F442280

General Info

Members Datasets Scaffolds Average Seq Length
431 260 425 153

Family's Representative Sequence

Representative Sequence 3300000545|CNXas_1002950|CNXas_10029502
Length 160
Sequence MTVFDNIVGMHYRYPDHYVVGREKIREYATAVKNEDAAYFDDKAAADLGYAGVLAPLTFISVFGYQAQTAFFESADIGIQDAKIVQVDQELKFAKPIMAGDRLYCDVWVHSIRKSFGADIIVTKNIITNEKGDVVQETYTTLAGRTAEDGEEGGFNDGAA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
7 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
190 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
191 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
192 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
260 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0.23
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.12
Nodule 0.23
Rhizoplane 10.67
Rhizosphere 74.01
Stem 0
Stem Tuber 0
Unclassified 6.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1002950 3300000545 Bacteria 1193
2 JGI24739J22299_10089461 3300001989 Bacteria 938
3 JGI24737J22298_10014221 3300001990 Bacteria 2585
4 JGI24737J22298_10019452 3300001990 Bacteria 2172
5 JGI24743J22301_10002717 3300001991 Bacteria 2708
6 JGI24735J21928_10048036 3300002067 Bacteria 1236
7 JGI24735J21928_10078773 3300002067 Bacteria 944
8 JGI24750J21931_1002778 3300002070 Bacteria 2102
9 JGI24750J21931_1006249 3300002070 Bacteria 1479
10 JGI24745J21846_1012218 3300002073 Bacteria 985
11 JGI24738J21930_10006810 3300002075 Bacteria 2655
12 JGI24749J21850_1001310 3300002076 Bacteria 3524
13 JGI24744J21845_10001349 3300002077 Bacteria 4856
14 JGI24744J21845_10007272 3300002077 Bacteria 2288
15 JGI24034J26672_10014035 3300002239 Bacteria 1219
16 JGI24742J22300_10003976 3300002244 Bacteria 2411
17 Ga0070676_10030968 3300005328 Bacteria 3055
18 Ga0070690_100106069 3300005330 Bacteria 1869
19 Ga0070670_100803041 3300005331 Bacteria 850
20 Ga0068869_100020924 3300005334 Bacteria 4494
21 Ga0068869_100491697 3300005334 Bacteria 1023
22 Ga0068869_100738198 3300005334 Bacteria 842
23 Ga0070666_10012464 3300005335 Bacteria 5363
24 Ga0070666_10163592 3300005335 Bacteria 1556
25 Ga0070680_100193132 3300005336 Bacteria 1716
26 Ga0070680_100250938 3300005336 Bacteria 1496
27 Ga0070682_100444346 3300005337 Bacteria 991
28 Ga0070682_101672228 3300005337 Bacteria 552
29 Ga0068868_100014673 3300005338 Bacteria 5779
30 Ga0070660_100350868 3300005339 Bacteria 1215
31 Ga0070689_100012121 3300005340 Bacteria 6200
32 Ga0070689_100852739 3300005340 Bacteria 804
33 Ga0070691_10044174 3300005341 Bacteria 2112
34 Ga0070691_10582667 3300005341 Bacteria 658
35 Ga0070687_100175351 3300005343 Bacteria 1280
36 Ga0070692_10055296 3300005345 Bacteria 2075
37 Ga0070668_100000242 3300005347 Bacteria 35872
38 Ga0070668_100922172 3300005347 Bacteria 782
39 Ga0070669_100051317 3300005353 Bacteria 3014
40 Ga0070669_100158534 3300005353 Bacteria 1757
41 Ga0070675_100548055 3300005354 Bacteria 1046
42 Ga0070674_100004607 3300005356 Bacteria 7878
43 Ga0070674_101026310 3300005356 Bacteria 725
44 Ga0070673_100875949 3300005364 Bacteria 832
45 Ga0070688_100110304 3300005365 Bacteria 1829
46 Ga0070688_100129136 3300005365 Bacteria 1703
47 Ga0070659_100004755 3300005366 Bacteria 9703
48 Ga0070659_100271805 3300005366 Bacteria 1408
49 Ga0070659_100735461 3300005366 Bacteria 855
50 Ga0070667_100000420 3300005367 Bacteria 45173
51 Ga0070667_100010100 3300005367 Bacteria 7810
52 Ga0070667_100027586 3300005367 Bacteria 4725
53 Ga0070703_10058701 3300005406 Bacteria 1253
54 Ga0070703_10250041 3300005406 Bacteria 719
55 Ga0070709_10113400 3300005434 Bacteria 1826
56 Ga0070710_10003235 3300005437 Bacteria 7716
57 Ga0070701_10019354 3300005438 Bacteria 3214
58 Ga0070701_10089230 3300005438 Bacteria 1686
59 Ga0070711_100000663 3300005439 Bacteria 17961
60 Ga0070705_100031394 3300005440 Bacteria 2941
61 Ga0070700_100044230 3300005441 Bacteria 2742
62 Ga0070663_100105506 3300005455 Bacteria 2109
63 Ga0070663_100224019 3300005455 Bacteria 1477
64 Ga0070678_100000459 3300005456 Bacteria 19456
65 Ga0070662_100064570 3300005457 Bacteria 2681
66 Ga0070681_10254318 3300005458 Bacteria 1669
67 Ga0068867_100007547 3300005459 Bacteria 7694
68 Ga0068867_100175003 3300005459 Bacteria 1702
69 Ga0070685_10074540 3300005466 Bacteria 2019
70 Ga0070685_10241501 3300005466 Bacteria 1193
71 Ga0070706_101004897 3300005467 Bacteria 769
72 Ga0068853_100006833 3300005539 Bacteria 9098
73 Ga0070672_100111485 3300005543 Bacteria 2230
74 Ga0070695_100413927 3300005545 Bacteria 1025
75 Ga0070696_100007179 3300005546 Bacteria 7440
76 Ga0070693_100008532 3300005547 Bacteria 5059
77 Ga0070693_100796444 3300005547 Bacteria 700
78 Ga0070665_100046382 3300005548 Bacteria 4366
79 Ga0070665_100218072 3300005548 Bacteria 1908
80 Ga0070665_100220414 3300005548 Bacteria 1897
81 Ga0070665_100742449 3300005548 Bacteria 995
82 Ga0070704_100078798 3300005549 Bacteria 2418
83 Ga0070704_100103964 3300005549 Bacteria 2146
84 Ga0068855_100107660 3300005563 Bacteria 3202
85 Ga0068854_100053258 3300005578 Bacteria 2905
86 Ga0068856_100125448 3300005614 Bacteria 2570
87 Ga0068856_101678422 3300005614 Bacteria 648
88 Ga0070702_100010544 3300005615 Bacteria 4557
89 Ga0070702_100193792 3300005615 Bacteria 1339
90 Ga0070702_100214777 3300005615 Bacteria 1283
91 Ga0070702_101026095 3300005615 Bacteria 654
92 Ga0068852_100537544 3300005616 Bacteria 1168
93 Ga0068859_100007479 3300005617 Bacteria 11091
94 Ga0068859_100030153 3300005617 Bacteria 5442
95 Ga0068859_100404890 3300005617 Bacteria 1460
96 Ga0068864_100705907 3300005618 Bacteria 986
97 Ga0068864_100761067 3300005618 Bacteria 950
98 Ga0068866_10004533 3300005718 Bacteria 5698
99 Ga0068861_100004705 3300005719 Bacteria 9173
100 Ga0068861_101955646 3300005719 Bacteria 584
101 Ga0068863_100000818 3300005841 Bacteria 31194
102 Ga0068863_100100765 3300005841 Bacteria 2745
103 Ga0068863_100403257 3300005841 Bacteria 1338
104 Ga0068858_100011821 3300005842 Bacteria 8230
105 Ga0068858_100023732 3300005842 Bacteria 5713
106 Ga0068858_101241829 3300005842 Bacteria 733
107 Ga0068860_100000048 3300005843 Bacteria 209375
108 Ga0068860_100012097 3300005843 Bacteria 8500
