36 Ga0214542_1000023 3300021321 Bacteria 191557
37 Ga0214543_1000019 3300021327 Bacteria 267908
38 Ga0214543_1000022 3300021327 Bacteria 241930
39 Ga0228711_1000017 3300022739 Bacteria 121084
40 Ga0228710_1000005 3300022740 Bacteria 233531
41 Ga0209130_1000017 3300025284 Bacteria 388431
42 Ga0209676_1001868 3300025292 Bacteria 17327
43 Ga0209025_1000153 3300025294 Bacteria 170548
44 Ga0209564_1000013 3300025295 Bacteria 775755
45 Ga0209050_1003752 3300025298 Bacteria 10896
46 Ga0209256_1000211 3300025299 Bacteria 110131
47 Ga0209256_1009453 3300025299 Bacteria 4271
48 Ga0207426_1000006 3300025302 Bacteria 1025969
49 Ga0209257_1013610 3300025304 Bacteria 3593
50 Ga0207656_10003678 3300025321 Bacteria 5306
51 Ga0207649_10001014 3300025920 Bacteria 17344
52 Ga0207709_10008159 3300025935 Bacteria 5799
53 Ga0207640_10019181 3300025981 Bacteria 4035
54 Ga0207639_10001237 3300026041 Bacteria 17295
55 Ga0207674_10209108 3300026116 Bacteria 1900
56 Ga0207698_10015221 3300026142 Bacteria 5147
57 Ga0209281_1000082 3300027111 Bacteria 257684
58 Ga0209281_1000484 3300027111 Bacteria 55133
59 Ga0209282_1000006 3300027666 Bacteria 276998
60 Ga0307515_10000017 3300028794 Bacteria 550465
61 Ga0307515_10016027 3300028794 Bacteria 13756
62 Ga0307513_10000852 3300031456 Bacteria 44393
63 Ga0307513_10026587 3300031456 Bacteria 6668
64 Ga0316576_10041834 3300031727 Bacteria 3300
65 Ga0316578_10020559 3300031728 Bacteria 3650
66 Ga0307406_10037366 3300031901 Bacteria 2999
67 Ga0307412_10496561 3300031911 Bacteria 1015
68 Ga0315914_1000003 3300031967 Bacteria 314370
69 Ga0315913_1000001 3300033430 Bacteria 284459
70 Ga0315915_1000008 3300033464 Bacteria 258517
71 Ga0373935_0232142 3300035692 Bacteria 1285
72 Ga0373927_0002185 3300035695 Bacteria 14378
73 Ga0316584_0065527 3300036712 Bacteria 2721
74 Ga0316584_0142952 3300036712 Bacteria 1783
75 Ga0373925_0002324 3300037068 Bacteria 15297
76 Ga0400483_048939 3300039062 Bacteria 1726
77 Ga0400483_064186 3300039062 Bacteria 26495
78 Ga0400483_274439 3300039062 Bacteria 13218
79 Ga0436361_0923664 3300039447 Bacteria 3916
80 Ga0439436_0002887 3300041404 Bacteria 5222
81 Ga0439439_0031912 3300041406 Bacteria 1344
82 Ga0439465_0016416 3300041413 Bacteria 2309
83 Ga0451807_0877284 3300041486 Bacteria 1145
84 Ga0439449_0028381 3300042007 Bacteria 2086
85 Ga0439449_0103321 3300042007 Bacteria 1054
86 Ga0450906_014998 3300042145 Bacteria 1412
87 Ga0466965_0027951 3300044683 Bacteria 2739
88 Ga0451576_0018873 3300045051 Bacteria 7538
89 Ga0495638_0186998 3300046460 Bacteria 1178
90 Ga0495633_0064807 3300046558 Bacteria 1708
91 Ga0496116_0081633 3300048919 Bacteria 2003
92 Ga0496117_0014050 3300048920 Bacteria 6926
93 Ga0496118_0034836 3300048921 Bacteria 4100
94 Ga0496119_0017908 3300048922 Bacteria 5304
95 Ga0496120_0032322 3300048923 Bacteria 3156
96 Ga0496121_0000003 3300048924 Bacteria 1191431
97 Ga0496121_0043175 3300048924 Bacteria 3909
98 Ga0496122_0132086 3300048925 Bacteria 1583
99 Ga0496124_0000067 3300048927 Bacteria 222576
100 Ga0496124_0013289 3300048927 Bacteria 8045
101 Ga0496125_0000262 3300048928 Bacteria 108389
102 Ga0496126_0031796 3300048929 Bacteria 4980
103 Ga0496126_0120519 3300048929 Bacteria 2276
104 Ga0496126_0148529 3300048929 Bacteria 2011
