F442401

General Info

Members Datasets Scaffolds Average Seq Length
431 225 428 214

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100229032|Ga0307416_1002290322
Length 242
Sequence MSAFDPLQTLAECPLSTHCGHRHARYSYSVDHAPNYWTDGYAKVEALIPPEICAAFLERLKVDLGPRPVNLSGVTQFPNLLARPAFEVYGQHYIPMAFFLWGLTPTVSRLLGRDLLPTYDYLRIYREGDVCRVHSDRYSCEHSLSLTLGYSDGRSWDLQVEPDRTDPSAKVDESFPAKFASVTMKPGDGVLYQGVHHRHGRTEPNPNRWSAHLFLHWVDRNGPYRKHAFDGQIPAAVDFQFA

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
4 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
5 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
178 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
179 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
180 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
181 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
213 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.23
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0
Rhizoplane 4.87
Rhizosphere 84.45
Stem 0
Stem Tuber 0
Unclassified 4.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8435877 2162886011 Unclassified 1359
2 MBSR1b_contig_6576037 2162886012 Bacteria 812
3 MBSR1b_contig_8719363 2162886012 Bacteria 2074
4 JGI24741J21665_1005640 3300001915 Bacteria 2595
5 JGI24752J21851_1001317 3300001976 Bacteria 3348
6 JGI24739J22299_10019008 3300001989 Bacteria 2464
7 JGI24737J22298_10071059 3300001990 Bacteria 1039
8 JGI24735J21928_10030476 3300002067 Bacteria 1602
9 JGI25150J39212_1000514 3300002774 Bacteria 15973
10 JGI25165J46597_1000032 3300003214 Bacteria 294371
11 JGI25153J46596_10000181 3300003215 Bacteria 62061
12 rootH1_10029462 3300003323 Bacteria 1451
13 Ga0055530_10031779 3300003791 Bacteria 1382
14 Ga0055531_10039760 3300003794 Bacteria 1390
15 Ga0065165_1026468 3300005262 Bacteria 1907
16 Ga0065712_10077101 3300005290 Bacteria 3550
17 Ga0065712_10261035 3300005290 Unclassified 937
18 Ga0065715_10110282 3300005293 Bacteria 2628
19 Ga0065715_10473104 3300005293 Bacteria 804
20 Ga0070658_10000037 3300005327 Bacteria 141493
21 Ga0070658_10018660 3300005327 Bacteria 5556
22 Ga0070676_10080867 3300005328 Bacteria 1971
23 Ga0070683_100085586 3300005329 Bacteria 2955
24 Ga0070670_100001791 3300005331 Bacteria 17491
25 Ga0070670_100006019 3300005331 Bacteria 10255
26 Ga0070670_100020530 3300005331 Bacteria 5680
27 Ga0070670_100032937 3300005331 Bacteria 4465
28 Ga0070670_100108499 3300005331 Bacteria 2392
29 Ga0070670_100472631 3300005331 Bacteria 1113
30 Ga0070677_10001101 3300005333 Bacteria 8676
31 Ga0068869_100119107 3300005334 Unclassified 2017
32 Ga0070666_10003370 3300005335 Bacteria 9689
33 Ga0070680_100000705 3300005336 Bacteria 23175
34 Ga0070680_100167405 3300005336 Bacteria 1848
35 Ga0070680_100200486 3300005336 Bacteria 1683
36 Ga0070682_100147205 3300005337 Bacteria 1612
37 Ga0070660_100000617 3300005339 Bacteria 23758
38 Ga0070660_100005195 3300005339 Bacteria 8999
39 Ga0070660_100027153 3300005339 Bacteria 4270
40 Ga0070660_100057187 3300005339 Bacteria 3020
41 Ga0070660_100113321 3300005339 Bacteria 2159
42 Ga0070689_100204605 3300005340 Bacteria 1613
43 Ga0070661_100000065 3300005344 Bacteria 84689
44 Ga0070661_100023413 3300005344 Bacteria 4426
45 Ga0070661_100098256 3300005344 Bacteria 2175
46 Ga0070661_100402966 3300005344 Bacteria 1082
47 Ga0070692_10005931 3300005345 Bacteria 5262
48 Ga0070668_100027522 3300005347 Bacteria 4317
49 Ga0070668_100053741 3300005347 Bacteria 3106
50 Ga0070668_100087679 3300005347 Bacteria 2449
51 Ga0070668_100271099 3300005347 Unclassified 1414
52 Ga0070668_100272657 3300005347 Bacteria 1411
53 Ga0070669_100019163 3300005353 Bacteria 4889
54 Ga0070669_100061027 3300005353 Unclassified 2770
55 Ga0070669_100087713 3300005353 Bacteria 2327
56 Ga0070669_100152268 3300005353 Unclassified 1791
57 Ga0070675_100006727 3300005354 Bacteria 8838
58 Ga0070675_100008582 3300005354 Bacteria 7933
59 Ga0070671_100000987 3300005355 Bacteria 20885
60 Ga0070671_100008457 3300005355 Bacteria 8247
61 Ga0070671_100030728 3300005355 Bacteria 4433
62 Ga0070674_100016909 3300005356 Bacteria 4577
63 Ga0070674_100043628 3300005356 Bacteria 3052
64 Ga0070673_100007096 3300005364 Bacteria 7358
65 Ga0070673_100019095 3300005364 Bacteria 4917
66 Ga0070673_100081069 3300005364 Bacteria 2631
67 Ga0070659_100029895 3300005366 Bacteria 4212
68 Ga0070659_100039352 3300005366 Bacteria 3691
69 Ga0070667_100001302 3300005367 Bacteria 22531
70 Ga0070667_100003430 3300005367 Bacteria 13502
71 Ga0070667_100064941 3300005367 Bacteria 3098
72 Ga0070667_100207320 3300005367 Bacteria 1741
73 Ga0070667_100241200 3300005367 Bacteria 1614
74 Ga0070714_100039665 3300005435 Bacteria 3965
75 Ga0070713_100087774 3300005436 Bacteria 2668
76 Ga0070694_100023727 3300005444 Bacteria 3950
77 Ga0070663_100362150 3300005455 Bacteria 1177
78 Ga0070678_100017249 3300005456 Bacteria 4643
79 Ga0070662_100001154 3300005457 Bacteria 16204
80 Ga0070662_100006786 3300005457 Bacteria 7401
81 Ga0070662_100024858 3300005457 Bacteria 4131
82 Ga0070662_100029536 3300005457 Bacteria 3827