109 Ga0068862_100000053 3300005844 Bacteria 143631
110 Ga0068862_100141809 3300005844 Bacteria 2133
111 Ga0068862_101424913 3300005844 Bacteria 697
112 Ga0081455_10020494 3300005937 Bacteria 6222
113 Ga0070717_10795776 3300006028 Bacteria 860
114 Ga0075365_10096368 3300006038 Bacteria 2022
115 Ga0075365_10387717 3300006038 Bacteria 986
116 Ga0075365_10488580 3300006038 Bacteria 870
117 Ga0075363_100002416 3300006048 Bacteria 7624
118 Ga0075363_100038920 3300006048 Bacteria 2501
119 Ga0075364_10004937 3300006051 Bacteria 7727
120 Ga0075364_10080057 3300006051 Bacteria 2159
121 Ga0070715_10019728 3300006163 Bacteria 2590
122 Ga0070716_100017188 3300006173 Bacteria 3746
123 Ga0070712_100001159 3300006175 Bacteria 15943
124 Ga0075362_10068655 3300006177 Bacteria 1615
125 Ga0075367_10140498 3300006178 Bacteria 1496
126 Ga0075369_10001719 3300006186 Bacteria 7575
127 Ga0075369_10003008 3300006186 Bacteria 6099
128 Ga0097621_100034529 3300006237 Bacteria 4035
129 Ga0068871_100037026 3300006358 Bacteria 3889
130 Ga0068865_100004581 3300006881 Bacteria 8343
131 Ga0068865_100266482 3300006881 Bacteria 1358
132 Ga0068865_101638679 3300006881 Bacteria 579
133 Ga0097620_100007479 3300006931 Bacteria 11091
134 Ga0097620_100030152 3300006931 Bacteria 5442
135 Ga0097620_100404876 3300006931 Bacteria 1460
136 Ga0097620_100436575 3300006931 Bacteria 1405
137 Ga0099795_10033819 3300007788 Bacteria 1778
138 Ga0105250_10219602 3300009092 Bacteria 806
139 Ga0111539_12793291 3300009094 Bacteria 566
140 Ga0105245_10001283 3300009098 Bacteria 22648
141 Ga0105245_10466966 3300009098 Bacteria 1273
142 Ga0105247_10000195 3300009101 Bacteria 59840
143 Ga0105247_10001525 3300009101 Bacteria 16561
144 Ga0105243_10000773 3300009148 Bacteria 30624
145 Ga0105241_10108958 3300009174 Bacteria 2214
146 Ga0105242_10011770 3300009176 Bacteria 6732
147 Ga0105248_10000151 3300009177 Bacteria 81027
148 Ga0105248_10092423 3300009177 Bacteria 3408
149 Ga0105248_10198857 3300009177 Bacteria 2258
150 Ga0105237_10036627 3300009545 Bacteria 4965
151 Ga0105237_10078629 3300009545 Bacteria 3288
152 Ga0105237_10274922 3300009545 Bacteria 1687
153 Ga0105237_11026073 3300009545 Bacteria 832
154 Ga0105238_10085801 3300009551 Bacteria 3136
155 Ga0105238_10399144 3300009551 Bacteria 1368
156 Ga0105238_11210018 3300009551 Bacteria 780
157 Ga0105249_10000022 3300009553 Bacteria 258377
158 Ga0105249_10004515 3300009553 Bacteria 12030
159 Ga0105249_11094272 3300009553 Bacteria 867
160 Ga0105239_10030172 3300010375 Bacteria 5961
161 Ga0105239_10265819 3300010375 Bacteria 1928
162 Ga0105239_10744172 3300010375 Bacteria 1122
163 Ga0105246_10098785 3300011119 Bacteria 2121
164 Ga0105246_10209475 3300011119 Bacteria 1521
165 Ga0105246_10289796 3300011119 Bacteria 1317
166 Ga0157315_1018580 3300012508 Bacteria 711
167 Ga0157371_10276098 3300013102 Bacteria 1213
168 Ga0157369_10069869 3300013105 Bacteria 3773
169 Ga0157369_11111949 3300013105 Bacteria 808
170 Ga0157374_10247874 3300013296 Bacteria 1752
171 Ga0157378_10002823 3300013297 Bacteria 15493
172 Ga0163162_10002292 3300013306 Bacteria 17964
173 Ga0163162_10084462 3300013306 Bacteria 3250
174 Ga0163162_10131792 3300013306 Bacteria 2608
175 Ga0163162_10305334 3300013306 Bacteria 1724
176 Ga0163162_10789545 3300013306 Bacteria 1067
177 Ga0163162_11041825 3300013306 Bacteria 926
178 Ga0163162_12233424 3300013306 Bacteria 628
179 Ga0157372_10030734 3300013307 Bacteria 5877
180 Ga0157372_11332350 3300013307 Bacteria 828
181 Ga0157375_10230452 3300013308 Bacteria 2011
182 Ga0157375_10740364 3300013308 Bacteria 1135
183 Ga0163163_10060207 3300014325 Bacteria 3759
184 Ga0163163_10108313 3300014325 Bacteria 2806
185 Ga0157380_10006763 3300014326 Bacteria 8104
186 Ga0157377_10114241 3300014745 Bacteria 1627
187 Ga0157379_10471190 3300014968 Bacteria 1161
188 Ga0163161_10000939 3300017792 Bacteria 22414
189 Ga0163161_10659349 3300017792 Bacteria 868
190 Ga0213875_10065998 3300021388 Bacteria 1691
191 Ga0207696_1069020 3300025711 Bacteria 985
192 Ga0207653_10078407 3300025885 Bacteria 1139
193 Ga0207692_10074289 3300025898 Bacteria 1801
194 Ga0207642_10000995 3300025899 Bacteria 8857
195 Ga0207642_10698975 3300025899 Bacteria 639
196 Ga0207710_10000091 3300025900 Bacteria 121330
197 Ga0207710_10003297 3300025900 Bacteria 7215
198 Ga0207710_10011748 3300025900 Bacteria 3683
199 Ga0207688_10001765 3300025901 Bacteria 11487
200 Ga0207688_10002070 3300025901 Bacteria 10777
201 Ga0207688_10165542 3300025901 Bacteria 1313
202 Ga0207688_10602041 3300025901 Bacteria 693
203 Ga0207680_10021721 3300025903 Bacteria 3477
204 Ga0207647_10071279 3300025904 Bacteria 2097
205 Ga0207685_10024431 3300025905 Bacteria 2071
206 Ga0207699_10022805 3300025906 Bacteria 3398
207 Ga0207645_10009732 3300025907 Bacteria 6638
208 Ga0207654_10037199 3300025911 Bacteria 2723
209 Ga0207671_10010972 3300025914 Bacteria 7422
210 Ga0207671_10079406 3300025914 Bacteria 2458
211 Ga0207693_10000513 3300025915 Bacteria 34994
212 Ga0207663_10002243 3300025916 Bacteria 9247
213 Ga0207660_10158352 3300025917 Bacteria 1745
214 Ga0207660_10366999 3300025917 Bacteria 1156
215 Ga0207662_10010024 3300025918 Bacteria 5226
216 Ga0207657_10322538 3300025919 Bacteria 1221
217 Ga0207652_10957337 3300025921 Bacteria 754
218 Ga0207681_10001228 3300025923 Bacteria 16511
219 Ga0207681_10074200 3300025923 Bacteria 2382
220 Ga0207681_10315023 3300025923 Bacteria 1242
221 Ga0207694_10046859 3300025924 Bacteria 3342
222 Ga0207694_10815257 3300025924 Bacteria 788
223 Ga0207659_11135035 3300025926 Bacteria 672
224 Ga0207687_10006399 3300025927 Bacteria 7779
225 Ga0207687_10102941 3300025927 Bacteria 2105
226 Ga0207644_10319629 3300025931 Bacteria 1255
227 Ga0207690_10069097 3300025932 Bacteria 2429
228 Ga0207690_10471504 3300025932 Bacteria 1012
229 Ga0207690_11104884 3300025932 Bacteria 661
230 Ga0207706_10005762 3300025933 Bacteria 11528
231 Ga0207686_10021838 3300025934 Bacteria 3679
232 Ga0207709_10020181 3300025935 Bacteria 3756
233 Ga0207709_10210672 3300025935 Bacteria 1394
234 Ga0207670_10012662 3300025936 Bacteria 4943
235 Ga0207669_10001354 3300025937 Bacteria 10425
