F442363

General Info

Members Datasets Scaffolds Average Seq Length
431 216 862 422

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10024674|Ga0157372_100246742
Length 473
Sequence LRKPQKTAKNAREMVGLVRLCSPAITLCWGYXXXXSAKRLIEIPPDCGDDLGVAEMALTDTAIKNAKPKAKPYKLADEKGLHLLVHPSGGLLWRMKYRVDGADDHGQPKRIEKLLSFGSYPEISLKGARVLRDDARKQLAEGIDPGQAKKEAKIATMLGAANSFEAVAEEYISRIEQEGRAQATMDKVRWLSTLLIPAIGPRPVAEVTPHELLAVLKKVEQSGKRETAGRMRSFASRVFRYAVATARASNDPAHMLLGALVPPKVKHHAAITDPKALGELLRAMDSYQGQPATLYALRLTPHIFQRPGEVRQMEWSEIDFDKAVWTIPASRMKMREPHHVPLSEQALAILRDMQALTGRGTYVFPSIRSASRPMSENTINGALRRLGYSGDEMTAHGFRSTASSLLNESGKWNVDAIERALAHREANQVRAAYHRSIYWPERVQMAQWWSDYLDQLRIGAEVVPFPSSAKWAG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
176 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
196 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
197 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
203 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
204 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
205 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
208 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
209 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
210 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
211 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
212 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
213 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
214 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
215 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
216 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.4
Nodule 0
Rhizoplane 3.94
Rhizosphere 68.45
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10024674 3300013307 Bacteria 6535
2 JGI24736J21556_1002515 3300001904 Bacteria 3240
3 JGI24741J21665_1009633 3300001915 Bacteria 1766
4 JGI24752J21851_1000488 3300001976 Bacteria 5310
5 JGI24740J21852_10002692 3300001979 Bacteria 7972
6 JGI24740J21852_10003184 3300001979 Bacteria 7247
7 JGI24740J21852_10028759 3300001979 Bacteria 1833
8 JGI24739J22299_10016653 3300001989 Bacteria 2658
9 JGI24739J22299_10016989 3300001989 Bacteria 2630
10 JGI24737J22298_10000317 3300001990 Bacteria 16169
11 JGI24737J22298_10017610 3300001990 Bacteria 2300
12 JGI24735J21928_10001472 3300002067 Bacteria 8324
13 JGI24735J21928_10004226 3300002067 Bacteria 4844
14 JGI24748J21848_1000718 3300002074 Bacteria 3580
15 JGI24738J21930_10000773 3300002075 Bacteria 9144
16 JGI24034J26672_10002407 3300002239 Bacteria 2573
17 JGI24751J29686_10000131 3300002459 Bacteria 37771
18 rootL2_10234077 3300003322 Bacteria 1997
19 Ga0055529_1000045 3300003763 Bacteria 209617
20 Ga0055536_1000377 3300003781 Bacteria 32807
21 Ga0055536_1000758 3300003781 Bacteria 21512
22 Ga0055531_10000292 3300003794 Bacteria 50059
23 Ga0065707_10081738 3300005295 Bacteria 54410
24 Ga0065707_10081989 3300005295 Bacteria 26006
25 Ga0065707_10084047 3300005295 Bacteria 7779
26 Ga0070683_100172532 3300005329 Bacteria 2053
27 Ga0070670_100001497 3300005331 Bacteria 18824
28 Ga0070666_10004937 3300005335 Bacteria 8161
29 Ga0070666_10046107 3300005335 Bacteria 2923
30 Ga0070680_100032382 3300005336 Bacteria 4208
31 Ga0070660_100088097 3300005339 Bacteria 2444
32 Ga0070668_100000081 3300005347 Bacteria 59959
33 Ga0070669_100000192 3300005353 Bacteria 53873
34 Ga0070669_100000776 3300005353 Bacteria 23176
35 Ga0070669_100002663 3300005353 Bacteria 12860
36 Ga0070671_100001129 3300005355 Bacteria 19815
37 Ga0070671_100013869 3300005355 Bacteria 6501
38 Ga0070659_100038769 3300005366 Bacteria 3717
39 Ga0070659_100066504 3300005366 Bacteria 2856
40 Ga0070659_100112910 3300005366 Bacteria 2194
41 Ga0070667_100000211 3300005367 Bacteria 67927
42 Ga0070667_100000926 3300005367 Bacteria 27083
43 Ga0070667_100001140 3300005367 Bacteria 24152
44 Ga0070667_100010295 3300005367 Bacteria 7726
45 Ga0070663_100007255 3300005455 Bacteria 6738
46 Ga0070663_100067566 3300005455 Bacteria 2593
47 Ga0070678_100000094 3300005456 Bacteria 34168
48 Ga0070662_100035713 3300005457 Bacteria 3512
49 Ga0070662_100037288 3300005457 Bacteria 3446
50 Ga0070662_100066976 3300005457 Bacteria 2636
51 Ga0070662_100192599 3300005457 Bacteria 1613
52 Ga0068853_100040373 3300005539 Bacteria 3981
53 Ga0068853_100080353 3300005539 Bacteria 2852
54 Ga0070665_100004936 3300005548 Bacteria 13835
55 Ga0070665_100015137 3300005548 Bacteria 7743
56 Ga0068855_100007101 3300005563 Bacteria 13589
57 Ga0068855_100071478 3300005563 Bacteria 4035
58 Ga0068855_100094214 3300005563 Bacteria 3453
59 Ga0068855_100112410 3300005563 Bacteria 3125
60 Ga0068855_100130672 3300005563 Bacteria 2868