83 Ga0070662_100276116 3300005457 Bacteria 1358
84 Ga0070662_100319028 3300005457 Bacteria 1267
85 Ga0070681_10166137 3300005458 Bacteria 2129
86 Ga0068867_100087753 3300005459 Bacteria 2356
87 Ga0070679_100000002 3300005530 Bacteria 312066
88 Ga0070679_100080804 3300005530 Bacteria 3240
89 Ga0070679_100131924 3300005530 Bacteria 2479
90 Ga0070684_100618323 3300005535 Bacteria 1008
91 Ga0068853_100031749 3300005539 Bacteria 4468
92 Ga0068853_100171542 3300005539 Bacteria 1963
93 Ga0070672_100049310 3300005543 Bacteria 3275
94 Ga0070672_100591975 3300005543 Bacteria 965
95 Ga0070665_100000054 3300005548 Bacteria 244426
96 Ga0070665_100000086 3300005548 Bacteria 178229
97 Ga0070665_100068153 3300005548 Bacteria 3567
98 Ga0070665_100106217 3300005548 Bacteria 2810
99 Ga0070665_100969027 3300005548 Bacteria 863
100 Ga0068855_100321666 3300005563 Bacteria 1710
101 Ga0068855_100788934 3300005563 Bacteria 1010
102 Ga0070664_100002681 3300005564 Bacteria 14366
103 Ga0070664_100008629 3300005564 Bacteria 8248
104 Ga0070664_100097042 3300005564 Bacteria 2558
105 Ga0070664_100203499 3300005564 Bacteria 1767
106 Ga0068857_100045328 3300005577 Bacteria 3901
107 Ga0068857_100213449 3300005577 Bacteria 1761
108 Ga0068857_100421318 3300005577 Bacteria 1245
109 Ga0068854_100257873 3300005578 Unclassified 1395
110 Ga0068854_100320333 3300005578 Bacteria 1260
111 Ga0068854_100639244 3300005578 Bacteria 912
112 Ga0068856_100858831 3300005614 Bacteria 927
113 Ga0068852_100016642 3300005616 Bacteria 5744
114 Ga0068852_100267531 3300005616 Bacteria 1644
115 Ga0068852_100399717 3300005616 Bacteria 1351
116 Ga0068859_100001097 3300005617 Bacteria 27611
117 Ga0068864_100000502 3300005618 Bacteria 33698
118 Ga0068864_100007061 3300005618 Bacteria 9219
119 Ga0068864_100023202 3300005618 Bacteria 5208
120 Ga0068851_10100741 3300005834 Bacteria 1533
121 Ga0068851_10198672 3300005834 Unclassified 1118
122 Ga0068863_100000592 3300005841 Bacteria 36831
123 Ga0068863_100118508 3300005841 Bacteria 2523
124 Ga0068858_100001226 3300005842 Bacteria 26511
125 Ga0068858_100004267 3300005842 Bacteria 14055
126 Ga0068860_100001440 3300005843 Bacteria 25753
127 Ga0068860_100378793 3300005843 Unclassified 1396
128 Ga0068862_100002492 3300005844 Bacteria 16289
129 Ga0068862_100156066 3300005844 Bacteria 2034
130 Ga0068862_100266600 3300005844 Bacteria 1565
131 Ga0097621_100012082 3300006237 Bacteria 6390
132 Ga0097621_100133287 3300006237 Bacteria 2117
133 Ga0068871_100004623 3300006358 Bacteria 9610
134 Ga0068871_100772168 3300006358 Bacteria 884
135 Ga0075428_100661538 3300006844 Unclassified 1114
136 Ga0075430_100620859 3300006846 Bacteria 892
137 Ga0075434_100079173 3300006871 Bacteria 3283
138 Ga0097620_100001097 3300006931 Bacteria 27611
139 Ga0105250_10022278 3300009092 Unclassified 2555
140 Ga0105240_10790821 3300009093 Bacteria 1028
141 Ga0111539_10060517 3300009094 Bacteria 4488
142 Ga0105247_10119082 3300009101 Unclassified 1709
143 Ga0114129_10082112 3300009147 Bacteria 4479
144 Ga0105242_10096201 3300009176 Bacteria 2501
145 Ga0105248_10004576 3300009177 Bacteria 15314
146 Ga0105248_10013222 3300009177 Bacteria 9085
147 Ga0105248_10021837 3300009177 Bacteria 7092
148 Ga0105237_10019710 3300009545 Bacteria 6963
149 Ga0105237_10849158 3300009545 Bacteria 920
150 Ga0105238_10064257 3300009551 Bacteria 3670
151 Ga0105238_10318891 3300009551 Bacteria 1540
152 Ga0105238_10518521 3300009551 Bacteria 1194
153 Ga0105249_10547483 3300009553 Bacteria 1207
154 Ga0157373_10034355 3300013100 Bacteria 3642
155 Ga0157373_10239064 3300013100 Bacteria 1284
156 Ga0157371_10102726 3300013102 Bacteria 2028
157 Ga0157371_10206985 3300013102 Bacteria 1407
158 Ga0157371_10432331 3300013102 Unclassified 966
159 Ga0157370_10174991 3300013104 Bacteria 1995
160 Ga0157369_10554969 3300013105 Bacteria 1187
161 Ga0157369_10567168 3300013105 Bacteria 1173
162 Ga0157374_10001212 3300013296 Bacteria 22054
163 Ga0157374_10186775 3300013296 Bacteria 2026
164 Ga0157378_10052474 3300013297 Bacteria 3628
165 Ga0163162_10103196 3300013306 Bacteria 2945
166 Ga0163162_10337554 3300013306 Unclassified 1639
167 Ga0157372_10374295 3300013307 Bacteria 1660
168 Ga0157372_10396728 3300013307 Bacteria 1608
169 Ga0157372_10579900 3300013307 Bacteria 1307
170 Ga0157375_10011909 3300013308 Bacteria 7695
171 Ga0157375_10187621 3300013308 Bacteria 2221
172 Ga0157375_10463942 3300013308 Bacteria 1432
173 Ga0157375_10746268 3300013308 Bacteria 1130
174 Ga0163163_10002967 3300014325 Bacteria 14354
175 Ga0163163_10006238 3300014325 Bacteria 10402
176 Ga0163163_10372507 3300014325 Unclassified 1485
177 Ga0157380_10001794 3300014326 Bacteria 14166
178 Ga0157379_10007300 3300014968 Bacteria 9567
179 Ga0163161_10025185 3300017792 Bacteria 4210
180 Ga0163161_10465158 3300017792 Bacteria 1024
181 Ga0206356_11476484 3300020070 Bacteria 4045
182 Ga0213873_10000010 3300021358 Bacteria 223024
183 Ga0213876_10000027 3300021384 Bacteria 223024
184 Ga0213876_10012361 3300021384 Bacteria 4544