236 Ga0207669_10749138 3300025937 Bacteria 806
237 Ga0207704_10022607 3300025938 Bacteria 3373
238 Ga0207665_10027810 3300025939 Bacteria 3736
239 Ga0207691_10416114 3300025940 Bacteria 1146
240 Ga0207711_10000172 3300025941 Bacteria 69349
241 Ga0207711_10131142 3300025941 Bacteria 2247
242 Ga0207689_10019854 3300025942 Bacteria 5661
243 Ga0207689_10179637 3300025942 Bacteria 1745
244 Ga0207689_10366219 3300025942 Bacteria 1199
245 Ga0207667_10197457 3300025949 Bacteria 2064
246 Ga0207651_10173783 3300025960 Bacteria 1702
247 Ga0207712_10000005 3300025961 Bacteria 608697
248 Ga0207712_10067682 3300025961 Bacteria 2557
249 Ga0207712_11313053 3300025961 Bacteria 647
250 Ga0207668_10000756 3300025972 Bacteria 19801
251 Ga0207668_10008387 3300025972 Bacteria 6156
252 Ga0207640_10100826 3300025981 Bacteria 2024
253 Ga0207658_10000356 3300025986 Bacteria 45186
254 Ga0207658_10220114 3300025986 Bacteria 1596
255 Ga0207677_10014185 3300026023 Bacteria 4644
256 Ga0207677_10182898 3300026023 Bacteria 1650
257 Ga0207677_10709714 3300026023 Bacteria 893
258 Ga0207703_10009257 3300026035 Bacteria 7746
259 Ga0207703_10034176 3300026035 Bacteria 4034
260 Ga0207639_10041715 3300026041 Bacteria 3435
261 Ga0207678_10128206 3300026067 Bacteria 2164
262 Ga0207678_10147642 3300026067 Bacteria 2007
263 Ga0207678_10232451 3300026067 Bacteria 1579
264 Ga0207708_10014048 3300026075 Bacteria 5983
265 Ga0207702_10278063 3300026078 Bacteria 1581
266 Ga0207641_10002348 3300026088 Bacteria 17500
267 Ga0207641_10180506 3300026088 Bacteria 1933
268 Ga0207641_10658171 3300026088 Bacteria 1029
269 Ga0207648_10001669 3300026089 Bacteria 24324
270 Ga0207648_10282611 3300026089 Bacteria 1484
271 Ga0207676_10626863 3300026095 Bacteria 1035
272 Ga0207676_11144248 3300026095 Bacteria 770
273 Ga0207675_100004512 3300026118 Bacteria 13447
274 Ga0207683_10001309 3300026121 Bacteria 22501
275 Ga0207683_10326300 3300026121 Bacteria 1406
276 Ga0207698_10207385 3300026142 Bacteria 1760
277 Ga0207698_10382201 3300026142 Bacteria 1340
278 Ga0207698_11526232 3300026142 Bacteria 683
279 Ga0209179_1014912 3300027512 Bacteria 1435
280 Ga0207428_11198099 3300027907 Bacteria 528
281 Ga0268266_10003639 3300028379 Bacteria 15248
282 Ga0268266_10581821 3300028379 Bacteria 1074
283 Ga0268266_10587403 3300028379 Bacteria 1069
284 Ga0268266_10852896 3300028379 Bacteria 880
285 Ga0268265_10000005 3300028380 Bacteria 535350
286 Ga0268265_10150238 3300028380 Bacteria 1963
287 Ga0268265_10751434 3300028380 Bacteria 946
288 Ga0268264_10000005 3300028381 Bacteria 934972
289 Ga0268264_10005001 3300028381 Bacteria 11218
290 Ga0268264_10758220 3300028381 Bacteria 967
291 Ga0307413_11651496 3300031824 Bacteria 570
292 Ga0307410_10131975 3300031852 Bacteria 1836
293 Ga0307407_11235118 3300031903 Bacteria 585
294 Ga0307409_101339465 3300031995 Bacteria 741
295 Ga0307416_101270601 3300032002 Bacteria 842
296 Ga0307416_102195129 3300032002 Bacteria 653
297 Ga0373949_0078971 3300035090 Bacteria 874
298 Ga0373931_0021763 3300035691 Bacteria 3220
299 Ga0373937_1094125 3300036401 Bacteria 746
300 Ga0436364_0431232 3300037853 Bacteria 912
301 Ga0436364_0677668 3300037853 Bacteria 3973
302 Ga0436365_0433813 3300039437 Bacteria 3317
303 Ga0436365_1586243 3300039437 Bacteria 3417
304 Ga0436363_1499070 3300039450 Bacteria 1011
305 Ga0436363_1673198 3300039450 Bacteria 599
306 Ga0439461_0004106 3300041410 Bacteria 2419
307 Ga0439461_0023785 3300041410 Bacteria 1234
308 Ga0439466_0003951 3300041411 Bacteria 5716
309 Ga0439466_0094578 3300041411 Bacteria 935
310 Ga0439465_0002227 3300041413 Bacteria 6360
311 Ga0439465_0009263 3300041413 Bacteria 3102
312 Ga0451787_588158 3300041441 Bacteria 1078
313 Ga0451789_0517351 3300041443 Bacteria 2713
314 Ga0451794_49069 3300041446 Bacteria 1103
315 Ga0451791_0772339 3300041451 Bacteria 642
316 Ga0451793_1783229 3300041452 Bacteria 1868
317 Ga0451797_0123005 3300041453 Bacteria 1241
318 Ga0451795_0382023 3300041456 Bacteria 1453
319 Ga0451833_1057544 3300041491 Bacteria 785
320 Ga0451841_0089027 3300041498 Bacteria 789
321 Ga0451853_0782178 3300041512 Bacteria 659
322 Ga0439442_004458 3300042002 Bacteria 2780
323 Ga0439442_013676 3300042002 Bacteria 1666
324 Ga0439445_0003083 3300042004 Bacteria 3733
325 Ga0439445_0005709 3300042004 Bacteria 2844
326 Ga0439448_0021198 3300042005 Bacteria 2014
327 Ga0466972_0060674 3300044658 Bacteria 1814
328 Ga0466970_0039851 3300044765 Bacteria 2494
329 Ga0466960_0107433 3300044901 Bacteria 1445
330 Ga0466967_0069194 3300045976 Bacteria 3154
331 Ga0466967_0467858 3300045976 Bacteria 1234
332 Ga0495638_0008184 3300046460 Bacteria 7434
333 Ga0495606_0114519 3300046507 Bacteria 1622
334 Ga0495648_0013467 3300046524 Bacteria 6044
335 Ga0495656_0679034 3300046615 Bacteria 554
336 Ga0495658_0003996 3300046683 Bacteria 7266
337 Ga0495671_0227086 3300046692 Bacteria 903
338 Ga0495649_0302438 3300046694 Bacteria 814
339 Ga0495674_0326653 3300047319 Bacteria 1248
340 Ga0495672_0011184 3300047320 Bacteria 6343
341 Ga0495672_0496870 3300047320 Bacteria 543
342 Ga0495676_0095431 3300047321 Bacteria 2213
343 Ga0495673_0003826 3300047469 Bacteria 9720
344 Ga0495593_0012968 3300047673 Bacteria 4760
345 Ga0496100_0003502 3300048903 Bacteria 8196
346 Ga0496100_0150505 3300048903 Bacteria 1659
347 Ga0496100_0199202 3300048903 Bacteria 1458
348 Ga0496100_0287779 3300048903 Bacteria 1227
349 Ga0496101_0000047 3300048904 Bacteria 152715
350 Ga0496101_0003730 3300048904 Bacteria 9504
351 Ga0496101_0025795 3300048904 Bacteria 4080
352 Ga0496102_0000003 3300048905 Bacteria 592263
353 Ga0496102_0000050 3300048905 Bacteria 179469
354 Ga0496102_0134667 3300048905 Bacteria 2314
355 Ga0496102_0441674 3300048905 Bacteria 1221
356 Ga0496102_0564942 3300048905 Bacteria 1060
357 Ga0496102_0567827 3300048905 Bacteria 1057
358 Ga0496102_0614044 3300048905 Bacteria 1010
359 Ga0496103_0000012 3300048906 Bacteria 301778
360 Ga0496103_0000831 3300048906 Bacteria 22700
361 Ga0496103_0002661 3300048906 Bacteria 11186
362 Ga0496104_0138632 3300048907 Bacteria 2338
363 Ga0496105_0150665 3300048908 Bacteria 1912