105 Ga0496126_0265368 3300048929 Bacteria 1426
106 Ga0501032_0115820 3300049569 Bacteria 1772
107 Ga0501033_0227212 3300049570 Bacteria 1327
108 Ga0501034_0000012 3300049571 Bacteria 310504
109 Ga0501037_0040170 3300049573 Bacteria 3443
110 Ga0501037_0184681 3300049573 Bacteria 1478
111 Ga0501038_0122453 3300049574 Bacteria 2143
112 Ga0501038_0440626 3300049574 Bacteria 1003
113 Ga0501039_0100010 3300049575 Bacteria 2263
114 Ga0501043_0129745 3300049579 Bacteria 1976
115 Ga0501043_0302654 3300049579 Bacteria 1221
116 Ga0501047_0165955 3300049581 Bacteria 2078
117 Ga0501068_0255716 3300049584 Bacteria 1117
118 Ga0501070_0032344 3300049586 Bacteria 4377
119 Ga0501072_0201341 3300049588 Bacteria 1588
120 Ga0501073_0304715 3300049589 Bacteria 1099
121 Ga0501079_0214739 3300049741 Bacteria 1503
122 Ga0501080_0210434 3300049742 Bacteria 1782
123 Ga0501280_004079 3300049776 Bacteria 2173
124 Ga0501044_0256703 3300049823 Bacteria 1687
125 Ga0501044_0453255 3300049823 Bacteria 1189
126 nmdc:mga03683_4236_c1 3300050489 Bacteria 4729
127 nmdc:mga00v17_11871_c1 3300050491 Bacteria 4795
128 nmdc:mga00v17_34229_c1 3300050491 Bacteria 3015
129 nmdc:mga0sz30_148215_c1 3300050516 Bacteria 1037
130 Ga0500644_0002531 3300053088 Bacteria 4566
131 Ga0500618_004184 3300053125 Bacteria 4700
132 Ga0500573_0001859 3300053140 Bacteria 10276
133 Ga0500573_0092770 3300053140 Bacteria 1704
134 Ga0500577_0048876 3300053142 Bacteria 1580
135 Ga0500588_0009446 3300053146 Bacteria 2318
136 Ga0500622_0032103 3300053156 Bacteria 2753
137 Ga0501084_0416424 3300054114 Bacteria 1136
138 2889793007 2889790730 Bacteria 5689708
139 2509108020 2508501122 Bacteria 6292184
140 2509376800 2509276019 Bacteria 6802256
141 2510304097 2510065057 Bacteria 6649661
142 2510839327 2510461069 Bacteria 5505000
143 2511502531 2511231052 Bacteria 6974333
144 2512533905 2512047086 Bacteria 6850303
145 2512970336 2512875026 Bacteria 6861065
146 2513583164 2513237086 Bacteria 7265287
147 2513601400 2513237089 Bacteria 6553624
148 2513620310 2513237091 Bacteria 6900273
149 2513881782 2513237140 Bacteria 7076289
150 2513904926 2513237143 Bacteria 6664116
151 2513983597 2513237156 Bacteria 6402557
152 2513997547 2513237159 Bacteria 6810126
153 2514003153 2513237160 Bacteria 6650282
154 2515609318 2515154107 Bacteria 6795637
155 2516206048 2516143018 Bacteria 6951533
156 2516893906 2516653046 Bacteria 6989037
157 2517570626 2517487022 Bacteria 7227575
158 2524448271 2524023207 Bacteria 6813453
159 2551675298 2551306084 Bacteria 8942552
160 2551676708 2551306084 Bacteria 8942552
161 2551689418 2551306085 Bacteria 7347181
162 2551696008 2551306086 Bacteria 6843938
163 2551697245 2551306087 Bacteria 7351905
164 2551708854 2551306089 Bacteria 7162724
165 2551716341 2551306090 Bacteria 7953713
166 2551726451 2551306091 Bacteria 7086830
167 2551731804 2551306092 Bacteria 6992595
168 2551740969 2551306093 Bacteria 7064773
169 2558865842 2558860100 Bacteria 8458965
170 2585167581 2582581283 Bacteria 6030556
171 2585265811 2582581306 Bacteria 6450535
172 2585389058 2582581865 Bacteria 6644329
173 2585395201 2582581866 Bacteria 6859583
174 2599332123 2599185156 Bacteria 5403036
175 2600196046 2599185352 Bacteria 7228948
176 2643804413 2643221557 Bacteria 7184309
177 2643811097 2643221558 Bacteria 5460675