61 Ga0068855_100187173 3300005563 Bacteria 2338
62 Ga0068855_100338229 3300005563 Bacteria 1660
63 Ga0070664_100007340 3300005564 Bacteria 8883
64 Ga0068857_100014866 3300005577 Bacteria 6788
65 Ga0068857_100085521 3300005577 Bacteria 2819
66 Ga0068857_100104293 3300005577 Bacteria 2545
67 Ga0068854_100010602 3300005578 Bacteria 5981
68 Ga0068854_100013589 3300005578 Bacteria 5349
69 Ga0068854_100020121 3300005578 Bacteria 4509
70 Ga0068854_100072356 3300005578 Bacteria 2524
71 Ga0068854_100164260 3300005578 Bacteria 1722
72 Ga0068854_100190587 3300005578 Bacteria 1606
73 Ga0068856_100145423 3300005614 Bacteria 2378
74 Ga0068856_100225946 3300005614 Bacteria 1887
75 Ga0068852_100012859 3300005616 Bacteria 6380
76 Ga0068852_100038163 3300005616 Bacteria 4035
77 Ga0068864_100000642 3300005618 Bacteria 29378
78 Ga0068864_100340421 3300005618 Bacteria 1413
79 Ga0068861_100000201 3300005719 Bacteria 31934
80 Ga0068851_10007335 3300005834 Bacteria 5058
81 Ga0068851_10007799 3300005834 Bacteria 4926
82 Ga0068851_10035267 3300005834 Bacteria 2500
83 Ga0068863_100000005 3300005841 Bacteria 269757
84 Ga0068863_100000113 3300005841 Bacteria 85761
85 Ga0068863_100000178 3300005841 Bacteria 67693
86 Ga0068863_100000515 3300005841 Bacteria 39374
87 Ga0068863_100012337 3300005841 Bacteria 8250
88 Ga0068863_100029739 3300005841 Bacteria 5216
89 Ga0068858_100000304 3300005842 Bacteria 52470
90 Ga0068858_100000575 3300005842 Bacteria 38389
91 Ga0068858_100001411 3300005842 Bacteria 24666
92 Ga0068858_100090199 3300005842 Bacteria 2852
93 Ga0068860_100000076 3300005843 Bacteria 171786
94 Ga0068860_100002857 3300005843 Bacteria 17934
95 Ga0068860_100011503 3300005843 Bacteria 8721
96 Ga0068862_100026255 3300005844 Bacteria 4895
97 Ga0068862_100027758 3300005844 Bacteria 4765
98 Ga0068862_100104434 3300005844 Bacteria 2482
99 Ga0068862_100165863 3300005844 Bacteria 1974
100 Ga0068862_100294539 3300005844 Bacteria 1491
101 Ga0075365_10001441 3300006038 Bacteria 10781
102 Ga0075368_10000260 3300006042 Bacteria 15191
103 Ga0075363_100000420 3300006048 Bacteria 13185
104 Ga0075363_100001211 3300006048 Bacteria 9531
105 Ga0075364_10000603 3300006051 Bacteria 18593
106 Ga0075364_10003051 3300006051 Bacteria 9458
107 Ga0075432_10001227 3300006058 Bacteria 8251
108 Ga0075367_10000037 3300006178 Bacteria 29457
109 Ga0075369_10000171 3300006186 Bacteria 18596
110 Ga0075369_10002760 3300006186 Bacteria 6304
111 Ga0075366_10000075 3300006195 Bacteria 38646
112 Ga0075366_10049429 3300006195 Bacteria 2495
113 Ga0097621_100149437 3300006237 Bacteria 2002
114 Ga0075370_10018861 3300006353 Bacteria 3746
115 Ga0075370_10076057 3300006353 Bacteria 1925
116 Ga0105240_10014198 3300009093 Bacteria 10878
117 Ga0105240_10057904 3300009093 Bacteria 4838
118 Ga0105240_10079232 3300009093 Bacteria 4043
119 Ga0105240_10196701 3300009093 Bacteria 2366
120 Ga0105245_10017780 3300009098 Bacteria 6205
121 Ga0105247_10005028 3300009101 Bacteria 8395
122 Ga0105243_10154990 3300009148 Bacteria 1969
123 Ga0105241_10001518 3300009174 Bacteria 17788
124 Ga0105241_10010487 3300009174 Bacteria 6797
125 Ga0105241_10029882 3300009174 Bacteria 4069
126 Ga0105248_10001699 3300009177 Bacteria 24508
127 Ga0105248_10011310 3300009177 Bacteria 9840
128 Ga0105248_10014579 3300009177 Bacteria 8651
129 Ga0105248_10218793 3300009177 Unclassified 2144
130 Ga0105248_10358438 3300009177 Bacteria 1642
131 Ga0105237_10058224 3300009545 Bacteria 3868
132 Ga0105237_10072022 3300009545 Bacteria 3450
133 Ga0105237_10099724 3300009545 Bacteria 2896
134 Ga0105238_10022102 3300009551 Bacteria 6486
135 Ga0105238_10053878 3300009551 Bacteria 4042
136 Ga0105238_10060651 3300009551 Bacteria 3787
137 Ga0105249_10001726 3300009553 Bacteria 19123
138 Ga0105239_10028039 3300010375 Bacteria 6197
139 Ga0105239_10069570 3300010375 Bacteria 3867
140 Ga0105239_10235530 3300010375 Bacteria 2055
141 Ga0105246_10007335 3300011119 Bacteria 6755
142 Ga0157373_10075121 3300013100 Bacteria 2385
143 Ga0157371_10000011 3300013102 Bacteria 377608
144 Ga0157371_10001436 3300013102 Bacteria 24743
145 Ga0157371_10096010 3300013102 Bacteria 2101
146 Ga0157370_10001878 3300013104 Bacteria 25891
147 Ga0157370_10077570 3300013104 Bacteria 3129
148 Ga0157370_10081186 3300013104 Bacteria 3052
149 Ga0157369_10003126 3300013105 Bacteria 19790
150 Ga0157369_10004722 3300013105 Bacteria 16019
151 Ga0157369_10004757 3300013105 Bacteria 15960
152 Ga0157369_10031001 3300013105 Bacteria 5892
153 Ga0157369_10273255 3300013105 Bacteria 1761
154 Ga0157369_10291895 3300013105 Bacteria 1697
155 Ga0157378_10004604 3300013297 Bacteria 12098
156 Ga0157378_10062347 3300013297 Bacteria 3329