185 Ga0213876_10036128 3300021384 Bacteria 2606
186 Ga0213876_10036729 3300021384 Bacteria 2584
187 Ga0209437_106131 3300025233 Bacteria 2014
188 Ga0207425_1000019 3300025245 Bacteria 399942
189 Ga0209129_1002152 3300025258 Bacteria 9975
190 Ga0209233_1000066 3300025261 Bacteria 381218
191 Ga0209565_1049772 3300025263 Unclassified 756
192 Ga0209676_1008137 3300025292 Bacteria 4747
193 Ga0209025_1000472 3300025294 Bacteria 78081
194 Ga0209758_1000019 3300025297 Bacteria 743682
195 Ga0209050_1014929 3300025298 Bacteria 3303
196 Ga0209257_1003900 3300025304 Bacteria 12155
197 Ga0207697_10042290 3300025315 Bacteria 1872
198 Ga0207656_10091982 3300025321 Bacteria 1378
199 Ga0207696_1023114 3300025711 Unclassified 1965
200 Ga0207682_10002291 3300025893 Bacteria 8623
201 Ga0207680_10029536 3300025903 Bacteria 3081
202 Ga0207647_10045730 3300025904 Bacteria 2730
203 Ga0207645_10196585 3300025907 Bacteria 1326
204 Ga0207705_10000008 3300025909 Bacteria 589717
205 Ga0207705_10008958 3300025909 Bacteria 7288
206 Ga0207705_10010899 3300025909 Bacteria 6600
207 Ga0207705_10013063 3300025909 Bacteria 5992
208 Ga0207705_10093185 3300025909 Bacteria 2208
209 Ga0207705_10107739 3300025909 Bacteria 2056
210 Ga0207695_10571297 3300025913 Bacteria 1012
211 Ga0207671_10006798 3300025914 Bacteria 10107
212 Ga0207660_10001171 3300025917 Bacteria 17537
213 Ga0207660_10047301 3300025917 Bacteria 3041
214 Ga0207660_10506933 3300025917 Bacteria 979
215 Ga0207657_10000867 3300025919 Bacteria 31897
216 Ga0207657_10012237 3300025919 Bacteria 8476
217 Ga0207657_10023650 3300025919 Bacteria 5715
218 Ga0207657_10023793 3300025919 Bacteria 5694
219 Ga0207657_10065279 3300025919 Bacteria 3103
220 Ga0207657_10185551 3300025919 Bacteria 1680
221 Ga0207657_10185562 3300025919 Bacteria 1680
222 Ga0207649_10000223 3300025920 Bacteria 46101
223 Ga0207649_10025822 3300025920 Bacteria 3430
224 Ga0207649_10117392 3300025920 Bacteria 1788
225 Ga0207652_10000001 3300025921 Bacteria 1006643
226 Ga0207652_10000002 3300025921 Bacteria 878035
227 Ga0207652_10016264 3300025921 Bacteria 6071
228 Ga0207652_10050930 3300025921 Bacteria 3549
229 Ga0207652_10187789 3300025921 Bacteria 1858
230 Ga0207681_10039815 3300025923 Unclassified 3123
231 Ga0207681_10183641 3300025923 Bacteria 1595
232 Ga0207681_10192728 3300025923 Bacteria 1560
233 Ga0207694_10157390 3300025924 Bacteria 1833
234 Ga0207694_10452164 3300025924 Bacteria 1072
235 Ga0207650_10002895 3300025925 Bacteria 11846
236 Ga0207650_10011705 3300025925 Bacteria 6044
237 Ga0207650_10142063 3300025925 Bacteria 1888
238 Ga0207650_10271165 3300025925 Bacteria 1379
239 Ga0207659_10001607 3300025926 Bacteria 13404
240 Ga0207659_10005281 3300025926 Bacteria 7829
241 Ga0207659_10130777 3300025926 Bacteria 1937
242 Ga0207687_10033996 3300025927 Bacteria 3460
243 Ga0207700_10117762 3300025928 Bacteria 2148
244 Ga0207664_10026093 3300025929 Bacteria 4411
245 Ga0207644_10005240 3300025931 Bacteria 8461
246 Ga0207644_10054097 3300025931 Bacteria 2890
247 Ga0207644_10057399 3300025931 Bacteria 2810
248 Ga0207690_10155294 3300025932 Bacteria 1700
249 Ga0207706_10001368 3300025933 Bacteria 24401
250 Ga0207706_10011377 3300025933 Bacteria 8109
251 Ga0207706_10012270 3300025933 Bacteria 7808
252 Ga0207706_10012864 3300025933 Bacteria 7616
253 Ga0207706_10037239 3300025933 Bacteria 4320
254 Ga0207706_10347808 3300025933 Bacteria 1289
255 Ga0207706_10402507 3300025933 Bacteria 1187
256 Ga0207669_10035371 3300025937 Bacteria 2841
257 Ga0207669_10181613 3300025937 Bacteria 1509
258 Ga0207691_10000916 3300025940 Bacteria 29221
259 Ga0207711_10000848 3300025941 Bacteria 29550
260 Ga0207711_10004471 3300025941 Bacteria 11919
261 Ga0207711_10014730 3300025941 Bacteria 6497
262 Ga0207689_10159286 3300025942 Unclassified 1860
263 Ga0207679_10012000 3300025945 Bacteria 5632
264 Ga0207679_10124720 3300025945 Bacteria 2056
265 Ga0207679_10256095 3300025945 Unclassified 1490
266 Ga0207667_10757152 3300025949 Bacteria 970
267 Ga0207667_10764352 3300025949 Unclassified 965
268 Ga0207651_10005034 3300025960 Bacteria 6737
269 Ga0207651_10018647 3300025960 Bacteria 4136
270 Ga0207651_10022836 3300025960 Bacteria 3835
271 Ga0207651_10817043 3300025960 Bacteria 827
272 Ga0207668_10166272 3300025972 Unclassified 1725
273 Ga0207668_10176171 3300025972 Bacteria 1682
274 Ga0207668_10208855 3300025972 Unclassified 1560
275 Ga0207640_10321802 3300025981 Bacteria 1232
276 Ga0207640_10523379 3300025981 Bacteria 991
277 Ga0207658_10000806 3300025986 Bacteria 26353
278 Ga0207658_10000913 3300025986 Bacteria 24495
279 Ga0207703_10000647 3300026035 Bacteria 34943
280 Ga0207703_10030118 3300026035 Bacteria 4287
281 Ga0207639_10207067 3300026041 Bacteria 1686
282 Ga0207639_10277722 3300026041 Unclassified 1472
283 Ga0207678_10053717 3300026067 Bacteria 3471
284 Ga0207702_10123168 3300026078 Bacteria 2323
285 Ga0207702_10720162 3300026078 Bacteria 984
286 Ga0207641_10000671 3300026088 Bacteria 37139
287 Ga0207641_10023080 3300026088 Bacteria 5126
288 Ga0207641_10028800 3300026088 Bacteria 4591