178 2643910802 2643221580 Bacteria 3816678
179 2644052073 2643221607 Bacteria 6314006
180 2644065183 2643221610 Bacteria 7480339
181 2644105476 2643221618 Bacteria 7717186
182 2644146479 2643221626 Bacteria 8069654
183 2644204866 2643221636 Bacteria 6583769
184 2644208670 2643221637 Bacteria 5345260
185 2644308227 2643221655 Bacteria 7722067
186 2644334051 2643221659 Bacteria 7890716
187 2644377593 2643221668 Bacteria 7306521
188 2644416855 2643221675 Bacteria 7473456
189 2644449895 2643221680 Bacteria 7473610
190 2644484816 2643221686 Bacteria 6310811
191 2644494187 2643221688 Bacteria 5260751
192 2644500628 2643221689 Bacteria 6042950
193 2644541648 2643221698 Bacteria 7756764
194 2644615509 2643221712 Bacteria 7729434
195 2644652200 2643221718 Bacteria 5345506
196 2644672751 2643221723 Bacteria 7095460
197 2644690030 2643221726 Bacteria 7455827
198 2657684842 2657244999 Bacteria 5946535
199 2692315156 2690316117 Bacteria 6800650
200 2715500681 2713897090 Bacteria 3353799
201 2739347123 2738543031 Bacteria 5769731
202 2753463331 2751185821 Bacteria 6189929
203 2765465955 2765235802 Bacteria 5618596
204 2770196590 2767802442 Bacteria 5747986
205 2776269302 2775506902 Bacteria 6208009
206 2776283559 2775506904 Bacteria 5954060
207 2776914322 2775507049 Bacteria 6284736
208 2792581560 2791355082 Bacteria 5973319
209 2792620457 2791355091 Bacteria 6135441
210 2792625815 2791355092 Bacteria 6248105
211 2792638758 2791355094 Bacteria 7011481
212 2793283771 2791355253 Bacteria 5171699
213 2802716693 2802428858 Bacteria 6636079
214 2802725504 2802428859 Bacteria 6667919
215 2802730404 2802428860 Bacteria 6525526
216 2802737624 2802428861 Bacteria 6534206
217 2802742986 2802428862 Bacteria 6633353
218 2802750410 2802428863 Bacteria 6410669
219 2804753028 2802429268 Bacteria 6094027
220 2819240971 2818991272 Bacteria 4622173
221 2838079649 2838074704 Bacteria 6785777
222 2839993588 2839993093 Bacteria 5512535
223 2840766595 2840764183 Bacteria 6358399
224 2840879378 2840878972 Bacteria 5483153
225 2842522210 2842521101 Bacteria 6569494
226 2842924478 2842922631 Bacteria 5824079
227 2844166390 2844163670 Bacteria 7266046
228 2847419788 2847417321 Bacteria 6913799
229 2848994804 2848992105 Bacteria 6810864
230 2850081803 2850079185 Bacteria 6848280
231 2854681685 2854681122 Bacteria 4548679
232 2854914157 2854911287 Bacteria 5582813
233 2855826631 2855825444 Bacteria 6785811
234 2855842022 2855839649 Bacteria 7135830
235 2855877304 2855872281 Bacteria 6964271
236 2858802696 2858800743 Bacteria 6603254
237 2889919414 2889914905 Bacteria 5702301
238 2894653456 2894652903 Bacteria 4587256
239 2896391238 2896384573 Bacteria 7700774
240 2898796403 2898795034 Bacteria 4294459
241 2899806705 2899803654 Bacteria 5577784
242 2904579714 2904578770 Bacteria 5302906
243 2913299094 2913295892 Bacteria 6333755
244 2915981166 2915980308 Bacteria 6624279
245 2915989941 2915986958 Bacteria 6739310
246 2915998536 2915993759 Bacteria 7016183
247 2916005073 2916000859 Bacteria 6865702
248 2916012987 2916007675 Bacteria 6898660
249 2916021087 2916014648 Bacteria 6946486
250 2916023044 2916021584 Bacteria 6854472
251 2916034206 2916028427 Bacteria 6748433
252 2916039336 2916035215 Bacteria 6755766
253 2916044400 2916041962 Bacteria 6820487