157 Ga0163162_10030331 3300013306 Bacteria 5358
158 Ga0163162_10143267 3300013306 Bacteria 2504
159 Ga0157372_10003423 3300013307 Bacteria 17122
160 Ga0157372_10013848 3300013307 Bacteria 8611
161 Ga0157375_10266435 3300013308 Bacteria 1875
162 Ga0163163_10066853 3300014325 Bacteria 3572
163 Ga0157380_10000063 3300014326 Bacteria 61666
164 Ga0157380_10017674 3300014326 Bacteria 5281
165 Ga0157380_10053545 3300014326 Bacteria 3200
166 Ga0157379_10001908 3300014968 Bacteria 17245
167 Ga0163161_10140540 3300017792 Bacteria 1828
168 Ga0213875_10000415 3300021388 Bacteria 37517
169 Ga0209147_100740 3300025229 Bacteria 16154
170 Ga0209148_1000011 3300025254 Bacteria 1196503
171 Ga0209455_1000006 3300025272 Bacteria 1196503
172 Ga0209676_1000113 3300025292 Bacteria 207931
173 Ga0209676_1007809 3300025292 Bacteria 4922
174 Ga0209050_1000126 3300025298 Bacteria 188438
175 Ga0209257_1000256 3300025304 Bacteria 123057
176 Ga0207656_10002640 3300025321 Bacteria 6069
177 Ga0207656_10006106 3300025321 Bacteria 4312
178 Ga0207656_10008770 3300025321 Bacteria 3737
179 Ga0207710_10020438 3300025900 Bacteria 2830
180 Ga0207680_10002157 3300025903 Bacteria 9224
181 Ga0207680_10002879 3300025903 Bacteria 8062
182 Ga0207647_10014029 3300025904 Bacteria 5543
183 Ga0207647_10030891 3300025904 Bacteria 3452
184 Ga0207647_10033785 3300025904 Bacteria 3271
185 Ga0207647_10098879 3300025904 Bacteria 1733
186 Ga0207705_10014807 3300025909 Bacteria 5607
187 Ga0207654_10000275 3300025911 Bacteria 31294
188 Ga0207654_10001304 3300025911 Bacteria 13295
189 Ga0207654_10002847 3300025911 Bacteria 8771
190 Ga0207695_10002649 3300025913 Bacteria 26162
191 Ga0207695_10004197 3300025913 Bacteria 19798
192 Ga0207695_10007225 3300025913 Bacteria 14194
193 Ga0207695_10125712 3300025913 Bacteria 2527
194 Ga0207695_10134063 3300025913 Bacteria 2431
195 Ga0207671_10001110 3300025914 Bacteria 32453
196 Ga0207671_10001674 3300025914 Bacteria 25176
197 Ga0207671_10033664 3300025914 Bacteria 3811
198 Ga0207681_10000037 3300025923 Bacteria 154417
199 Ga0207681_10002329 3300025923 Bacteria 12089
200 Ga0207681_10002496 3300025923 Bacteria 11686
201 Ga0207694_10001514 3300025924 Bacteria 19795
202 Ga0207694_10009355 3300025924 Bacteria 7392
203 Ga0207694_10039181 3300025924 Bacteria 3646
204 Ga0207694_10105219 3300025924 Bacteria 2240
205 Ga0207650_10000940 3300025925 Bacteria 21951
206 Ga0207687_10000786 3300025927 Bacteria 21379
207 Ga0207644_10001658 3300025931 Bacteria 14331
208 Ga0207644_10045890 3300025931 Bacteria 3110
209 Ga0207690_10033854 3300025932 Bacteria 3288
210 Ga0207690_10055293 3300025932 Bacteria 2672
211 Ga0207706_10019588 3300025933 Bacteria 6087
212 Ga0207706_10050371 3300025933 Bacteria 3680
213 Ga0207711_10003346 3300025941 Bacteria 13893
214 Ga0207711_10023595 3300025941 Bacteria 5150
215 Ga0207711_10093036 3300025941 Bacteria 2655
216 Ga0207711_10316761 3300025941 Bacteria 1441
217 Ga0207661_10144098 3300025944 Bacteria 2053
218 Ga0207679_10093352 3300025945 Bacteria 2334
219 Ga0207679_10138732 3300025945 Bacteria 1962
220 Ga0207667_10006846 3300025949 Bacteria 13769
221 Ga0207667_10010314 3300025949 Bacteria 10930
222 Ga0207667_10014533 3300025949 Bacteria 8971
223 Ga0207667_10138438 3300025949 Bacteria 2506
224 Ga0207667_10167360 3300025949 Bacteria 2259
225 Ga0207712_10002258 3300025961 Bacteria 12514
226 Ga0207712_10010910 3300025961 Bacteria 5782
227 Ga0207668_10000079 3300025972 Bacteria 72795
228 Ga0207640_10001533 3300025981 Bacteria 12460
229 Ga0207640_10004434 3300025981 Bacteria 7616
230 Ga0207640_10008141 3300025981 Bacteria 5807
231 Ga0207640_10072138 3300025981 Bacteria 2328
232 Ga0207658_10000180 3300025986 Bacteria 67969
233 Ga0207658_10001382 3300025986 Bacteria 18946
234 Ga0207658_10002307 3300025986 Bacteria 14075
235 Ga0207658_10003598 3300025986 Bacteria 10951
236 Ga0207703_10000404 3300026035 Bacteria 46297
237 Ga0207703_10000435 3300026035 Bacteria 43900
238 Ga0207703_10001020 3300026035 Bacteria 26876
239 Ga0207703_10076345 3300026035 Bacteria 2779
240 Ga0207639_10013662 3300026041 Bacteria 5690
241 Ga0207639_10142061 3300026041 Bacteria 2001
242 Ga0207678_10016624 3300026067 Bacteria 6464
243 Ga0207678_10104900 3300026067 Bacteria 2412
244 Ga0207702_10011082 3300026078 Bacteria 7525
245 Ga0207702_10034087 3300026078 Bacteria 4254
246 Ga0207641_10000064 3300026088 Bacteria 156652
247 Ga0207641_10000161 3300026088 Bacteria 94555
248 Ga0207641_10000256 3300026088 Bacteria 67708
249 Ga0207641_10000759 3300026088 Bacteria 34711
250 Ga0207641_10006949 3300026088 Bacteria 9472
251 Ga0207676_10000603 3300026095 Bacteria 29490