364 Ga0496106_0006678 3300048909 Bacteria 8542
365 Ga0496106_0012798 3300048909 Bacteria 6194
366 Ga0496106_0139460 3300048909 Bacteria 1906
367 Ga0496107_0004101 3300048910 Bacteria 9812
368 Ga0496107_0146999 3300048910 Bacteria 1743
369 Ga0496107_0405518 3300048910 Bacteria 1014
370 Ga0496108_0001423 3300048911 Bacteria 18868
371 Ga0496108_0033164 3300048911 Bacteria 4290
372 Ga0496109_0015166 3300048912 Bacteria 6708
373 Ga0496109_0645971 3300048912 Bacteria 995
374 Ga0496109_0830242 3300048912 Bacteria 862
375 Ga0496110_0198206 3300048913 Bacteria 1824
376 Ga0496111_0430858 3300048914 Bacteria 974
377 Ga0496112_0101548 3300048915 Bacteria 2846
378 Ga0496114_0006229 3300048917 Bacteria 9391
379 Ga0496114_0390655 3300048917 Bacteria 1232
380 Ga0496114_0449439 3300048917 Bacteria 1141
381 Ga0496115_0059278 3300048918 Bacteria 3082
382 Ga0496115_0907690 3300048918 Bacteria 679
383 Ga0496115_1286563 3300048918 Bacteria 545
384 Ga0496116_0000040 3300048919 Bacteria 346900
385 Ga0496117_0000003 3300048920 Bacteria 1881097
386 Ga0496117_0000459 3300048920 Bacteria 68055
387 Ga0496118_0000001 3300048921 Bacteria 1881100
388 Ga0496118_0003972 3300048921 Bacteria 18042
389 Ga0496119_0000142 3300048922 Bacteria 100419
390 Ga0496119_0013089 3300048922 Bacteria 6651
391 Ga0496120_0000149 3300048923 Bacteria 116137
392 Ga0496120_0027186 3300048923 Bacteria 3524
393 Ga0496121_0000019 3300048924 Bacteria 499976
394 Ga0496121_0013569 3300048924 Bacteria 8737
395 Ga0496124_0267286 3300048927 Bacteria 1254
396 Ga0496125_0015384 3300048928 Bacteria 7404
397 Ga0496126_0000785 3300048929 Bacteria 57203
398 Ga0496126_0007337 3300048929 Bacteria 12109
399 Ga0501034_0138127 3300049571 Bacteria 2418
400 Ga0501070_0157301 3300049586 Bacteria 1874
401 nmdc:mga03683_43180_c1 3300050489 Bacteria 1859
402 nmdc:mga03n38_119047_c1 3300050490 Bacteria 1295
403 nmdc:mga03n38_22624_c1 3300050490 Bacteria 2547
404 nmdc:mga03n38_38269_c1 3300050490 Bacteria 2074
405 nmdc:mga00v17_148785_c1 3300050491 Bacteria 1504
406 nmdc:mga00v17_385353_c1 3300050491 Bacteria 911
407 nmdc:mga00v17_8065_c1 3300050491 Bacteria 5654
408 nmdc:mga0yw44_153469_c1 3300050492 Bacteria 1503
409 nmdc:mga06z11_114695_c1 3300050494 Bacteria 1496
410 nmdc:mga07m45_11392_c1 3300050496 Bacteria 4670
411 nmdc:mga08y16_1799169_c1 3300050511 Bacteria 566
412 nmdc:mga0sz30_16094_c2 3300050516 Bacteria 2103
413 nmdc:mga0sz30_37175_c1 3300050516 Bacteria 2037
414 nmdc:mga0sz30_492588_c1 3300050516 Bacteria 551
415 nmdc:mga0sz30_776_c1 3300050516 Bacteria 11640
416 Ga0500610_0006123 3300053079 Bacteria 5014
417 Ga0500643_003704 3300053087 Bacteria 7202
418 Ga0500562_007264 3300053108 Bacteria 2797
419 Ga0500658_0059077 3300053134 Bacteria 1590
420 Ga0500577_0034043 3300053142 Bacteria 1806
421 Ga0500604_0064699 3300053151 Bacteria 1156
422 Ga0500616_0029359 3300053153 Bacteria 3026
423 Ga0500616_0044839 3300053153 Bacteria 2358
424 Ga0500633_0025404 3300053160 Bacteria 1852
425 Ga0500611_169034 3300053727 Bacteria 608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0496870 Ga0495672_0496870_105_530 133
2 3300048910 Ga0496107_0405518 Ga0496107_0405518_21_440 139
3 3300031995 Ga0307409_101339465 Ga0307409_1013394652 140
4 3300041410 Ga0439461_0004106 Ga0439461_0004106_19_441 140
5 3300050516 nmdc:mga0sz30_492588_c1 nmdc:mga0sz30_492588_c1_119_541 140
6 3300053134 Ga0500658_0059077 Ga0500658_0059077_1153_1575 140
7 3300042005 Ga0439448_0021198 Ga0439448_0021198_1541_1993 141
8 3300046615 Ga0495656_0679034 Ga0495656_0679034_116_541 141
9 3300006186 Ga0075369_10003008 Ga0075369_100030089 142
10 3300031824 Ga0307413_11651496 Ga0307413_116514961 142
11 3300031903 Ga0307407_11235118 Ga0307407_112351181 142
12 3300044765 Ga0466970_0039851 Ga0466970_0039851_1922_2374 142
13 3300045976 Ga0466967_0467858 Ga0466967_0467858_244_696 142
14 3300050516 nmdc:mga0sz30_37175_c1 nmdc:mga0sz30_37175_c1_171_623 142
15 3300005547 Ga0070693_100796444 Ga0070693_1007964441 144
16 3300005345 Ga0070692_10055296 Ga0070692_100552964 146
17 3300041451 Ga0451791_0772339 Ga0451791_0772339_85_528 147
18 3300049586 Ga0501070_0157301 Ga0501070_0157301_395_874 148
19 3300002067 JGI24735J21928_10048036 JGI24735J21928_100480363 149
20 3300005367 Ga0070667_100000420 Ga0070667_10000042022 149
21 3300005548 Ga0070665_100046382 Ga0070665_1000463828 149
22 3300005617 Ga0068859_100030153 Ga0068859_1000301536 149
23 3300005618 Ga0068864_100705907 Ga0068864_1007059074 149
24 3300005841 Ga0068863_100000818 Ga0068863_10000081826 149
25 3300005842 Ga0068858_100023732 Ga0068858_1000237328 149
26 3300005843 Ga0068860_100000048 Ga0068860_100000048171 149
27 3300005844 Ga0068862_100000053 Ga0068862_100000053108 149
28 3300006931 Ga0097620_100030152 Ga0097620_1000301526 149
29 3300009101 Ga0105247_10000195 Ga0105247_1000019539 149
30 3300009177 Ga0105248_10000151 Ga0105248_1000015129 149
31 3300009545 Ga0105237_11026073 Ga0105237_110260731 149
32 3300009553 Ga0105249_10000022 Ga0105249_10000022163 149
33 3300013306 Ga0163162_10305334 Ga0163162_103053345 149
34 3300014325 Ga0163163_10060207 Ga0163163_100602076 149
35 3300025900 Ga0207710_10000091 Ga0207710_1000009192 149
36 3300025923 Ga0207681_10001228 Ga0207681_1000122810 149
37 3300025935 Ga0207709_10210672 Ga0207709_102106723 149
38 3300025941 Ga0207711_10000172 Ga0207711_1000017240 149
39 3300025961 Ga0207712_10000005 Ga0207712_10000005164 149
40 3300025986 Ga0207658_10000356 Ga0207658_1000035623 149
41 3300026035 Ga0207703_10034176 Ga0207703_100341766 149
42 3300026088 Ga0207641_10002348 Ga0207641_1000234814 149
43 3300026095 Ga0207676_10626863 Ga0207676_106268634 149
44 3300028379 Ga0268266_10003639 Ga0268266_100036394 149
45 3300028380 Ga0268265_10000005 Ga0268265_10000005456 149
46 3300028381 Ga0268264_10000005 Ga0268264_10000005164 149
47 3300041441 Ga0451787_588158 Ga0451787_588158_234_683 149
48 3300041443 Ga0451789_0517351 Ga0451789_0517351_188_637 149
49 3300041446 Ga0451794_49069 Ga0451794_49069_302_751 149
50 3300041452 Ga0451793_1783229 Ga0451793_1783229_875_1324 149
51 3300041453 Ga0451797_0123005 Ga0451797_0123005_678_1127 149