254 2916050448 2916048683 Bacteria 6543552
255 2916061505 2916055098 Bacteria 6758838
256 2916062029 2916061851 Bacteria 6737736
257 2916069358 2916068649 Bacteria 6943657
258 2916080498 2916076590 Bacteria 6596108
259 2919120619 2919119836 Bacteria 5208557
260 2919681491 2919679072 Bacteria 4629602
261 2920761161 2920760137 Bacteria 7427611
262 2920825651 2920822456 Bacteria 6897201
263 2921205503 2921201388 Bacteria 6926299
264 2921209701 2921208531 Bacteria 6745326
265 2921239284 2921237296 Bacteria 6876710
266 2921247818 2921244191 Bacteria 6568419
267 2921251675 2921250672 Bacteria 6677771
268 2921262628 2921257292 Bacteria 6808382
269 2921269639 2921263974 Bacteria 6864552
270 2921287158 2921282425 Bacteria 6826397
271 2921294094 2921289301 Bacteria 7316391
272 2921300505 2921296804 Bacteria 7176999
273 2924148558 2924144063 Bacteria 6883928
274 2924151505 2924150972 Bacteria 7169444
275 2924159911 2924158325 Bacteria 7188855
276 2924167539 2924165586 Bacteria 7260590
277 2924174621 2924172951 Bacteria 6749356
278 2924183751 2924179722 Bacteria 6843264
279 2924193115 2924186466 Bacteria 6876637
280 2924196465 2924193448 Bacteria 6955718
281 2924203915 2924200457 Bacteria 6757188
282 2924210826 2924207177 Bacteria 6917007
283 2924218204 2924214083 Bacteria 7080103
284 2924227405 2924221636 Bacteria 7113495
285 2924233246 2924228884 Bacteria 6633132
286 2928522514 2928521798 Bacteria 4960112
287 2929141163 2929138655 Bacteria 5810547
288 2937002782 2936996657 Bacteria 6298727
289 2937005347 2937002841 Bacteria 6934057
290 2937012882 2937009748 Bacteria 6746052
291 2937021852 2937016420 Bacteria 6782579
292 2937027357 2937023124 Bacteria 6815156
293 2937035657 2937029754 Bacteria 6424026
294 2937043859 2937042894 Bacteria 6741576
295 2937050304 2937049772 Bacteria 6757901
296 2937058369 2937056579 Bacteria 7107896
297 2937068671 2937063883 Bacteria 7199456
298 2937072393 2937071275 Bacteria 6984483
299 2937080719 2937078374 Bacteria 6610289
300 2937090110 2937084907 Bacteria 6618516
301 2937097413 2937091812 Bacteria 6979387
302 2937101128 2937098957 Bacteria 7249374
303 2937110235 2937106411 Bacteria 6947143
304 2937117660 2937113482 Bacteria 6505872
305 2937124492 2937119839 Bacteria 6597547
306 2937131438 2937126314 Bacteria 6771275
307 2937848075 2937843397 Bacteria 5256375
308 2937876050 2937868953 Bacteria 6639878
309 2941504582 2941499720 Bacteria 7599444
310 2957380668 2957375807 Bacteria 6425588
311 2957382535 2957382221 Bacteria 6737050
312 2957389485 2957388812 Bacteria 6778072
313 2957397274 2957395598 Bacteria 6822399
314 2957408338 2957402308 Bacteria 6741770
315 2957412906 2957408893 Bacteria 6558585
316 2957418959 2957415311 Bacteria 6991633
317 2957426788 2957422303 Bacteria 7172205
318 2957435887 2957430029 Bacteria 7022557
319 2957440155 2957437181 Bacteria 6568994
320 2957450589 2957443900 Bacteria 6869977
321 2957455313 2957450854 Bacteria 6765715
322 2957460433 2957457609 Bacteria 6967680
323 2957468837 2957464669 Bacteria 6568877
324 2957472914 2957471148 Bacteria 6797643
325 2957483578 2957478035 Bacteria 6756658
326 2957489161 2957484790 Bacteria 6703082
327 2957497972 2957491536 Bacteria 6695180
328 2957501710 2957498199 Bacteria 7126688
329 2957507338 2957505466 Bacteria 7253085