252 Ga0207674_10001961 3300026116 Bacteria 26062
253 Ga0207674_10035823 3300026116 Bacteria 5177
254 Ga0207675_100000018 3300026118 Bacteria 124200
255 Ga0207698_10001302 3300026142 Bacteria 14538
256 Ga0207698_10002111 3300026142 Bacteria 11721
257 Ga0207698_10170382 3300026142 Bacteria 1916
258 Ga0207698_10183388 3300026142 Bacteria 1857
259 Ga0209813_10000068 3300027866 Bacteria 39853
260 Ga0268266_10001471 3300028379 Bacteria 27988
261 Ga0268266_10006764 3300028379 Bacteria 10453
262 Ga0268266_10012843 3300028379 Bacteria 7231
263 Ga0268265_10005642 3300028380 Bacteria 8552
264 Ga0268265_10017140 3300028380 Bacteria 4991
265 Ga0268265_10104579 3300028380 Unclassified 2295
266 Ga0268265_10152922 3300028380 Bacteria 1948
267 Ga0268264_10000139 3300028381 Bacteria 171848
268 Ga0268264_10005550 3300028381 Bacteria 10689
269 Ga0268264_10011694 3300028381 Bacteria 7238
270 Ga0307517_10005117 3300028786 Bacteria 19935
271 Ga0265339_10051232 3300031249 Bacteria 2254
272 Ga0307408_100016778 3300031548 Bacteria 4895
273 Ga0307405_10000177 3300031731 Bacteria 23450
274 Ga0307405_10050081 3300031731 Bacteria 2584
275 Ga0307405_10094573 3300031731 Bacteria 1988
276 Ga0307405_10157561 3300031731 Bacteria 1604
277 Ga0307406_10014149 3300031901 Bacteria 4584
278 Ga0307412_10000289 3300031911 Bacteria 31935
279 Ga0307412_10002894 3300031911 Bacteria 9512
280 Ga0307412_10003006 3300031911 Bacteria 9335
281 Ga0307416_100004236 3300032002 Bacteria 8611
282 Ga0316583_10047058 3300032133 Bacteria 1521
283 Ga0307510_10003966 3300033180 Bacteria 17345
284 Ga0316584_0181633 3300036712 Bacteria 1557
285 Ga0395900_0281696 3300037418 Bacteria 1654
286 Ga0395905_0245837 3300037471 Bacteria 1671
287 Ga0395905_0258691 3300037471 Bacteria 1625
288 Ga0436364_1487636 3300037853 Bacteria 30336
289 Ga0395901_0042579 3300038443 Bacteria 4708
290 Ga0395901_0240039 3300038443 Bacteria 1890
291 Ga0451853_4036402 3300041512 Bacteria 2261
292 Ga0439448_0015668 3300042005 Bacteria 2298
293 Ga0451576_0118659 3300045051 Bacteria 2754
294 Ga0495638_0000012 3300046460 Bacteria 435577
295 Ga0495606_0000672 3300046507 Bacteria 53500
296 Ga0495610_0000072 3300046512 Bacteria 120618
297 Ga0495610_0000134 3300046512 Bacteria 82325
298 Ga0495632_0001232 3300046519 Bacteria 21721
299 Ga0495643_0001030 3300046522 Bacteria 28407
300 Ga0495643_0005389 3300046522 Bacteria 8658
301 Ga0495648_0000038 3300046524 Bacteria 191612
302 Ga0495654_0003096 3300046530 Bacteria 10338
303 Ga0495625_0004319 3300046660 Bacteria 13500
304 Ga0495673_0012912 3300047469 Bacteria 4405
305 Ga0495681_0000523 3300047470 Bacteria 29297
306 Ga0495686_0013366 3300047472 Bacteria 5696
307 Ga0495686_0076366 3300047472 Bacteria 2053
308 Ga0496100_0010524 3300048903 Bacteria 5239
309 Ga0496101_0014080 3300048904 Bacteria 5372
310 Ga0496102_0000225 3300048905 Bacteria 74792
311 Ga0496102_0002284 3300048905 Bacteria 16382
312 Ga0496103_0000144 3300048906 Bacteria 74526
313 Ga0496103_0000845 3300048906 Bacteria 22406
314 Ga0496104_0020066 3300048907 Bacteria 6122
315 Ga0496104_0022382 3300048907 Bacteria 5805
316 Ga0496104_0030121 3300048907 Bacteria 5040
317 Ga0496105_0010595 3300048908 Bacteria 7253
318 Ga0496105_0015357 3300048908 Bacteria 6101
319 Ga0496105_0023080 3300048908 Bacteria 5044
320 Ga0496105_0039971 3300048908 Bacteria 3867
321 Ga0496105_0208727 3300048908 Bacteria 1592
322 Ga0496112_0129647 3300048915 Bacteria 2493
323 Ga0496112_0265534 3300048915 Bacteria 1665
324 Ga0496113_0008737 3300048916 Bacteria 6614
325 Ga0496116_0001278 3300048919 Bacteria 28950
326 Ga0496116_0008286 3300048919 Bacteria 9035
327 Ga0496116_0016409 3300048919 Bacteria 5795
328 Ga0496117_0000519 3300048920 Bacteria 63633
329 Ga0496117_0006966 3300048920 Bacteria 11207
330 Ga0496117_0036143 3300048920 Bacteria 3700
331 Ga0496117_0069489 3300048920 Bacteria 2371
332 Ga0496118_0000193 3300048921 Bacteria 107307
333 Ga0496118_0004990 3300048921 Bacteria 15338
334 Ga0496118_0012535 3300048921 Bacteria 8124
335 Ga0496118_0026026 3300048921 Bacteria 4996
336 Ga0496118_0053657 3300048921 Bacteria 3061
337 Ga0496119_0013660 3300048922 Bacteria 6444
338 Ga0496119_0022015 3300048922 Bacteria 4581
339 Ga0496120_0021228 3300048923 Bacteria 4107
340 Ga0496121_0016923 3300048924 Bacteria 7491
341 Ga0496121_0028777 3300048924 Bacteria 5163
342 Ga0496121_0030286 3300048924 Bacteria 4972
343 Ga0496122_0023252 3300048925 Bacteria 5472
344 Ga0496123_0011740 3300048926 Bacteria 7551
345 Ga0496124_0000188 3300048927 Bacteria 122361
346 Ga0496124_0000237 3300048927 Bacteria 107270
347 Ga0496124_0070802 3300048927 Bacteria 2892
348 Ga0496124_0156535 3300048927 Bacteria 1781