52 3300041456 Ga0451795_0382023 Ga0451795_0382023_635_1084 149
53 3300041491 Ga0451833_1057544 Ga0451833_1057544_24_473 149
54 3300041498 Ga0451841_0089027 Ga0451841_0089027_93_542 149
55 3300041512 Ga0451853_0782178 Ga0451853_0782178_40_489 149
56 3300044658 Ga0466972_0060674 Ga0466972_0060674_289_738 149
57 3300044901 Ga0466960_0107433 Ga0466960_0107433_812_1261 149
58 3300046460 Ga0495638_0008184 Ga0495638_0008184_2458_2907 149
59 3300046507 Ga0495606_0114519 Ga0495606_0114519_722_1171 149
60 3300048903 Ga0496100_0150505 Ga0496100_0150505_352_801 149
61 3300048904 Ga0496101_0025795 Ga0496101_0025795_3234_3683 149
62 3300048905 Ga0496102_0000050 Ga0496102_0000050_94579_95028 149
63 3300048906 Ga0496103_0000831 Ga0496103_0000831_4934_5383 149
64 3300048910 Ga0496107_0146999 Ga0496107_0146999_1134_1583 149
65 3300048918 Ga0496115_1286563 Ga0496115_1286563_75_524 149
66 3300048920 Ga0496117_0000459 Ga0496117_0000459_4379_4828 149
67 3300048921 Ga0496118_0003972 Ga0496118_0003972_12826_13275 149
68 3300048922 Ga0496119_0013089 Ga0496119_0013089_5105_5554 149
69 3300048923 Ga0496120_0027186 Ga0496120_0027186_307_756 149
70 3300048924 Ga0496121_0013569 Ga0496121_0013569_7036_7485 149
71 3300048927 Ga0496124_0267286 Ga0496124_0267286_505_954 149
72 3300048928 Ga0496125_0015384 Ga0496125_0015384_851_1300 149
73 3300048929 Ga0496126_0007337 Ga0496126_0007337_7795_8244 149
74 3300053087 Ga0500643_003704 Ga0500643_003704_522_971 149
75 3300053142 Ga0500577_0034043 Ga0500577_0034043_667_1116 149
76 3300053153 Ga0500616_0029359 Ga0500616_0029359_2518_2967 149
77 3300053153 Ga0500616_0044839 Ga0500616_0044839_256_705 149
78 3300053160 Ga0500633_0025404 Ga0500633_0025404_842_1291 149
79 3300053727 Ga0500611_169034 Ga0500611_169034_65_514 149
80 3300005340 Ga0070689_100852739 Ga0070689_1008527391 150
81 3300005937 Ga0081455_10020494 Ga0081455_100204947 150
82 3300006048 Ga0075363_100002416 Ga0075363_1000024163 150
83 3300006881 Ga0068865_101638679 Ga0068865_1016386791 150
84 3300025899 Ga0207642_10698975 Ga0207642_106989751 150
85 3300041410 Ga0439461_0023785 Ga0439461_0023785_137_589 150
86 3300041411 Ga0439466_0003951 Ga0439466_0003951_1828_2280 150
87 3300041411 Ga0439466_0094578 Ga0439466_0094578_215_667 150
88 3300041413 Ga0439465_0002227 Ga0439465_0002227_3253_3705 150
89 3300041413 Ga0439465_0009263 Ga0439465_0009263_836_1288 150
90 3300042002 Ga0439442_004458 Ga0439442_004458_489_941 150
91 3300042004 Ga0439445_0003083 Ga0439445_0003083_922_1374 150
92 3300042004 Ga0439445_0005709 Ga0439445_0005709_312_764 150
93 3300046694 Ga0495649_0302438 Ga0495649_0302438_90_542 150
94 3300048905 Ga0496102_0567827 Ga0496102_0567827_231_683 150
95 3300001989 JGI24739J22299_10089461 JGI24739J22299_100894612 151
96 3300001990 JGI24737J22298_10019452 JGI24737J22298_100194526 151
97 3300002067 JGI24735J21928_10078773 JGI24735J21928_100787732 151
98 3300002070 JGI24750J21931_1002778 JGI24750J21931_10027784 151
99 3300002073 JGI24745J21846_1012218 JGI24745J21846_10122182 151
100 3300002075 JGI24738J21930_10006810 JGI24738J21930_100068105 151
101 3300002076 JGI24749J21850_1001310 JGI24749J21850_10013103 151
102 3300002077 JGI24744J21845_10001349 JGI24744J21845_100013497 151
103 3300002239 JGI24034J26672_10014035 JGI24034J26672_100140353 151
104 3300002244 JGI24742J22300_10003976 JGI24742J22300_100039766 151
105 3300005328 Ga0070676_10030968 Ga0070676_100309686 151
106 3300005330 Ga0070690_100106069 Ga0070690_1001060694 151
107 3300005331 Ga0070670_100803041 Ga0070670_1008030412 151
108 3300005334 Ga0068869_100491697 Ga0068869_1004916972 151
109 3300005334 Ga0068869_100738198 Ga0068869_1007381982 151
110 3300005335 Ga0070666_10012464 Ga0070666_100124647 151
111 3300005336 Ga0070680_100250938 Ga0070680_1002509381 151
112 3300005337 Ga0070682_101672228 Ga0070682_1016722281 151
113 3300005338 Ga0068868_100014673 Ga0068868_1000146738 151
114 3300005339 Ga0070660_100350868 Ga0070660_1003508683 151
115 3300005340 Ga0070689_100012121 Ga0070689_1000121218 151
116 3300005341 Ga0070691_10044174 Ga0070691_100441744 151
117 3300005341 Ga0070691_10582667 Ga0070691_105826671 151
118 3300005343 Ga0070687_100175351 Ga0070687_1001753511 151
119 3300005347 Ga0070668_100000242 Ga0070668_1000002424 151
120 3300005353 Ga0070669_100051317 Ga0070669_1000513175 151
121 3300005354 Ga0070675_100548055 Ga0070675_1005480551 151
122 3300005356 Ga0070674_100004607 Ga0070674_10000460711 151
123 3300005356 Ga0070674_101026310 Ga0070674_1010263101 151
124 3300005364 Ga0070673_100875949 Ga0070673_1008759492 151
125 3300005365 Ga0070688_100110304 Ga0070688_1001103043 151
126 3300005366 Ga0070659_100004755 Ga0070659_1000047554 151
127 3300005366 Ga0070659_100735461 Ga0070659_1007354612 151
128 3300005367 Ga0070667_100010100 Ga0070667_1000101002 151
129 3300005406 Ga0070703_10058701 Ga0070703_100587012 151
130 3300005434 Ga0070709_10113400 Ga0070709_101134003 151
131 3300005437 Ga0070710_10003235 Ga0070710_1000323510 151
132 3300005438 Ga0070701_10019354 Ga0070701_100193545 151
133 3300005439 Ga0070711_100000663 Ga0070711_10000066320 151
134 3300005440 Ga0070705_100031394 Ga0070705_1000313945 151
135 3300005441 Ga0070700_100044230 Ga0070700_1000442305 151
136 3300005455 Ga0070663_100105506 Ga0070663_1001055064 151
137 3300005456 Ga0070678_100000459 Ga0070678_10000045923 151
138 3300005457 Ga0070662_100064570 Ga0070662_1000645704 151
139 3300005458 Ga0070681_10254318 Ga0070681_102543184 151
140 3300005459 Ga0068867_100007547 Ga0068867_1000075474 151
141 3300005466 Ga0070685_10074540 Ga0070685_100745404 151
142 3300005539 Ga0068853_100006833 Ga0068853_1000068334 151
143 3300005545 Ga0070695_100413927 Ga0070695_1004139273 151
144 3300005546 Ga0070696_100007179 Ga0070696_1000071793 151
145 3300005547 Ga0070693_100008532 Ga0070693_1000085323 151
146 3300005548 Ga0070665_100218072 Ga0070665_1002180722 151
147 3300005549 Ga0070704_100078798 Ga0070704_1000787985 151
148 3300005563 Ga0068855_100107660 Ga0068855_1001076606 151
149 3300005578 Ga0068854_100053258 Ga0068854_1000532585 151
150 3300005614 Ga0068856_100125448 Ga0068856_1001254484 151