289 Ga0207648_10239798 3300026089 Bacteria 1614
290 Ga0207676_10000701 3300026095 Bacteria 26384
291 Ga0207676_10001732 3300026095 Bacteria 16057
292 Ga0207674_10250833 3300026116 Bacteria 1717
293 Ga0207674_10383254 3300026116 Bacteria 1359
294 Ga0207683_10002160 3300026121 Bacteria 17275
295 Ga0207698_10064295 3300026142 Bacteria 2875
296 Ga0207698_10211315 3300026142 Bacteria 1746
297 Ga0268266_10000002 3300028379 Bacteria 3059047
298 Ga0268266_10000134 3300028379 Bacteria 143139
299 Ga0268266_10076324 3300028379 Bacteria 2912
300 Ga0268266_10336382 3300028379 Bacteria 1416
301 Ga0268265_10002985 3300028380 Bacteria 12362
302 Ga0268265_10003997 3300028380 Bacteria 10380
303 Ga0268265_10218036 3300028380 Bacteria 1667
304 Ga0268264_10004378 3300028381 Bacteria 12054
305 Ga0268264_10323757 3300028381 Unclassified 1458
306 Ga0268264_10762142 3300028381 Bacteria 965
307 Ga0307513_10096507 3300031456 Bacteria 2994
308 Ga0307509_10256154 3300031507 Bacteria 1529
309 Ga0307508_10051785 3300031616 Bacteria 3649
310 Ga0307405_10162833 3300031731 Bacteria 1582
311 Ga0307405_10256415 3300031731 Bacteria 1304
312 Ga0307405_10322029 3300031731 Bacteria 1181
313 Ga0307413_10030947 3300031824 Bacteria 3012
314 Ga0307413_10102142 3300031824 Bacteria 1897
315 Ga0307413_10136126 3300031824 Bacteria 1689
316 Ga0307413_10324891 3300031824 Bacteria 1177
317 Ga0307413_10460214 3300031824 Bacteria 1012
318 Ga0307410_10006402 3300031852 Bacteria 6352
319 Ga0307410_10017573 3300031852 Bacteria 4300
320 Ga0307410_10400478 3300031852 Unclassified 1109
321 Ga0307406_10489680 3300031901 Bacteria 995
322 Ga0307407_10664412 3300031903 Bacteria 782
323 Ga0307412_10001423 3300031911 Bacteria 13336
324 Ga0307412_10105952 3300031911 Bacteria 1998
325 Ga0307412_10331726 3300031911 Bacteria 1214
326 Ga0307409_100017211 3300031995 Bacteria 4810
327 Ga0307409_100020060 3300031995 Bacteria 4545
328 Ga0307409_100047658 3300031995 Bacteria 3254
329 Ga0307409_100051698 3300031995 Bacteria 3146
330 Ga0307409_100568148 3300031995 Unclassified 1116
331 Ga0307409_101093537 3300031995 Bacteria 818
332 Ga0307416_100054716 3300032002 Bacteria 3209
333 Ga0307416_100163344 3300032002 Bacteria 2062
334 Ga0307416_100229032 3300032002 Bacteria 1790
335 Ga0307416_100678852 3300032002 Unclassified 1117
336 Ga0307414_10036160 3300032004 Bacteria 3294
337 Ga0307414_10047860 3300032004 Bacteria 2946
338 Ga0307414_10280648 3300032004 Bacteria 1399
339 Ga0307411_10004311 3300032005 Bacteria 6786
340 Ga0307411_10008364 3300032005 Bacteria 5354
341 Ga0307411_10049378 3300032005 Bacteria 2734
342 Ga0307411_10158282 3300032005 Bacteria 1692
343 Ga0307411_10375851 3300032005 Bacteria 1167
344 Ga0307415_100001430 3300032126 Bacteria 11409
345 Ga0307415_100303313 3300032126 Bacteria 1324
346 Ga0307415_100346944 3300032126 Unclassified 1248
347 Ga0395899_0140256 3300037312 Bacteria 1720
348 Ga0395900_0059772 3300037418 Bacteria 3923
349 Ga0395900_0838608 3300037418 Bacteria 845
350 Ga0395898_0032010 3300037466 Bacteria 5250
351 Ga0395898_0359390 3300037466 Bacteria 1389
352 Ga0395905_0080204 3300037471 Bacteria 3058
353 Ga0395905_0395962 3300037471 Bacteria 1276
354 Ga0395905_0512886 3300037471 Bacteria 1099
355 Ga0395901_0103244 3300038443 Bacteria 2991
356 Ga0395901_0311534 3300038443 Bacteria 1630
357 Ga0436365_0662033 3300039437 Bacteria 58921
358 Ga0436365_0747708 3300039437 Bacteria 2503
359 Ga0436365_1259234 3300039437 Bacteria 9188
360 Ga0436365_1413572 3300039437 Bacteria 12913
361 Ga0436365_1425559 3300039437 Bacteria 947
362 Ga0436362_0553655 3300039453 Bacteria 122937
363 Ga0436362_1290835 3300039453 Bacteria 1078
364 Ga0450914_004191 3300042118 Bacteria 1156
365 Ga0450890_000437 3300042127 Bacteria 6053
366 Ga0450905_008981 3300042142 Bacteria 1372
367 Ga0450889_000344 3300042144 Bacteria 5185
368 Ga0439464_0015888 3300042439 Bacteria 2035
369 Ga0466965_0172870 3300044683 Bacteria 1137
370 Ga0466971_0316383 3300044719 Bacteria 752
371 Ga0466970_0346104 3300044765 Bacteria 843
372 Ga0466957_0236428 3300044842 Bacteria 1211
373 Ga0466957_0343972 3300044842 Bacteria 1011
374 Ga0466958_0109386 3300045836 Unclassified 1725
375 Ga0466967_0854413 3300045976 Unclassified 904
376 Ga0495663_0025934 3300046525 Bacteria 1713
377 Ga0495598_0022650 3300046537 Bacteria 1683
378 Ga0495621_0008352 3300046539 Bacteria 3102
379 Ga0495633_0007546 3300046558 Bacteria 6243
380 Ga0495668_0004309 3300046616 Bacteria 10184
381 Ga0495625_0127555 3300046660 Bacteria 1726
382 Ga0495669_0001045 3300046684 Bacteria 11523
383 Ga0495669_0235112 3300046684 Bacteria 879
384 Ga0496101_0041055 3300048904 Bacteria 3297
385 Ga0496101_0175133 3300048904 Bacteria 1650
386 Ga0496102_0258171 3300048905 Bacteria 1643
387 Ga0496102_0731423 3300048905 Bacteria 912
388 Ga0496106_0011582 3300048909 Bacteria 6518
389 Ga0496107_0004786 3300048910 Bacteria 9199
390 Ga0496107_0028311 3300048910 Bacteria 3981
391 Ga0496107_0135122 3300048910 Bacteria 1822
392 Ga0496108_0001395 3300048911 Bacteria 19007
393 Ga0496109_0007457 3300048912 Bacteria 9261