349 Ga0496125_0002975 3300048928 Bacteria 21293
350 Ga0496125_0025061 3300048928 Bacteria 5472
351 Ga0496125_0030896 3300048928 Bacteria 4782
352 Ga0496126_0002590 3300048929 Bacteria 24120
353 Ga0496126_0017721 3300048929 Bacteria 7093
354 Ga0501033_0027112 3300049570 Bacteria 4310
355 Ga0501033_0036742 3300049570 Bacteria 3669
356 Ga0501033_0205415 3300049570 Bacteria 1406
357 Ga0501034_0003601 3300049571 Bacteria 17582
358 Ga0501034_0042120 3300049571 Bacteria 4622
359 Ga0501034_0054813 3300049571 Bacteria 4013
360 Ga0501036_0239126 3300049572 Bacteria 1523
361 Ga0501037_0066790 3300049573 Bacteria 2619
362 Ga0501038_0096877 3300049574 Bacteria 2461
363 Ga0501043_0132911 3300049579 Bacteria 1950
364 Ga0501047_0099872 3300049581 Bacteria 2781
365 Ga0501225_0006373 3300049705 Bacteria 3447
366 Ga0501281_00060 3300049777 Bacteria 12822
367 Ga0501035_0026100 3300049822 Bacteria 5350
368 Ga0501035_0197841 3300049822 Bacteria 1725
369 Ga0501044_0085068 3300049823 Bacteria 3196
370 Ga0501044_0085665 3300049823 Bacteria 3184
371 nmdc:mga03683_215_c1 3300050489 Bacteria 18607
372 nmdc:mga03n38_1001_c1 3300050490 Bacteria 7726
373 nmdc:mga03n38_542_c1 3300050490 Bacteria 9595
374 nmdc:mga00v17_4531_c1 3300050491 Bacteria 7238
375 nmdc:mga00v17_586_c1 3300050491 Bacteria 20293
376 nmdc:mga0yw44_145053_c1 3300050492 Bacteria 1545
377 nmdc:mga0yw44_1494_c1 3300050492 Bacteria 9320
378 nmdc:mga0k408_9_c1 3300050493 Bacteria 82578
379 nmdc:mga06z11_165_c1 3300050494 Bacteria 25978
380 nmdc:mga04h51_15_c1 3300050495 Bacteria 76646
381 nmdc:mga07m45_18342_c1 3300050496 Bacteria 3775
382 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
383 nmdc:mga07m45_73428_c1 3300050496 Bacteria 1947
384 nmdc:mga07m45_74172_c1 3300050496 Bacteria 1938
385 nmdc:mga0sz30_1757_c2 3300050516 Bacteria 7340
386 nmdc:mga0sz30_301_c1 3300050516 Bacteria 18988
387 Ga0500635_0000365 3300053080 Bacteria 14348
388 Ga0500643_000620 3300053087 Bacteria 24035
389 Ga0500643_002703 3300053087 Bacteria 8911
390 Ga0500643_005878 3300053087 Bacteria 5211
391 Ga0500643_024676 3300053087 Bacteria 1905
392 Ga0500566_0000318 3300053094 Bacteria 25996
393 Ga0500592_000180 3300053116 Bacteria 12342
394 Ga0500594_0000378 3300053118 Bacteria 9947
395 Ga0500594_0000768 3300053118 Bacteria 6837
396 Ga0500595_011327 3300053119 Bacteria 3498
397 Ga0500607_000254 3300053121 Bacteria 50052
398 Ga0500607_000740 3300053121 Bacteria 31473
399 Ga0500607_001956 3300053121 Bacteria 17551
400 Ga0500608_000131 3300053122 Bacteria 30612
401 Ga0500608_000457 3300053122 Bacteria 15317
402 Ga0500608_002180 3300053122 Bacteria 7045
403 Ga0500614_002741 3300053123 Bacteria 3884
404 Ga0500642_0004357 3300053130 Bacteria 4422
405 Ga0500559_0000590 3300053136 Bacteria 24734
406 Ga0500590_000002 3300053148 Bacteria 124521
407 Ga0500590_000024 3300053148 Bacteria 39250
408 Ga0500590_000568 3300053148 Bacteria 12987
409 Ga0500590_004448 3300053148 Bacteria 6618
410 Ga0500590_018990 3300053148 Bacteria 3562
411 Ga0500616_0002041 3300053153 Bacteria 17777
412 Ga0500616_0004725 3300053153 Bacteria 9587
413 Ga0500622_0002120 3300053156 Bacteria 14766
414 Ga0500622_0047782 3300053156 Bacteria 2209
415 Ga0500627_0000116 3300053158 Bacteria 25428
416 Ga0500639_011338 3300053163 Bacteria 4677
417 Ga0500570_005818 3300053724 Bacteria 6639
418 Ga0500625_000021 3300053729 Bacteria 83503
419 Ga0500645_000047 3300053730 Bacteria 106093
420 Ga0500645_023893 3300053730 Bacteria 1872
421 2643823134 2643221560 Bacteria 4801179
422 2738709820 2738541275 Bacteria 4830863
423 2738848245 2738541301 Bacteria 4834102
424 2738863974 2738541304 Bacteria 4833665
425 2739296492 2738543022 Bacteria 4835059
426 2739358170 2738543033 Bacteria 4833336
427 2739790045 2739367756 Bacteria 4553612
428 2739791916 2739367756 Bacteria 4553612
429 2895886196 2895880812 Bacteria 11255272
430 2896431325 2896429255 Bacteria 2557483
431 2919139569 2919138771 Bacteria 5281312
432 Ga0157372_10024674
433 JGI24736J21556_1002515
434 JGI24741J21665_1009633
435 JGI24752J21851_1000488
436 JGI24740J21852_10002692
437 JGI24740J21852_10003184
438 JGI24740J21852_10028759
439 JGI24739J22299_10016653
440 JGI24739J22299_10016989
441 JGI24737J22298_10000317
442 JGI24737J22298_10017610
443 JGI24735J21928_10001472
444 JGI24735J21928_10004226
445 JGI24748J21848_1000718
446 JGI24738J21930_10000773
447 JGI24034J26672_10002407
448 JGI24751J29686_10000131
449 rootL2_10234077
450 Ga0055529_1000045
451 Ga0055536_1000377
452 Ga0055536_1000758
453 Ga0055531_10000292
454 Ga0065707_10081738
455 Ga0065707_10081989
456 Ga0065707_10084047
457 Ga0070683_100172532