151 3300005614 Ga0068856_101678422 Ga0068856_1016784221 151
152 3300005615 Ga0070702_100010544 Ga0070702_1000105444 151
153 3300005616 Ga0068852_100537544 Ga0068852_1005375445 151
154 3300005617 Ga0068859_100007479 Ga0068859_10000747914 151
155 3300005618 Ga0068864_100761067 Ga0068864_1007610672 151
156 3300005718 Ga0068866_10004533 Ga0068866_100045338 151
157 3300005719 Ga0068861_100004705 Ga0068861_1000047053 151
158 3300005842 Ga0068858_100011821 Ga0068858_10001182111 151
159 3300005842 Ga0068858_101241829 Ga0068858_1012418291 151
160 3300005843 Ga0068860_100012097 Ga0068860_1000120973 151
161 3300005844 Ga0068862_100141809 Ga0068862_1001418094 151
162 3300006038 Ga0075365_10488580 Ga0075365_104885801 151
163 3300006048 Ga0075363_100038920 Ga0075363_1000389204 151
164 3300006051 Ga0075364_10004937 Ga0075364_1000493711 151
165 3300006163 Ga0070715_10019728 Ga0070715_100197285 151
166 3300006173 Ga0070716_100017188 Ga0070716_1000171884 151
167 3300006175 Ga0070712_100001159 Ga0070712_10000115919 151
168 3300006177 Ga0075362_10068655 Ga0075362_100686555 151
169 3300006178 Ga0075367_10140498 Ga0075367_101404983 151
170 3300006237 Ga0097621_100034529 Ga0097621_1000345292 151
171 3300006358 Ga0068871_100037026 Ga0068871_1000370267 151
172 3300006881 Ga0068865_100004581 Ga0068865_10000458112 151
173 3300006931 Ga0097620_100007479 Ga0097620_10000747914 151
174 3300007788 Ga0099795_10033819 Ga0099795_100338192 151
175 3300009098 Ga0105245_10001283 Ga0105245_1000128326 151
176 3300009101 Ga0105247_10001525 Ga0105247_1000152521 151
177 3300009148 Ga0105243_10000773 Ga0105243_1000077331 151
178 3300009174 Ga0105241_10108958 Ga0105241_101089584 151
179 3300009176 Ga0105242_10011770 Ga0105242_1001177010 151
180 3300009177 Ga0105248_10092423 Ga0105248_100924236 151
181 3300009545 Ga0105237_10078629 Ga0105237_100786295 151
182 3300009551 Ga0105238_10399144 Ga0105238_103991443 151
183 3300009553 Ga0105249_10004515 Ga0105249_1000451516 151
184 3300009553 Ga0105249_11094272 Ga0105249_110942722 151
185 3300010375 Ga0105239_10265819 Ga0105239_102658192 151
186 3300010375 Ga0105239_10744172 Ga0105239_107441722 151
187 3300011119 Ga0105246_10209475 Ga0105246_102094755 151
188 3300013102 Ga0157371_10276098 Ga0157371_102760982 151
189 3300013105 Ga0157369_11111949 Ga0157369_111119492 151
190 3300013296 Ga0157374_10247874 Ga0157374_102478743 151
191 3300013297 Ga0157378_10002823 Ga0157378_1000282322 151
192 3300013306 Ga0163162_10002292 Ga0163162_1000229220 151
193 3300013306 Ga0163162_10131792 Ga0163162_101317925 151
194 3300013306 Ga0163162_11041825 Ga0163162_110418252 151
195 3300013307 Ga0157372_10030734 Ga0157372_100307344 151
196 3300013308 Ga0157375_10230452 Ga0157375_102304523 151
197 3300014325 Ga0163163_10108313 Ga0163163_101083135 151
198 3300014326 Ga0157380_10006763 Ga0157380_1000676311 151
199 3300014745 Ga0157377_10114241 Ga0157377_101142415 151
200 3300014968 Ga0157379_10471190 Ga0157379_104711902 151
201 3300017792 Ga0163161_10000939 Ga0163161_1000093928 151
202 3300025711 Ga0207696_1069020 Ga0207696_10690202 151
203 3300025898 Ga0207692_10074289 Ga0207692_100742892 151
204 3300025899 Ga0207642_10000995 Ga0207642_1000099511 151
205 3300025900 Ga0207710_10003297 Ga0207710_1000329710 151
206 3300025901 Ga0207688_10002070 Ga0207688_100020704 151
207 3300025901 Ga0207688_10165542 Ga0207688_101655423 151
208 3300025903 Ga0207680_10021721 Ga0207680_100217216 151
209 3300025905 Ga0207685_10024431 Ga0207685_100244316 151
210 3300025906 Ga0207699_10022805 Ga0207699_100228054 151
211 3300025907 Ga0207645_10009732 Ga0207645_100097327 151
212 3300025911 Ga0207654_10037199 Ga0207654_100371994 151
213 3300025914 Ga0207671_10079406 Ga0207671_100794064 151
214 3300025915 Ga0207693_10000513 Ga0207693_1000051335 151
215 3300025916 Ga0207663_10002243 Ga0207663_1000224311 151
216 3300025917 Ga0207660_10158352 Ga0207660_101583523 151
217 3300025918 Ga0207662_10010024 Ga0207662_100100246 151
218 3300025919 Ga0207657_10322538 Ga0207657_103225383 151
219 3300025921 Ga0207652_10957337 Ga0207652_109573372 151
220 3300025923 Ga0207681_10074200 Ga0207681_100742005 151
221 3300025927 Ga0207687_10006399 Ga0207687_100063996 151
222 3300025932 Ga0207690_10069097 Ga0207690_100690975 151
223 3300025933 Ga0207706_10005762 Ga0207706_100057624 151
224 3300025934 Ga0207686_10021838 Ga0207686_100218386 151
225 3300025935 Ga0207709_10020181 Ga0207709_100201816 151
226 3300025936 Ga0207670_10012662 Ga0207670_100126625 151
227 3300025937 Ga0207669_10001354 Ga0207669_100013549 151
228 3300025937 Ga0207669_10749138 Ga0207669_107491382 151
229 3300025938 Ga0207704_10022607 Ga0207704_100226076 151
230 3300025939 Ga0207665_10027810 Ga0207665_100278104 151
231 3300025941 Ga0207711_10131142 Ga0207711_101311423 151
232 3300025942 Ga0207689_10179637 Ga0207689_101796374 151
233 3300025949 Ga0207667_10197457 Ga0207667_101974575 151
234 3300025960 Ga0207651_10173783 Ga0207651_101737835 151
235 3300025961 Ga0207712_10067682 Ga0207712_100676825 151
236 3300025972 Ga0207668_10008387 Ga0207668_100083876 151
237 3300025981 Ga0207640_10100826 Ga0207640_101008263 151
238 3300025986 Ga0207658_10220114 Ga0207658_102201143 151
239 3300026023 Ga0207677_10014185 Ga0207677_100141854 151
240 3300026035 Ga0207703_10009257 Ga0207703_100092575 151
241 3300026041 Ga0207639_10041715 Ga0207639_100417155 151
242 3300026067 Ga0207678_10147642 Ga0207678_101476424 151
243 3300026075 Ga0207708_10014048 Ga0207708_1001404811 151
244 3300026078 Ga0207702_10278063 Ga0207702_102780633 151
245 3300026088 Ga0207641_10180506 Ga0207641_101805064 151
246 3300026089 Ga0207648_10001669 Ga0207648_100016694 151
247 3300026118 Ga0207675_100004512 Ga0207675_1000045123 151
248 3300026121 Ga0207683_10001309 Ga0207683_100013094 151
249 3300026121 Ga0207683_10326300 Ga0207683_103263003 151
250 3300026142 Ga0207698_10207385 Ga0207698_102073855 151
251 3300027512 Ga0209179_1014912 Ga0209179_10149121 151
252 3300028379 Ga0268266_10581821 Ga0268266_105818212 151
253 3300028380 Ga0268265_10150238 Ga0268265_101502385 151
254 3300028381 Ga0268264_10005001 Ga0268264_1000500114 151