330 2960586173 2960584000 Bacteria 6864594
331 2960591832 2960591022 Bacteria 6622873
332 2960602088 2960597568 Bacteria 6550735
333 2960610426 2960603979 Bacteria 6898737
334 2960614846 2960610863 Bacteria 6691244
335 2960618014 2960617483 Bacteria 6727748
336 2960630081 2960624210 Bacteria 6875384
337 2960634033 2960631154 Bacteria 6732508
338 2960638967 2960637947 Bacteria 7296468
339 2960651131 2960645483 Bacteria 7211087
340 2960658502 2960652885 Bacteria 7083688
341 2960667144 2960660292 Bacteria 7041660
342 2960670743 2960667422 Bacteria 6763020
343 2960675878 2960674078 Bacteria 6609048
344 2960680784 2960680706 Bacteria 6624464
345 2960688220 2960687367 Bacteria 6535474
346 2960696565 2960693952 Bacteria 6749742
347 2964614180 2964607997 Bacteria 7101408
348 2964617153 2964615318 Bacteria 6809089
349 2964622770 2964621998 Bacteria 6834995
350 2964632828 2964628898 Bacteria 7083044
351 2964639125 2964636051 Bacteria 7091832
352 2964646267 2964643177 Bacteria 6820887
353 2964651230 2964649959 Bacteria 6675118
354 2964663325 2964656573 Bacteria 7100150
355 2964667647 2964663802 Bacteria 7019362
356 2964673325 2964670856 Bacteria 6851364
357 2964680038 2964678106 Bacteria 6792020
358 2964689202 2964685014 Bacteria 6839111
359 2964694822 2964691889 Bacteria 6802758
360 2964699319 2964698721 Bacteria 6765331
361 2964706481 2964705432 Bacteria 7114648
362 2964718773 2964712639 Bacteria 6695970
363 2964722233 2964719344 Bacteria 7286602
364 2967666734 2967664464 Bacteria 6948836
365 2967673250 2967671571 Bacteria 7021409
366 2967685841 2967678726 Bacteria 7264382
367 2967690020 2967686174 Bacteria 6678622
368 2967699040 2967693043 Bacteria 6804451
369 2967702237 2967699805 Bacteria 6854538
370 2967712879 2967706974 Bacteria 7186053
371 2967720404 2967714385 Bacteria 7000047
372 2967722372 2967721400 Bacteria 7073753
373 2967732316 2967728569 Bacteria 6641507
374 2967739881 2967735183 Bacteria 6827012
375 2967744912 2967742019 Bacteria 6794534
376 2967749324 2967748971 Bacteria 6733771
377 2967759634 2967755722 Bacteria 6814706
378 2967763602 2967762386 Bacteria 6923502
379 2967772720 2967769361 Bacteria 6587838
380 2967776362 2967775926 Bacteria 6738189
381 2970024300 2970019648 Bacteria 7072033
382 2970027562 2970026789 Bacteria 6785236
383 2970036000 2970033650 Bacteria 7118744
384 2970045183 2970040964 Bacteria 6731123
385 2970049058 2970047711 Bacteria 7088379
386 2970056243 2970054988 Bacteria 6611507
387 2970066029 2970061556 Bacteria 7099761
388 2970071009 2970068827 Bacteria 7123112
389 2970079438 2970076120 Bacteria 6697332
390 2970084594 2970082768 Bacteria 6183754
391 2970094256 2970088815 Bacteria 6933825
392 2970097194 2970095765 Bacteria 6936963
393 2970103951 2970102677 Bacteria 6812532
394 2970111877 2970109326 Bacteria 6863976
395 2970120576 2970116247 Bacteria 6501857
396 2970126351 2970122695 Bacteria 6625855
397 2970135869 2970129317 Bacteria 6806560
398 2970141803 2970136068 Bacteria 7207982
399 2970147153 2970143518 Bacteria 6446480
400 2970152474 2970149975 Bacteria 6779706
401 2970162625 2970156795 Bacteria 7168044
402 2970168292 2970164137 Bacteria 6861252
403 2970181089 2970177841 Bacteria 6768001
404 2970186261 2970184632 Bacteria 7054431
405 2970196132 2970191845 Bacteria 7032787