394 Ga0496110_0000806 3300048913 Bacteria 21970
395 Ga0496110_0024849 3300048913 Bacteria 5112
396 Ga0496110_0062941 3300048913 Bacteria 3278
397 Ga0496111_0003369 3300048914 Bacteria 9880
398 Ga0496111_0043681 3300048914 Bacteria 3221
399 Ga0496111_0225583 3300048914 Bacteria 1392
400 Ga0496113_0001156 3300048916 Bacteria 14381
401 Ga0496114_0118540 3300048917 Bacteria 2274
402 Ga0496114_0511822 3300048917 Bacteria 1062
403 Ga0496115_0000865 3300048918 Bacteria 22016
404 Ga0496115_0040701 3300048918 Bacteria 3696
405 Ga0496117_0225755 3300048920 Bacteria 1039
406 Ga0496122_0116154 3300048925 Bacteria 1741
407 Ga0496123_0021702 3300048926 Bacteria 4979
408 Ga0496123_0031781 3300048926 Bacteria 3833
409 Ga0496123_0115471 3300048926 Bacteria 1523
410 Ga0496124_0001312 3300048927 Bacteria 37532
411 Ga0496124_0007485 3300048927 Bacteria 11593
412 Ga0501032_0170213 3300049569 Bacteria 1429
413 Ga0501069_0124788 3300049585 Bacteria 1472
414 Ga0501241_003448 3300049758 Bacteria 2983
415 Ga0501267_011600 3300049764 Bacteria 900
416 nmdc:mga05p37_174987_c1 3300050507 Bacteria 2615
417 nmdc:mga08y16_192797_c1 3300050511 Bacteria 2113
418 nmdc:mga0n895_29537_c1 3300050512 Bacteria 5230
419 Ga0500646_0083074 3300053090 Unclassified 980
420 Ga0500566_0002684 3300053094 Bacteria 10598
421 Ga0500658_0000249 3300053134 Bacteria 25303
422 Ga0500658_0012479 3300053134 Bacteria 3135
423 Ga0500559_0020301 3300053136 Bacteria 2809
424 Ga0500568_0006053 3300053139 Bacteria 6138
425 Ga0500604_0000026 3300053151 Bacteria 67911
426 Ga0500616_0000737 3300053153 Bacteria 37796
427 Ga0500596_000546 3300053735 Bacteria 7149
428 Ga0466962_0204452 3300061719 Unclassified 965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100030728 Ga0070671_1000307284 191
2 3300025931 Ga0207644_10054097 Ga0207644_100540973 191
3 3300031824 Ga0307413_10460214 Ga0307413_104602141 199
4 3300001976 JGI24752J21851_1001317 JGI24752J21851_10013174 200
5 3300005331 Ga0070670_100006019 Ga0070670_1000060193 200
6 3300005335 Ga0070666_10003370 Ga0070666_100033707 200
7 3300005340 Ga0070689_100204605 Ga0070689_1002046051 200
8 3300005344 Ga0070661_100023413 Ga0070661_1000234132 200
9 3300005364 Ga0070673_100007096 Ga0070673_1000070963 200
10 3300005456 Ga0070678_100017249 Ga0070678_1000172494 200
11 3300005457 Ga0070662_100001154 Ga0070662_10000115412 200
12 3300005459 Ga0068867_100087753 Ga0068867_1000877533 200
13 3300005543 Ga0070672_100049310 Ga0070672_1000493103 200
14 3300005548 Ga0070665_100068153 Ga0070665_1000681534 200
15 3300005564 Ga0070664_100008629 Ga0070664_1000086294 200
16 3300005616 Ga0068852_100267531 Ga0068852_1002675312 200
17 3300005618 Ga0068864_100007061 Ga0068864_1000070617 200
18 3300005842 Ga0068858_100001226 Ga0068858_1000012264 200
19 3300006237 Ga0097621_100012082 Ga0097621_1000120825 200
20 3300006358 Ga0068871_100004623 Ga0068871_1000046237 200
21 3300009176 Ga0105242_10096201 Ga0105242_100962013 200
22 3300013296 Ga0157374_10001212 Ga0157374_1000121213 200
23 3300013297 Ga0157378_10052474 Ga0157378_100524743 200
24 3300013306 Ga0163162_10103196 Ga0163162_101031962 200
25 3300013308 Ga0157375_10011909 Ga0157375_100119093 200
26 3300014325 Ga0163163_10002967 Ga0163163_100029674 200
27 3300017792 Ga0163161_10465158 Ga0163161_104651581 200
28 3300025903 Ga0207680_10029536 Ga0207680_100295364 200
29 3300025909 Ga0207705_10107739 Ga0207705_101077393 200
30 3300025920 Ga0207649_10025822 Ga0207649_100258224 200
31 3300025925 Ga0207650_10002895 Ga0207650_100028954 200
32 3300025926 Ga0207659_10130777 Ga0207659_101307772 200
33 3300025931 Ga0207644_10005240 Ga0207644_100052407 200
34 3300025933 Ga0207706_10001368 Ga0207706_1000136826 200
35 3300025940 Ga0207691_10000916 Ga0207691_1000091626 200
36 3300025941 Ga0207711_10014730 Ga0207711_100147305 200
37 3300025945 Ga0207679_10012000 Ga0207679_100120004 200
38 3300025960 Ga0207651_10005034 Ga0207651_100050347 200
39 3300026035 Ga0207703_10030118 Ga0207703_100301183 200
40 3300026088 Ga0207641_10028800 Ga0207641_100288003 200
41 3300026089 Ga0207648_10239798 Ga0207648_102397982 200
42 3300026095 Ga0207676_10001732 Ga0207676_1000173213 200
43 3300026121 Ga0207683_10002160 Ga0207683_1000216020 200
44 3300028379 Ga0268266_10336382 Ga0268266_103363822 200
45 3300048911 Ga0496108_0001395 Ga0496108_0001395_11436_12083 200
46 3300048912 Ga0496109_0007457 Ga0496109_0007457_377_1024 200
47 3300048913 Ga0496110_0024849 Ga0496110_0024849_2608_3255 200
48 3300048914 Ga0496111_0043681 Ga0496111_0043681_55_702 200
49 3300048916 Ga0496113_0001156 Ga0496113_0001156_8261_8908 200
50 3300031731 Ga0307405_10256415 Ga0307405_102564152 205
51 3300031995 Ga0307409_100568148 Ga0307409_1005681481 205
52 3300003214 JGI25165J46597_1000032 JGI25165J46597_100003274 206
53 3300005539 Ga0068853_100171542 Ga0068853_1001715422 206
54 3300005548 Ga0070665_100000086 Ga0070665_10000008636 206
55 3300005578 Ga0068854_100257873 Ga0068854_1002578732 206
56 3300006358 Ga0068871_100772168 Ga0068871_1007721682 206