458 Ga0070670_100001497
459 Ga0070666_10004937
460 Ga0070666_10046107
461 Ga0070680_100032382
462 Ga0070660_100088097
463 Ga0070668_100000081
464 Ga0070669_100000192
465 Ga0070669_100000776
466 Ga0070669_100002663
467 Ga0070671_100001129
468 Ga0070671_100013869
469 Ga0070659_100038769
470 Ga0070659_100066504
471 Ga0070659_100112910
472 Ga0070667_100000211
473 Ga0070667_100000926
474 Ga0070667_100001140
475 Ga0070667_100010295
476 Ga0070663_100007255
477 Ga0070663_100067566
478 Ga0070678_100000094
479 Ga0070662_100035713
480 Ga0070662_100037288
481 Ga0070662_100066976
482 Ga0070662_100192599
483 Ga0068853_100040373
484 Ga0068853_100080353
485 Ga0070665_100004936
486 Ga0070665_100015137
487 Ga0068855_100007101
488 Ga0068855_100071478
489 Ga0068855_100094214
490 Ga0068855_100112410
491 Ga0068855_100130672
492 Ga0068855_100187173
493 Ga0068855_100338229
494 Ga0070664_100007340
495 Ga0068857_100014866
496 Ga0068857_100085521
497 Ga0068857_100104293
498 Ga0068854_100010602
499 Ga0068854_100013589
500 Ga0068854_100020121
501 Ga0068854_100072356
502 Ga0068854_100164260
503 Ga0068854_100190587
504 Ga0068856_100145423
505 Ga0068856_100225946
506 Ga0068852_100012859
507 Ga0068852_100038163
508 Ga0068864_100000642
509 Ga0068864_100340421
510 Ga0068861_100000201
511 Ga0068851_10007335
512 Ga0068851_10007799
513 Ga0068851_10035267
514 Ga0068863_100000005
515 Ga0068863_100000113
516 Ga0068863_100000178
517 Ga0068863_100000515
518 Ga0068863_100012337
519 Ga0068863_100029739
520 Ga0068858_100000304
521 Ga0068858_100000575
522 Ga0068858_100001411
523 Ga0068858_100090199
524 Ga0068860_100000076
525 Ga0068860_100002857
526 Ga0068860_100011503
527 Ga0068862_100026255
528 Ga0068862_100027758
529 Ga0068862_100104434
530 Ga0068862_100165863
531 Ga0068862_100294539
532 Ga0075365_10001441
533 Ga0075368_10000260
534 Ga0075363_100000420
535 Ga0075363_100001211
536 Ga0075364_10000603
537 Ga0075364_10003051
538 Ga0075432_10001227
539 Ga0075367_10000037
540 Ga0075369_10000171
541 Ga0075369_10002760
542 Ga0075366_10000075
543 Ga0075366_10049429
544 Ga0097621_100149437
545 Ga0075370_10018861
546 Ga0075370_10076057
547 Ga0105240_10014198
548 Ga0105240_10057904
549 Ga0105240_10079232
550 Ga0105240_10196701
551 Ga0105245_10017780
552 Ga0105247_10005028
553 Ga0105243_10154990
554 Ga0105241_10001518
555 Ga0105241_10010487
556 Ga0105241_10029882
557 Ga0105248_10001699
558 Ga0105248_10011310
559 Ga0105248_10014579
560 Ga0105248_10218793
561 Ga0105248_10358438
562 Ga0105237_10058224
563 Ga0105237_10072022
564 Ga0105237_10099724
565 Ga0105238_10022102
566 Ga0105238_10053878
567 Ga0105238_10060651
568 Ga0105249_10001726
569 Ga0105239_10028039
570 Ga0105239_10069570
571 Ga0105239_10235530
572 Ga0105246_10007335
573 Ga0157373_10075121
574 Ga0157371_10000011
575 Ga0157371_10001436
576 Ga0157371_10096010
577 Ga0157370_10001878
578 Ga0157370_10077570
579 Ga0157370_10081186
580 Ga0157369_10003126
581 Ga0157369_10004722
582 Ga0157369_10004757
583 Ga0157369_10031001
584 Ga0157369_10273255
585 Ga0157369_10291895
586 Ga0157378_10004604
587 Ga0157378_10062347
588 Ga0163162_10030331
589 Ga0163162_10143267
590 Ga0157372_10003423
591 Ga0157372_10013848
592 Ga0157375_10266435
593 Ga0163163_10066853
594 Ga0157380_10000063
595 Ga0157380_10017674
596 Ga0157380_10053545
597 Ga0157379_10001908
598 Ga0163161_10140540
599 Ga0213875_10000415
600 Ga0209147_100740
601 Ga0209148_1000011
602 Ga0209455_1000006
603 Ga0209676_1000113
604 Ga0209676_1007809
605 Ga0209050_1000126
606 Ga0209257_1000256
607 Ga0207656_10002640
608 Ga0207656_10006106
609 Ga0207656_10008770
610 Ga0207710_10020438
611 Ga0207680_10002157
612 Ga0207680_10002879
613 Ga0207647_10014029
614 Ga0207647_10030891
615 Ga0207647_10033785
616 Ga0207647_10098879
617 Ga0207705_10014807
618 Ga0207654_10000275
619 Ga0207654_10001304
620 Ga0207654_10002847
621 Ga0207695_10002649
622 Ga0207695_10004197
623 Ga0207695_10007225
624 Ga0207695_10125712
625 Ga0207695_10134063
626 Ga0207671_10001110
627 Ga0207671_10001674
628 Ga0207671_10033664
629 Ga0207681_10000037
630 Ga0207681_10002329
631 Ga0207681_10002496
632 Ga0207694_10001514
633 Ga0207694_10009355
634 Ga0207694_10039181
635 Ga0207694_10105219
636 Ga0207650_10000940
637 Ga0207687_10000786
638 Ga0207644_10001658
639 Ga0207644_10045890
640 Ga0207690_10033854
641 Ga0207690_10055293
642 Ga0207706_10019588
643 Ga0207706_10050371
644 Ga0207711_10003346
645 Ga0207711_10023595
646 Ga0207711_10093036
647 Ga0207711_10316761
648 Ga0207661_10144098
649 Ga0207679_10093352
650 Ga0207679_10138732
651 Ga0207667_10006846
652 Ga0207667_10010314
653 Ga0207667_10014533
654 Ga0207667_10138438
655 Ga0207667_10167360