406 2977519329 2977516862 Bacteria 6940108
407 2977524433 2977523885 Bacteria 6960446
408 2977536373 2977530762 Bacteria 6951399
409 2977543320 2977537788 Bacteria 6929320
410 2977549650 2977544691 Bacteria 6875412
411 2977553042 2977551784 Bacteria 7125765
412 2977559937 2977558990 Bacteria 6863948
413 2977568838 2977565890 Bacteria 6901543
414 2977574070 2977572785 Bacteria 6763888
415 2977585929 2977579622 Bacteria 6772100
416 2989351060 2989349275 Bacteria 6349068
417 2989773330 2989771324 Bacteria 5605128
418 2989779582 2989776772 Bacteria 4843317
419 3000407579 3000405567 Bacteria 3779330
420 3002141929 3002141150 Bacteria 5254435
421 3003934671 3003930520 Bacteria 5667563
422 643826682 643692032 Bacteria 6891900
423 648739520 648276728 Bacteria 6968865
424 8003994457 8003992118 Bacteria 7266902
425 8004002163 8003999396 Bacteria 7063185
426 8005249804 8005246636 Bacteria 4933972
427 8018154091 8018150411 Bacteria 5549903
428 8049295642 8049293176 Bacteria 6128433
429 8054561903 8054558443 Bacteria 5204801
430 8055435371 8055431914 Bacteria 4551896
431 JGI25159J45721_1000008
432 JGI25160J50197_1000033
433 JGI25161J50226_1001306
434 Ga0006562J51391_1004059
435 Ga0055526_1000653
436 Ga0055524_1003306
437 Ga0055536_1004025
438 Ga0055531_10027789
439 Ga0055543_1000026
440 Ga0065165_1000178
441 Ga0070661_100004986
442 Ga0070661_100017373
443 Ga0070668_100012105
444 Ga0070667_100502757
445 Ga0068853_100000271
446 Ga0070686_100063210
447 Ga0068857_100125082
448 Ga0068854_100055149
449 Ga0068852_100006113
450 Ga0068851_10003553
451 Ga0075368_10036869
452 Ga0075363_100031257
453 Ga0075364_10012404
454 Ga0075362_10002360
455 Ga0075369_10166470
456 Ga0079104_1001481
457 Ga0079104_1009204
458 Ga0105243_10153629
459 Ga0105241_10014223
460 Ga0105238_10072179
461 Ga0105239_10579818
462 Ga0171463_1007
463 Ga0157378_10227522
464 Ga0183363_1084
465 Ga0214544_1000010
466 Ga0214542_1000023
467 Ga0214543_1000019
468 Ga0214543_1000022
469 Ga0228711_1000017
470 Ga0228710_1000005
471 Ga0209130_1000017
472 Ga0209676_1001868
473 Ga0209025_1000153
474 Ga0209564_1000013
475 Ga0209050_1003752
476 Ga0209256_1000211
477 Ga0209256_1009453
478 Ga0207426_1000006
479 Ga0209257_1013610
480 Ga0207656_10003678
481 Ga0207649_10001014
482 Ga0207709_10008159
483 Ga0207640_10019181
484 Ga0207639_10001237
485 Ga0207674_10209108
486 Ga0207698_10015221
487 Ga0209281_1000082
488 Ga0209281_1000484
489 Ga0209282_1000006
490 Ga0307515_10000017
491 Ga0307515_10016027
492 Ga0307513_10000852
493 Ga0307513_10026587
494 Ga0316576_10041834
495 Ga0316578_10020559
496 Ga0307406_10037366
497 Ga0307412_10496561
498 Ga0315914_1000003
499 Ga0315913_1000001
500 Ga0315915_1000008
501 Ga0373935_0232142
502 Ga0373927_0002185
503 Ga0316584_0065527
504 Ga0316584_0142952
505 Ga0373925_0002324
506 Ga0400483_048939
507 Ga0400483_064186
508 Ga0400483_274439
509 Ga0436361_0923664
510 Ga0439436_0002887
511 Ga0439439_0031912
512 Ga0439465_0016416
513 Ga0451807_0877284
514 Ga0439449_0028381
515 Ga0439449_0103321
516 Ga0450906_014998
517 Ga0466965_0027951
518 Ga0451576_0018873
519 Ga0495638_0186998
520 Ga0495633_0064807
521 Ga0496116_0081633
522 Ga0496117_0014050
523 Ga0496118_0034836
524 Ga0496119_0017908
525 Ga0496120_0032322
526 Ga0496121_0000003