57 3300009551 Ga0105238_10064257 Ga0105238_100642573 206
58 3300025233 Ga0209437_106131 Ga0209437_1061312 206
59 3300025261 Ga0209233_1000066 Ga0209233_100006676 206
60 3300026041 Ga0207639_10277722 Ga0207639_102777222 206
61 3300028379 Ga0268266_10000002 Ga0268266_100000022523 206
62 3300031507 Ga0307509_10256154 Ga0307509_102561543 206
63 3300031616 Ga0307508_10051785 Ga0307508_100517854 206
64 3300053735 Ga0500596_000546 Ga0500596_000546_1138_1794 206
65 iso_pu_bacteria 2928968154 2928971220 208
66 iso_pu_bacteria 2879163058 2879165492 209
67 3300021384 Ga0213876_10012361 Ga0213876_100123613 210
68 3300003323 rootH1_10029462 rootH1_100294622 211
69 3300005367 Ga0070667_100207320 Ga0070667_1002073202 211
70 3300005539 Ga0068853_100031749 Ga0068853_1000317492 211
71 3300005548 Ga0070665_100969027 Ga0070665_1009690271 211
72 3300009551 Ga0105238_10318891 Ga0105238_103188911 211
73 3300013105 Ga0157369_10567168 Ga0157369_105671681 211
74 3300020070 Ga0206356_11476484 Ga0206356_114764843 211
75 3300025924 Ga0207694_10452164 Ga0207694_104521641 211
76 3300026078 Ga0207702_10720162 Ga0207702_107201621 211
77 3300026142 Ga0207698_10211315 Ga0207698_102113153 211
78 3300028381 Ga0268264_10762142 Ga0268264_107621421 211
79 2162886012 MBSR1b_contig_6576037 MBSR1b_0134.00004600 212
80 3300005293 Ga0065715_10473104 Ga0065715_104731041 212
81 3300005577 Ga0068857_100045328 Ga0068857_1000453284 212
82 3300009093 Ga0105240_10790821 Ga0105240_107908212 212
83 3300009545 Ga0105237_10019710 Ga0105237_100197103 212
84 3300009545 Ga0105237_10849158 Ga0105237_108491581 212
85 3300025913 Ga0207695_10571297 Ga0207695_105712972 212
86 3300025914 Ga0207671_10006798 Ga0207671_100067985 212
87 3300026116 Ga0207674_10383254 Ga0207674_103832542 212
88 3300031852 Ga0307410_10400478 Ga0307410_104004781 212
89 3300031911 Ga0307412_10001423 Ga0307412_1000142310 212
90 3300032002 Ga0307416_100678852 Ga0307416_1006788522 212
91 3300032126 Ga0307415_100346944 Ga0307415_1003469442 212
92 3300038443 Ga0395901_0311534 Ga0395901_0311534_741_1385 212
93 3300039437 Ga0436365_1413572 Ga0436365_1413572_4101_4802 212
94 3300039453 Ga0436362_1290835 Ga0436362_1290835_48_749 212
95 3300048925 Ga0496122_0116154 Ga0496122_0116154_794_1441 212
96 3300048926 Ga0496123_0021702 Ga0496123_0021702_2807_3454 212
97 3300048926 Ga0496123_0031781 Ga0496123_0031781_2381_3028 212
98 3300048926 Ga0496123_0115471 Ga0496123_0115471_732_1379 212
99 3300048927 Ga0496124_0001312 Ga0496124_0001312_10684_11331 212
100 3300048927 Ga0496124_0007485 Ga0496124_0007485_2290_2937 212
101 2162886011 MRS1b_contig_8435877 MRS1b_0333.00001180 213
102 2162886012 MBSR1b_contig_8719363 MBSR1b_0865.00002470 213
103 3300001915 JGI24741J21665_1005640 JGI24741J21665_10056403 213
104 3300001989 JGI24739J22299_10019008 JGI24739J22299_100190082 213
105 3300001990 JGI24737J22298_10071059 JGI24737J22298_100710592 213
106 3300002067 JGI24735J21928_10030476 JGI24735J21928_100304762 213
107 3300002774 JGI25150J39212_1000514 JGI25150J39212_100051411 213
108 3300003215 JGI25153J46596_10000181 JGI25153J46596_100001816 213
109 3300003791 Ga0055530_10031779 Ga0055530_100317792 213
110 3300003794 Ga0055531_10039760 Ga0055531_100397602 213
111 3300005262 Ga0065165_1026468 Ga0065165_10264684 213
112 3300005290 Ga0065712_10077101 Ga0065712_100771013 213
113 3300005290 Ga0065712_10261035 Ga0065712_102610351 213
114 3300005293 Ga0065715_10110282 Ga0065715_101102821 213
115 3300005327 Ga0070658_10000037 Ga0070658_1000003764 213
116 3300005327 Ga0070658_10018660 Ga0070658_100186603 213
117 3300005328 Ga0070676_10080867 Ga0070676_100808672 213
118 3300005329 Ga0070683_100085586 Ga0070683_1000855864 213
119 3300005331 Ga0070670_100001791 Ga0070670_1000017913 213
120 3300005331 Ga0070670_100020530 Ga0070670_1000205303 213
121 3300005331 Ga0070670_100032937 Ga0070670_1000329372 213
122 3300005331 Ga0070670_100108499 Ga0070670_1001084992 213
123 3300005331 Ga0070670_100472631 Ga0070670_1004726312 213
124 3300005333 Ga0070677_10001101 Ga0070677_100011015 213
125 3300005334 Ga0068869_100119107 Ga0068869_1001191072 213
126 3300005336 Ga0070680_100000705 Ga0070680_10000070514 213
127 3300005336 Ga0070680_100167405 Ga0070680_1001674052 213
128 3300005336 Ga0070680_100200486 Ga0070680_1002004863 213
129 3300005337 Ga0070682_100147205 Ga0070682_1001472052 213
130 3300005339 Ga0070660_100000617 Ga0070660_10000061728 213
131 3300005339 Ga0070660_100005195 Ga0070660_1000051952 213
132 3300005339 Ga0070660_100027153 Ga0070660_1000271533 213
133 3300005339 Ga0070660_100057187 Ga0070660_1000571872 213
134 3300005339 Ga0070660_100113321 Ga0070660_1001133213 213
135 3300005344 Ga0070661_100000065 Ga0070661_10000006577 213
136 3300005344 Ga0070661_100098256 Ga0070661_1000982562 213
137 3300005344 Ga0070661_100402966 Ga0070661_1004029661 213
138 3300005345 Ga0070692_10005931 Ga0070692_100059312 213
139 3300005347 Ga0070668_100027522 Ga0070668_1000275222 213
140 3300005347 Ga0070668_100053741 Ga0070668_1000537414 213
141 3300005347 Ga0070668_100087679 Ga0070668_1000876793 213