656 Ga0207712_10002258
657 Ga0207712_10010910
658 Ga0207668_10000079
659 Ga0207640_10001533
660 Ga0207640_10004434
661 Ga0207640_10008141
662 Ga0207640_10072138
663 Ga0207658_10000180
664 Ga0207658_10001382
665 Ga0207658_10002307
666 Ga0207658_10003598
667 Ga0207703_10000404
668 Ga0207703_10000435
669 Ga0207703_10001020
670 Ga0207703_10076345
671 Ga0207639_10013662
672 Ga0207639_10142061
673 Ga0207678_10016624
674 Ga0207678_10104900
675 Ga0207702_10011082
676 Ga0207702_10034087
677 Ga0207641_10000064
678 Ga0207641_10000161
679 Ga0207641_10000256
680 Ga0207641_10000759
681 Ga0207641_10006949
682 Ga0207676_10000603
683 Ga0207674_10001961
684 Ga0207674_10035823
685 Ga0207675_100000018
686 Ga0207698_10001302
687 Ga0207698_10002111
688 Ga0207698_10170382
689 Ga0207698_10183388
690 Ga0209813_10000068
691 Ga0268266_10001471
692 Ga0268266_10006764
693 Ga0268266_10012843
694 Ga0268265_10005642
695 Ga0268265_10017140
696 Ga0268265_10104579
697 Ga0268265_10152922
698 Ga0268264_10000139
699 Ga0268264_10005550
700 Ga0268264_10011694
701 Ga0307517_10005117
702 Ga0265339_10051232
703 Ga0307408_100016778
704 Ga0307405_10000177
705 Ga0307405_10050081
706 Ga0307405_10094573
707 Ga0307405_10157561
708 Ga0307406_10014149
709 Ga0307412_10000289
710 Ga0307412_10002894
711 Ga0307412_10003006
712 Ga0307416_100004236
713 Ga0316583_10047058
714 Ga0307510_10003966
715 Ga0316584_0181633
716 Ga0395900_0281696
717 Ga0395905_0245837
718 Ga0395905_0258691
719 Ga0436364_1487636
720 Ga0395901_0042579
721 Ga0395901_0240039
722 Ga0451853_4036402
723 Ga0439448_0015668
724 Ga0451576_0118659
725 Ga0495638_0000012
726 Ga0495606_0000672
727 Ga0495610_0000072
728 Ga0495610_0000134
729 Ga0495632_0001232
730 Ga0495643_0001030
731 Ga0495643_0005389
732 Ga0495648_0000038
733 Ga0495654_0003096
734 Ga0495625_0004319
735 Ga0495673_0012912
736 Ga0495681_0000523
737 Ga0495686_0013366
738 Ga0495686_0076366
739 Ga0496100_0010524
740 Ga0496101_0014080
741 Ga0496102_0000225
742 Ga0496102_0002284
743 Ga0496103_0000144
744 Ga0496103_0000845
745 Ga0496104_0020066
746 Ga0496104_0022382
747 Ga0496104_0030121
748 Ga0496105_0010595
749 Ga0496105_0015357
750 Ga0496105_0023080
751 Ga0496105_0039971
752 Ga0496105_0208727
753 Ga0496112_0129647
754 Ga0496112_0265534
755 Ga0496113_0008737
756 Ga0496116_0001278
757 Ga0496116_0008286
758 Ga0496116_0016409
759 Ga0496117_0000519
760 Ga0496117_0006966
761 Ga0496117_0036143
762 Ga0496117_0069489
763 Ga0496118_0000193
764 Ga0496118_0004990
765 Ga0496118_0012535
766 Ga0496118_0026026
767 Ga0496118_0053657
768 Ga0496119_0013660
769 Ga0496119_0022015
770 Ga0496120_0021228
771 Ga0496121_0016923
772 Ga0496121_0028777
773 Ga0496121_0030286
774 Ga0496122_0023252
775 Ga0496123_0011740
776 Ga0496124_0000188
777 Ga0496124_0000237
778 Ga0496124_0070802
779 Ga0496124_0156535
780 Ga0496125_0002975
781 Ga0496125_0025061
782 Ga0496125_0030896
783 Ga0496126_0002590
784 Ga0496126_0017721
785 Ga0501033_0027112
786 Ga0501033_0036742
787 Ga0501033_0205415
788 Ga0501034_0003601
789 Ga0501034_0042120
790 Ga0501034_0054813
791 Ga0501036_0239126
792 Ga0501037_0066790
793 Ga0501038_0096877
794 Ga0501043_0132911
795 Ga0501047_0099872
796 Ga0501225_0006373
797 Ga0501281_00060
798 Ga0501035_0026100
799 Ga0501035_0197841
800 Ga0501044_0085068
801 Ga0501044_0085665
802 nmdc:mga03683_215_c1
803 nmdc:mga03n38_1001_c1
804 nmdc:mga03n38_542_c1
805 nmdc:mga00v17_4531_c1
806 nmdc:mga00v17_586_c1
807 nmdc:mga0yw44_145053_c1
808 nmdc:mga0yw44_1494_c1
809 nmdc:mga0k408_9_c1
810 nmdc:mga06z11_165_c1
811 nmdc:mga04h51_15_c1
812 nmdc:mga07m45_18342_c1
813 nmdc:mga07m45_5_c2
814 nmdc:mga07m45_73428_c1
815 nmdc:mga07m45_74172_c1
816 nmdc:mga0sz30_1757_c2
817 nmdc:mga0sz30_301_c1
818 Ga0500635_0000365
819 Ga0500643_000620
820 Ga0500643_002703
821 Ga0500643_005878
822 Ga0500643_024676
823 Ga0500566_0000318
824 Ga0500592_000180
825 Ga0500594_0000378
826 Ga0500594_0000768
827 Ga0500595_011327
828 Ga0500607_000254
829 Ga0500607_000740
830 Ga0500607_001956
831 Ga0500608_000131
832 Ga0500608_000457
833 Ga0500608_002180
834 Ga0500614_002741
835 Ga0500642_0004357
836 Ga0500559_0000590
837 Ga0500590_000002
838 Ga0500590_000024
839 Ga0500590_000568
840 Ga0500590_004448
841 Ga0500590_018990
842 Ga0500616_0002041
843 Ga0500616_0004725
844 Ga0500622_0002120
845 Ga0500622_0047782
846 Ga0500627_0000116
847 Ga0500639_011338
848 Ga0500570_005818
849 Ga0500625_000021
850 Ga0500645_000047
851 Ga0500645_023893
852 2643823134
853 2738709820
854 2738848245
855 2738863974
856 2739296492
857 2739358170
858 2739790045
859 2739791916
860 2895886196
861 2896431325
862 2919139569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22022