527 Ga0496121_0043175
528 Ga0496122_0132086
529 Ga0496124_0000067
530 Ga0496124_0013289
531 Ga0496125_0000262
532 Ga0496126_0031796
533 Ga0496126_0120519
534 Ga0496126_0148529
535 Ga0496126_0265368
536 Ga0501032_0115820
537 Ga0501033_0227212
538 Ga0501034_0000012
539 Ga0501037_0040170
540 Ga0501037_0184681
541 Ga0501038_0122453
542 Ga0501038_0440626
543 Ga0501039_0100010
544 Ga0501043_0129745
545 Ga0501043_0302654
546 Ga0501047_0165955
547 Ga0501068_0255716
548 Ga0501070_0032344
549 Ga0501072_0201341
550 Ga0501073_0304715
551 Ga0501079_0214739
552 Ga0501080_0210434
553 Ga0501280_004079
554 Ga0501044_0256703
555 Ga0501044_0453255
556 nmdc:mga03683_4236_c1
557 nmdc:mga00v17_11871_c1
558 nmdc:mga00v17_34229_c1
559 nmdc:mga0sz30_148215_c1
560 Ga0500644_0002531
561 Ga0500618_004184
562 Ga0500573_0001859
563 Ga0500573_0092770
564 Ga0500577_0048876
565 Ga0500588_0009446
566 Ga0500622_0032103
567 Ga0501084_0416424
568 2889793007
569 2509108020
570 2509376800
571 2510304097
572 2510839327
573 2511502531
574 2512533905
575 2512970336
576 2513583164
577 2513601400
578 2513620310
579 2513881782
580 2513904926
581 2513983597
582 2513997547
583 2514003153
584 2515609318
585 2516206048
586 2516893906
587 2517570626
588 2524448271
589 2551675298
590 2551676708
591 2551689418
592 2551696008
593 2551697245
594 2551708854
595 2551716341
596 2551726451
597 2551731804
598 2551740969
599 2558865842
600 2585167581
601 2585265811
602 2585389058
603 2585395201
604 2599332123
605 2600196046
606 2643804413
607 2643811097
608 2643910802
609 2644052073
610 2644065183
611 2644105476
612 2644146479
613 2644204866
614 2644208670
615 2644308227
616 2644334051
617 2644377593
618 2644416855
619 2644449895
620 2644484816
621 2644494187
622 2644500628
623 2644541648
624 2644615509
625 2644652200
626 2644672751
627 2644690030
628 2657684842
629 2692315156
630 2715500681
631 2739347123
632 2753463331
633 2765465955
634 2770196590
635 2776269302
636 2776283559
637 2776914322
638 2792581560
639 2792620457
640 2792625815
641 2792638758
642 2793283771
643 2802716693
644 2802725504
645 2802730404
646 2802737624
647 2802742986
648 2802750410
649 2804753028
650 2819240971
651 2838079649
652 2839993588
653 2840766595
654 2840879378
655 2842522210
656 2842924478
657 2844166390
658 2847419788
659 2848994804
660 2850081803
661 2854681685
662 2854914157
663 2855826631
664 2855842022
665 2855877304
666 2858802696
667 2889919414
668 2894653456
669 2896391238
670 2898796403
671 2899806705
672 2904579714
673 2913299094
674 2915981166
675 2915989941
676 2915998536
677 2916005073
678 2916012987
679 2916021087
680 2916023044
681 2916034206
682 2916039336
683 2916044400
684 2916050448
685 2916061505
686 2916062029
687 2916069358
688 2916080498
689 2919120619
690 2919681491
691 2920761161
692 2920825651
693 2921205503
694 2921209701
695 2921239284
696 2921247818
697 2921251675
698 2921262628
699 2921269639
700 2921287158
701 2921294094
702 2921300505
703 2924148558
704 2924151505
705 2924159911
706 2924167539
707 2924174621
708 2924183751
709 2924193115
710 2924196465
711 2924203915
712 2924210826
713 2924218204
714 2924227405
715 2924233246
716 2928522514
717 2929141163
718 2937002782
719 2937005347
720 2937012882
721 2937021852
722 2937027357
723 2937035657
724 2937043859