142 3300005347 Ga0070668_100271099 Ga0070668_1002710991 213
143 3300005347 Ga0070668_100272657 Ga0070668_1002726572 213
144 3300005353 Ga0070669_100019163 Ga0070669_1000191633 213
145 3300005353 Ga0070669_100061027 Ga0070669_1000610271 213
146 3300005353 Ga0070669_100087713 Ga0070669_1000877132 213
147 3300005353 Ga0070669_100152268 Ga0070669_1001522682 213
148 3300005354 Ga0070675_100006727 Ga0070675_1000067271 213
149 3300005354 Ga0070675_100008582 Ga0070675_1000085828 213
150 3300005355 Ga0070671_100000987 Ga0070671_10000098714 213
151 3300005355 Ga0070671_100008457 Ga0070671_1000084573 213
152 3300005356 Ga0070674_100016909 Ga0070674_1000169092 213
153 3300005356 Ga0070674_100043628 Ga0070674_1000436283 213
154 3300005364 Ga0070673_100019095 Ga0070673_1000190954 213
155 3300005364 Ga0070673_100081069 Ga0070673_1000810692 213
156 3300005366 Ga0070659_100029895 Ga0070659_1000298954 213
157 3300005366 Ga0070659_100039352 Ga0070659_1000393523 213
158 3300005367 Ga0070667_100001302 Ga0070667_1000013028 213
159 3300005367 Ga0070667_100003430 Ga0070667_1000034309 213
160 3300005367 Ga0070667_100064941 Ga0070667_1000649413 213
161 3300005367 Ga0070667_100241200 Ga0070667_1002412002 213
162 3300005435 Ga0070714_100039665 Ga0070714_1000396654 213
163 3300005436 Ga0070713_100087774 Ga0070713_1000877742 213
164 3300005444 Ga0070694_100023727 Ga0070694_1000237272 213
165 3300005455 Ga0070663_100362150 Ga0070663_1003621502 213
166 3300005457 Ga0070662_100006786 Ga0070662_1000067863 213
167 3300005457 Ga0070662_100024858 Ga0070662_1000248586 213
168 3300005457 Ga0070662_100029536 Ga0070662_1000295362 213
169 3300005457 Ga0070662_100276116 Ga0070662_1002761162 213
170 3300005457 Ga0070662_100319028 Ga0070662_1003190281 213
171 3300005458 Ga0070681_10166137 Ga0070681_101661373 213
172 3300005530 Ga0070679_100000002 Ga0070679_100000002316 213
173 3300005530 Ga0070679_100080804 Ga0070679_1000808042 213
174 3300005530 Ga0070679_100131924 Ga0070679_1001319241 213
175 3300005535 Ga0070684_100618323 Ga0070684_1006183232 213
176 3300005543 Ga0070672_100591975 Ga0070672_1005919751 213
177 3300005548 Ga0070665_100000054 Ga0070665_10000005483 213
178 3300005548 Ga0070665_100106217 Ga0070665_1001062174 213
179 3300005563 Ga0068855_100321666 Ga0068855_1003216661 213
180 3300005563 Ga0068855_100788934 Ga0068855_1007889341 213
181 3300005564 Ga0070664_100002681 Ga0070664_10000268118 213
182 3300005564 Ga0070664_100097042 Ga0070664_1000970423 213
183 3300005564 Ga0070664_100203499 Ga0070664_1002034993 213
184 3300005577 Ga0068857_100213449 Ga0068857_1002134492 213
185 3300005577 Ga0068857_100421318 Ga0068857_1004213182 213
186 3300005578 Ga0068854_100320333 Ga0068854_1003203332 213
187 3300005578 Ga0068854_100639244 Ga0068854_1006392441 213
188 3300005614 Ga0068856_100858831 Ga0068856_1008588312 213
189 3300005616 Ga0068852_100016642 Ga0068852_1000166424 213
190 3300005616 Ga0068852_100399717 Ga0068852_1003997172 213
191 3300005617 Ga0068859_100001097 Ga0068859_1000010976 213
192 3300005618 Ga0068864_100000502 Ga0068864_10000050216 213
193 3300005618 Ga0068864_100023202 Ga0068864_1000232022 213
194 3300005834 Ga0068851_10100741 Ga0068851_101007412 213
195 3300005834 Ga0068851_10198672 Ga0068851_101986721 213
196 3300005841 Ga0068863_100000592 Ga0068863_10000059210 213
197 3300005841 Ga0068863_100118508 Ga0068863_1001185083 213
198 3300005842 Ga0068858_100004267 Ga0068858_1000042677 213
199 3300005843 Ga0068860_100001440 Ga0068860_10000144024 213
200 3300005843 Ga0068860_100378793 Ga0068860_1003787932 213
201 3300005844 Ga0068862_100002492 Ga0068862_10000249214 213
202 3300005844 Ga0068862_100156066 Ga0068862_1001560662 213
203 3300005844 Ga0068862_100266600 Ga0068862_1002666001 213
204 3300006237 Ga0097621_100133287 Ga0097621_1001332872 213
205 3300006844 Ga0075428_100661538 Ga0075428_1006615382 213
206 3300006846 Ga0075430_100620859 Ga0075430_1006208592 213
207 3300006871 Ga0075434_100079173 Ga0075434_1000791733 213
208 3300006931 Ga0097620_100001097 Ga0097620_10000109721 213
209 3300009092 Ga0105250_10022278 Ga0105250_100222783 213
210 3300009094 Ga0111539_10060517 Ga0111539_100605174 213
211 3300009101 Ga0105247_10119082 Ga0105247_101190822 213
212 3300009147 Ga0114129_10082112 Ga0114129_100821124 213
213 3300009177 Ga0105248_10004576 Ga0105248_100045769 213
214 3300009177 Ga0105248_10013222 Ga0105248_100132227 213
215 3300009177 Ga0105248_10021837 Ga0105248_100218373 213
216 3300009551 Ga0105238_10518521 Ga0105238_105185212 213
217 3300009553 Ga0105249_10547483 Ga0105249_105474831 213
218 3300013100 Ga0157373_10034355 Ga0157373_100343553 213
219 3300013100 Ga0157373_10239064 Ga0157373_102390642 213
220 3300013102 Ga0157371_10102726 Ga0157371_101027262 213
221 3300013102 Ga0157371_10206985 Ga0157371_102069852 213
222 3300013102 Ga0157371_10432331 Ga0157371_104323311 213
223 3300013104 Ga0157370_10174991 Ga0157370_101749912 213
224 3300013105 Ga0157369_10554969 Ga0157369_105549692 213
225 3300013296 Ga0157374_10186775 Ga0157374_101867752 213