255 3300031852 Ga0307410_10131975 Ga0307410_101319755 151
256 3300035090 Ga0373949_0078971 Ga0373949_0078971_265_744 151
257 3300035691 Ga0373931_0021763 Ga0373931_0021763_2015_2494 151
258 3300048903 Ga0496100_0003502 Ga0496100_0003502_1208_1687 151
259 3300048903 Ga0496100_0287779 Ga0496100_0287779_50_505 151
260 3300048904 Ga0496101_0003730 Ga0496101_0003730_7131_7610 151
261 3300048905 Ga0496102_0134667 Ga0496102_0134667_1197_1676 151
262 3300048905 Ga0496102_0564942 Ga0496102_0564942_57_512 151
263 3300048905 Ga0496102_0614044 Ga0496102_0614044_261_716 151
264 3300048906 Ga0496103_0002661 Ga0496103_0002661_6487_6966 151
265 3300048907 Ga0496104_0138632 Ga0496104_0138632_1834_2289 151
266 3300048908 Ga0496105_0150665 Ga0496105_0150665_872_1327 151
267 3300048909 Ga0496106_0006678 Ga0496106_0006678_2107_2586 151
268 3300048910 Ga0496107_0004101 Ga0496107_0004101_7534_8013 151
269 3300048911 Ga0496108_0001423 Ga0496108_0001423_16481_16936 151
270 3300048912 Ga0496109_0015166 Ga0496109_0015166_1516_1971 151
271 3300048913 Ga0496110_0198206 Ga0496110_0198206_594_1049 151
272 3300048914 Ga0496111_0430858 Ga0496111_0430858_493_948 151
273 3300048915 Ga0496112_0101548 Ga0496112_0101548_333_788 151
274 3300048917 Ga0496114_0006229 Ga0496114_0006229_6701_7180 151
275 3300048917 Ga0496114_0449439 Ga0496114_0449439_651_1106 151
276 3300048918 Ga0496115_0059278 Ga0496115_0059278_2015_2494 151
277 3300037853 Ga0436364_0431232 Ga0436364_0431232_346_846 152
278 3300053079 Ga0500610_0006123 Ga0500610_0006123_3335_3793 152
279 3300053108 Ga0500562_007264 Ga0500562_007264_151_609 152
280 3300012508 Ga0157315_1018580 Ga0157315_10185802 154
281 iso_pu_bacteria 2643221687 2644486970 154
282 iso_pu_bacteria 2902792274 2902792862 154
283 3300005719 Ga0068861_101955646 Ga0068861_1019556462 155
284 iso_pu_bacteria 2738541264 2738664167 155
285 iso_pu_bacteria 2738541356 2739143302 155
286 iso_pu_bacteria 2842134933 2842136671 155
287 iso_pu_bacteria 2929212328 2929213673 155
288 3300006028 Ga0070717_10795776 Ga0070717_107957762 156
289 3300011119 Ga0105246_10098785 Ga0105246_100987853 156
290 3300013306 Ga0163162_12233424 Ga0163162_122334242 156
291 3300013308 Ga0157375_10740364 Ga0157375_107403642 156
292 3300045976 Ga0466967_0069194 Ga0466967_0069194_811_1281 156
293 3300048905 Ga0496102_0441674 Ga0496102_0441674_453_923 156
294 3300048911 Ga0496108_0033164 Ga0496108_0033164_791_1261 156
295 3300048912 Ga0496109_0830242 Ga0496109_0830242_71_541 156
296 3300048917 Ga0496114_0390655 Ga0496114_0390655_419_889 156
297 3300048918 Ga0496115_0907690 Ga0496115_0907690_16_486 156
298 3300021388 Ga0213875_10065998 Ga0213875_100659984 157
299 3300037853 Ga0436364_0677668 Ga0436364_0677668_3432_3905 157
300 3300039437 Ga0436365_1586243 Ga0436365_1586243_2414_2887 157
301 3300005548 Ga0070665_100742449 Ga0070665_1007424493 158
302 3300005615 Ga0070702_101026095 Ga0070702_1010260951 158
303 3300006038 Ga0075365_10387717 Ga0075365_103877172 158
304 3300006051 Ga0075364_10080057 Ga0075364_100800575 158
305 3300006186 Ga0075369_10001719 Ga0075369_1000171910 158
306 3300009094 Ga0111539_12793291 Ga0111539_127932911 158
307 3300009545 Ga0105237_10036627 Ga0105237_100366274 158
308 3300009551 Ga0105238_10085801 Ga0105238_100858013 158
309 3300010375 Ga0105239_10030172 Ga0105239_100301726 158
310 3300013307 Ga0157372_11332350 Ga0157372_113323502 158
311 3300025914 Ga0207671_10010972 Ga0207671_100109727 158
312 3300025924 Ga0207694_10046859 Ga0207694_100468596 158
313 3300025972 Ga0207668_10000756 Ga0207668_1000075616 158
314 3300026067 Ga0207678_10232451 Ga0207678_102324511 158
315 3300026142 Ga0207698_11526232 Ga0207698_115262321 158
316 3300027907 Ga0207428_11198099 Ga0207428_111980991 158
317 3300028379 Ga0268266_10587403 Ga0268266_105874033 158
318 3300032002 Ga0307416_101270601 Ga0307416_1012706012 158
319 3300046524 Ga0495648_0013467 Ga0495648_0013467_2211_2687 158
320 3300046692 Ga0495671_0227086 Ga0495671_0227086_169_645 158
321 3300047320 Ga0495672_0011184 Ga0495672_0011184_2660_3136 158
322 3300047469 Ga0495673_0003826 Ga0495673_0003826_3808_4284 158
323 3300048903 Ga0496100_0199202 Ga0496100_0199202_59_535 158
324 3300048904 Ga0496101_0000047 Ga0496101_0000047_54362_54838 158
325 3300048905 Ga0496102_0000003 Ga0496102_0000003_391496_391972 158
326 3300048906 Ga0496103_0000012 Ga0496103_0000012_101008_101484 158
327 3300048909 Ga0496106_0012798 Ga0496106_0012798_2133_2609 158
328 3300048919 Ga0496116_0000040 Ga0496116_0000040_146136_146612 158
329 3300048920 Ga0496117_0000003 Ga0496117_0000003_200292_200768 158
330 3300048921 Ga0496118_0000001 Ga0496118_0000001_200295_200771 158
331 3300048922 Ga0496119_0000142 Ga0496119_0000142_57430_57906 158
332 3300048923 Ga0496120_0000149 Ga0496120_0000149_11054_11530 158
333 3300048924 Ga0496121_0000019 Ga0496121_0000019_400894_401370 158
334 3300048929 Ga0496126_0000785 Ga0496126_0000785_41913_42389 158
335 3300050511 nmdc:mga08y16_1799169_c1 nmdc:mga08y16_1799169_c1_41_517 158
336 3300050516 nmdc:mga0sz30_16094_c2 nmdc:mga0sz30_16094_c2_1605_2081 158
337 3300005347 Ga0070668_100922172 Ga0070668_1009221722 159
338 3300005467 Ga0070706_101004897 Ga0070706_1010048971 159
339 3300005841 Ga0068863_100403257 Ga0068863_1004032572 159
340 3300006038 Ga0075365_10096368 Ga0075365_100963683 159
341 3300006931 Ga0097620_100436575 Ga0097620_1004365755 159
342 3300013306 Ga0163162_10084462 Ga0163162_100844625 159
343 3300017792 Ga0163161_10659349 Ga0163161_106593492 159
344 3300025901 Ga0207688_10602041 Ga0207688_106020412 159
345 3300025932 Ga0207690_10471504 Ga0207690_104715044 159
346 3300026023 Ga0207677_10709714 Ga0207677_107097143 159
347 3300026088 Ga0207641_10658171 Ga0207641_106581712 159
348 3300032002 Ga0307416_102195129 Ga0307416_1021951291 159
349 3300039437 Ga0436365_0433813 Ga0436365_0433813_1909_2388 159
350 3300039450 Ga0436363_1499070 Ga0436363_1499070_117_596 159
351 3300039450 Ga0436363_1673198 Ga0436363_1673198_15_494 159
352 3300042002 Ga0439442_013676 Ga0439442_013676_1136_1615 159
353 3300049571 Ga0501034_0138127 Ga0501034_0138127_263_742 159