725 2937050304
726 2937058369
727 2937068671
728 2937072393
729 2937080719
730 2937090110
731 2937097413
732 2937101128
733 2937110235
734 2937117660
735 2937124492
736 2937131438
737 2937848075
738 2937876050
739 2941504582
740 2957380668
741 2957382535
742 2957389485
743 2957397274
744 2957408338
745 2957412906
746 2957418959
747 2957426788
748 2957435887
749 2957440155
750 2957450589
751 2957455313
752 2957460433
753 2957468837
754 2957472914
755 2957483578
756 2957489161
757 2957497972
758 2957501710
759 2957507338
760 2960586173
761 2960591832
762 2960602088
763 2960610426
764 2960614846
765 2960618014
766 2960630081
767 2960634033
768 2960638967
769 2960651131
770 2960658502
771 2960667144
772 2960670743
773 2960675878
774 2960680784
775 2960688220
776 2960696565
777 2964614180
778 2964617153
779 2964622770
780 2964632828
781 2964639125
782 2964646267
783 2964651230
784 2964663325
785 2964667647
786 2964673325
787 2964680038
788 2964689202
789 2964694822
790 2964699319
791 2964706481
792 2964718773
793 2964722233
794 2967666734
795 2967673250
796 2967685841
797 2967690020
798 2967699040
799 2967702237
800 2967712879
801 2967720404
802 2967722372
803 2967732316
804 2967739881
805 2967744912
806 2967749324
807 2967759634
808 2967763602
809 2967772720
810 2967776362
811 2970024300
812 2970027562
813 2970036000
814 2970045183
815 2970049058
816 2970056243
817 2970066029
818 2970071009
819 2970079438
820 2970084594
821 2970094256
822 2970097194
823 2970103951
824 2970111877
825 2970120576
826 2970126351
827 2970135869
828 2970141803
829 2970147153
830 2970152474
831 2970162625
832 2970168292
833 2970181089
834 2970186261
835 2970196132
836 2977519329
837 2977524433
838 2977536373
839 2977543320
840 2977549650
841 2977553042
842 2977559937
843 2977568838
844 2977574070
845 2977585929
846 2989351060
847 2989773330
848 2989779582
849 3000407579
850 3002141929
851 3003934671
852 643826682
853 648739520
854 8003994457
855 8004002163
856 8005249804
857 8018154091
858 8049295642
859 8054561903
860 8055435371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

303

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8479 90 286
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7766 90 286
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7508 71 289
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7389 90 289
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7337 79 289
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.944 93 283 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9255 89 283 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9249 93 286 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.912 93 289 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9073 92 282 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2P7BLB9-F1-model_v4 ABC transporter permease 0.9762 6 294 GO:0005886
GO:0055085
AF-A0A382EI94-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9758 50 294 GO:0005886
GO:0055085
AF-A0A528CYA0-F1-model_v4 ABC transporter permease 0.9723 48 294 GO:0005886
GO:0055085
AF-A0A382EI94-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9719 50 294 GO:0005886
GO:0055085
AF-A0A6I6IVB8-F1-model_v4 ABC transporter permease 0.9705 9 293 GO:0005886
GO:0055085

Map