Phage_int_M

Phage integrase central domain

164

259

0.96

PF00589

Phage_integrase

Phage integrase family

271

438

0.89

PF13356

Arm-DNA-bind_3

Arm DNA-binding domain

58

152

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtz-assembly1.cif.gz_A structure of the arm-type binding domain of hpi integrase 0.9785 1 75
3ju0-assembly1.cif.gz_A structure of the arm-type binding domain of hai7 integrase 0.9784 1 82
3rmp-assembly1.cif.gz_C structural basis for the recognition of attp substrates by p4-like integrases 0.9728 1 75
3jtz-assembly1.cif.gz_A structure of the arm-type binding domain of hpi integrase 0.9416 1 75
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.9363 95 190
ID Description Score Start End Superfamily
af_P32053_7_95_3.30.160.390 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9933 1 85 3.30.160.390
3ju0A00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9784 1 82 3.30.160.390
3rmpC00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9728 1 75 3.30.160.390
af_P37326_1_84_3.30.160.390 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9663 1 83 3.30.160.390
af_P39347_1_63_3.30.160.390 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Integrase, DNA-binding domain 0.9627 27 85 3.30.160.390
ID Description Score Start End GO Terms
AF-A0A2N2SR13-F1-model_v4 Integrase 1.008 2 64 GO:0015074
AF-A0A7H4NRX7-F1-model_v4 deleted 1.002 2 72
AF-A0A379X1R9-F1-model_v4 Integrase 1.002 2 72 GO:0015074
AF-A0A847ZYY6-F1-model_v4 DUF4102 domain-containing protein 1.001 2 70 GO:0015074
AF-A0A521PZA9-F1-model_v4 DUF4102 domain-containing protein 0.9989 2 68 GO:0015074

Map