354 3300050490 nmdc:mga03n38_119047_c1 nmdc:mga03n38_119047_c1_151_630 159
355 3300050490 nmdc:mga03n38_38269_c1 nmdc:mga03n38_38269_c1_1022_1501 159
356 3300050491 nmdc:mga00v17_148785_c1 nmdc:mga00v17_148785_c1_665_1144 159
357 3300050491 nmdc:mga00v17_385353_c1 nmdc:mga00v17_385353_c1_203_682 159
358 3300050496 nmdc:mga07m45_11392_c1 nmdc:mga07m45_11392_c1_3290_3769 159
359 3300053151 Ga0500604_0064699 Ga0500604_0064699_525_1004 159
360 3300000545 CNXas_1002950 CNXas_10029502 160
361 3300001990 JGI24737J22298_10014221 JGI24737J22298_100142215 160
362 3300001991 JGI24743J22301_10002717 JGI24743J22301_100027175 160
363 3300002070 JGI24750J21931_1006249 JGI24750J21931_10062492 160
364 3300002077 JGI24744J21845_10007272 JGI24744J21845_100072724 160
365 3300005334 Ga0068869_100020924 Ga0068869_1000209242 160
366 3300005335 Ga0070666_10163592 Ga0070666_101635921 160
367 3300005336 Ga0070680_100193132 Ga0070680_1001931323 160
368 3300005337 Ga0070682_100444346 Ga0070682_1004443461 160
369 3300005353 Ga0070669_100158534 Ga0070669_1001585342 160
370 3300005365 Ga0070688_100129136 Ga0070688_1001291362 160
371 3300005366 Ga0070659_100271805 Ga0070659_1002718052 160
372 3300005367 Ga0070667_100027586 Ga0070667_1000275866 160
373 3300005406 Ga0070703_10250041 Ga0070703_102500411 160
374 3300005438 Ga0070701_10089230 Ga0070701_100892305 160
375 3300005455 Ga0070663_100224019 Ga0070663_1002240192 160
376 3300005459 Ga0068867_100175003 Ga0068867_1001750032 160
377 3300005466 Ga0070685_10241501 Ga0070685_102415014 160
378 3300005543 Ga0070672_100111485 Ga0070672_1001114852 160
379 3300005548 Ga0070665_100220414 Ga0070665_1002204144 160
380 3300005549 Ga0070704_100103964 Ga0070704_1001039643 160
381 3300005615 Ga0070702_100193792 Ga0070702_1001937922 160
382 3300005615 Ga0070702_100214777 Ga0070702_1002147774 160
383 3300005617 Ga0068859_100404890 Ga0068859_1004048905 160
384 3300005841 Ga0068863_100100765 Ga0068863_1001007655 160
385 3300005844 Ga0068862_101424913 Ga0068862_1014249131 160
386 3300006881 Ga0068865_100266482 Ga0068865_1002664824 160
387 3300006931 Ga0097620_100404876 Ga0097620_1004048761 160
388 3300009092 Ga0105250_10219602 Ga0105250_102196022 160
389 3300009098 Ga0105245_10466966 Ga0105245_104669662 160
390 3300009177 Ga0105248_10198857 Ga0105248_101988573 160
391 3300009545 Ga0105237_10274922 Ga0105237_102749223 160
392 3300009551 Ga0105238_11210018 Ga0105238_112100182 160
393 3300011119 Ga0105246_10289796 Ga0105246_102897962 160
394 3300013105 Ga0157369_10069869 Ga0157369_100698697 160
395 3300013306 Ga0163162_10789545 Ga0163162_107895454 160
396 3300025885 Ga0207653_10078407 Ga0207653_100784072 160
397 3300025900 Ga0207710_10011748 Ga0207710_100117487 160
398 3300025901 Ga0207688_10001765 Ga0207688_1000176517 160
399 3300025904 Ga0207647_10071279 Ga0207647_100712793 160
400 3300025917 Ga0207660_10366999 Ga0207660_103669994 160
401 3300025923 Ga0207681_10315023 Ga0207681_103150232 160
402 3300025924 Ga0207694_10815257 Ga0207694_108152572 160
403 3300025926 Ga0207659_11135035 Ga0207659_111350351 160
404 3300025927 Ga0207687_10102941 Ga0207687_101029412 160
405 3300025931 Ga0207644_10319629 Ga0207644_103196294 160
406 3300025932 Ga0207690_11104884 Ga0207690_111048841 160
407 3300025940 Ga0207691_10416114 Ga0207691_104161141 160
408 3300025942 Ga0207689_10019854 Ga0207689_100198546 160
409 3300025942 Ga0207689_10366219 Ga0207689_103662191 160
410 3300025961 Ga0207712_11313053 Ga0207712_113130531 160
411 3300026023 Ga0207677_10182898 Ga0207677_101828983 160
412 3300026067 Ga0207678_10128206 Ga0207678_101282064 160
413 3300026089 Ga0207648_10282611 Ga0207648_102826114 160
414 3300026095 Ga0207676_11144248 Ga0207676_111442482 160
415 3300026142 Ga0207698_10382201 Ga0207698_103822014 160
416 3300028379 Ga0268266_10852896 Ga0268266_108528963 160
417 3300028380 Ga0268265_10751434 Ga0268265_107514342 160
418 3300028381 Ga0268264_10758220 Ga0268264_107582202 160
419 3300036401 Ga0373937_1094125 Ga0373937_1094125_142_624 160
420 3300046683 Ga0495658_0003996 Ga0495658_0003996_404_886 160
421 3300047319 Ga0495674_0326653 Ga0495674_0326653_82_564 160
422 3300047321 Ga0495676_0095431 Ga0495676_0095431_960_1442 160
423 3300047673 Ga0495593_0012968 Ga0495593_0012968_926_1408 160
424 3300048909 Ga0496106_0139460 Ga0496106_0139460_182_664 160
425 3300048912 Ga0496109_0645971 Ga0496109_0645971_175_657 160
426 3300050489 nmdc:mga03683_43180_c1 nmdc:mga03683_43180_c1_457_939 160
427 3300050490 nmdc:mga03n38_22624_c1 nmdc:mga03n38_22624_c1_370_852 160
428 3300050491 nmdc:mga00v17_8065_c1 nmdc:mga00v17_8065_c1_2572_3054 160
429 3300050492 nmdc:mga0yw44_153469_c1 nmdc:mga0yw44_153469_c1_19_501 160
430 3300050494 nmdc:mga06z11_114695_c1 nmdc:mga06z11_114695_c1_348_830 160
431 3300050516 nmdc:mga0sz30_776_c1 nmdc:mga0sz30_776_c1_8358_8840 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

6

138

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.9228 6 146
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.9199 1 158
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.9142 1 158
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.9136 1 159
5zy8-assembly1.cif.gz_C crystal structure of c terminal truncated hadbc (3r-hydroxyacyl-acp dehydratase) complex from mycobacterium tuberculosis 0.9135 6 144
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9175 7 147 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9137 1 159 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9082 1 159 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9071 7 144 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9009 7 144 3.10.129.10
ID Description Score Start End GO Terms
AF-Q0RYL4-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9225 7 147
AF-A0A0R3EJ09-F1-model_v4 UPF0336 protein AOT86_20635 0.9224 1 156
AF-A0A150A8F5-F1-model_v4 Acyl dehydratase 0.9176 7 147 GO:0006633
GO:0019171
AF-A0A0R3EJ09-F1-model_v4 UPF0336 protein AOT86_20635 0.9168 1 156
AF-A0A260BLY3-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9132 7 146

Feature Viewer

pLDDT pTM Quality
83.58 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map