226 3300013306 Ga0163162_10337554 Ga0163162_103375543 213
227 3300013307 Ga0157372_10374295 Ga0157372_103742952 213
228 3300013307 Ga0157372_10396728 Ga0157372_103967283 213
229 3300013307 Ga0157372_10579900 Ga0157372_105799002 213
230 3300013308 Ga0157375_10187621 Ga0157375_101876212 213
231 3300013308 Ga0157375_10463942 Ga0157375_104639422 213
232 3300013308 Ga0157375_10746268 Ga0157375_107462682 213
233 3300014325 Ga0163163_10006238 Ga0163163_100062384 213
234 3300014325 Ga0163163_10372507 Ga0163163_103725071 213
235 3300014326 Ga0157380_10001794 Ga0157380_100017946 213
236 3300014968 Ga0157379_10007300 Ga0157379_100073004 213
237 3300017792 Ga0163161_10025185 Ga0163161_100251854 213
238 3300021358 Ga0213873_10000010 Ga0213873_10000010110 213
239 3300021384 Ga0213876_10000027 Ga0213876_10000027110 213
240 3300021384 Ga0213876_10036128 Ga0213876_100361283 213
241 3300021384 Ga0213876_10036729 Ga0213876_100367292 213
242 3300025245 Ga0207425_1000019 Ga0207425_100001942 213
243 3300025258 Ga0209129_1002152 Ga0209129_10021524 213
244 3300025263 Ga0209565_1049772 Ga0209565_10497721 213
245 3300025292 Ga0209676_1008137 Ga0209676_10081372 213
246 3300025294 Ga0209025_1000472 Ga0209025_100047250 213
247 3300025297 Ga0209758_1000019 Ga0209758_1000019545 213
248 3300025298 Ga0209050_1014929 Ga0209050_10149293 213
249 3300025304 Ga0209257_1003900 Ga0209257_10039003 213
250 3300025315 Ga0207697_10042290 Ga0207697_100422902 213
251 3300025321 Ga0207656_10091982 Ga0207656_100919822 213
252 3300025711 Ga0207696_1023114 Ga0207696_10231143 213
253 3300025893 Ga0207682_10002291 Ga0207682_100022912 213
254 3300025904 Ga0207647_10045730 Ga0207647_100457304 213
255 3300025907 Ga0207645_10196585 Ga0207645_101965852 213
256 3300025909 Ga0207705_10000008 Ga0207705_1000000892 213
257 3300025909 Ga0207705_10008958 Ga0207705_100089584 213
258 3300025909 Ga0207705_10010899 Ga0207705_100108997 213
259 3300025909 Ga0207705_10013063 Ga0207705_100130634 213
260 3300025909 Ga0207705_10093185 Ga0207705_100931852 213
261 3300025917 Ga0207660_10001171 Ga0207660_100011712 213
262 3300025917 Ga0207660_10047301 Ga0207660_100473012 213
263 3300025917 Ga0207660_10506933 Ga0207660_105069332 213
264 3300025919 Ga0207657_10000867 Ga0207657_1000086724 213
265 3300025919 Ga0207657_10012237 Ga0207657_100122377 213
266 3300025919 Ga0207657_10023650 Ga0207657_100236503 213
267 3300025919 Ga0207657_10023793 Ga0207657_100237934 213
268 3300025919 Ga0207657_10065279 Ga0207657_100652794 213
269 3300025919 Ga0207657_10185551 Ga0207657_101855513 213
270 3300025919 Ga0207657_10185562 Ga0207657_101855622 213
271 3300025920 Ga0207649_10000223 Ga0207649_1000022330 213
272 3300025920 Ga0207649_10117392 Ga0207649_101173922 213
273 3300025921 Ga0207652_10000001 Ga0207652_10000001176 213
274 3300025921 Ga0207652_10000002 Ga0207652_10000002551 213
275 3300025921 Ga0207652_10016264 Ga0207652_100162644 213
276 3300025921 Ga0207652_10050930 Ga0207652_100509301 213
277 3300025921 Ga0207652_10187789 Ga0207652_101877892 213
278 3300025923 Ga0207681_10039815 Ga0207681_100398153 213
279 3300025923 Ga0207681_10183641 Ga0207681_101836411 213
280 3300025923 Ga0207681_10192728 Ga0207681_101927282 213
281 3300025924 Ga0207694_10157390 Ga0207694_101573903 213
282 3300025925 Ga0207650_10011705 Ga0207650_100117051 213
283 3300025925 Ga0207650_10142063 Ga0207650_101420632 213
284 3300025925 Ga0207650_10271165 Ga0207650_102711651 213
285 3300025926 Ga0207659_10001607 Ga0207659_1000160710 213
286 3300025926 Ga0207659_10005281 Ga0207659_100052817 213
287 3300025927 Ga0207687_10033996 Ga0207687_100339963 213
288 3300025928 Ga0207700_10117762 Ga0207700_101177622 213
289 3300025929 Ga0207664_10026093 Ga0207664_100260934 213
290 3300025931 Ga0207644_10057399 Ga0207644_100573991 213
291 3300025932 Ga0207690_10155294 Ga0207690_101552942 213
292 3300025933 Ga0207706_10011377 Ga0207706_100113776 213
293 3300025933 Ga0207706_10012270 Ga0207706_100122703 213
294 3300025933 Ga0207706_10012864 Ga0207706_100128642 213
295 3300025933 Ga0207706_10037239 Ga0207706_100372394 213
296 3300025933 Ga0207706_10347808 Ga0207706_103478081 213
297 3300025933 Ga0207706_10402507 Ga0207706_104025072 213
298 3300025937 Ga0207669_10035371 Ga0207669_100353712 213
299 3300025937 Ga0207669_10181613 Ga0207669_101816132 213
300 3300025941 Ga0207711_10000848 Ga0207711_1000084816 213
301 3300025941 Ga0207711_10004471 Ga0207711_100044714 213
302 3300025942 Ga0207689_10159286 Ga0207689_101592863 213
303 3300025945 Ga0207679_10124720 Ga0207679_101247202 213
304 3300025945 Ga0207679_10256095 Ga0207679_102560952 213
305 3300025949 Ga0207667_10757152 Ga0207667_107571522 213
306 3300025949 Ga0207667_10764352 Ga0207667_107643522 213
307 3300025960 Ga0207651_10018647 Ga0207651_100186472 213
308 3300025960 Ga0207651_10022836 Ga0207651_100228364 213
309 3300025960 Ga0207651_10817043 Ga0207651_108170431 213
310 3300025972 Ga0207668_10166272 Ga0207668_101662722 213
311 3300025972 Ga0207668_10176171 Ga0207668_101761712 213
312 3300025972 Ga0207668_10208855 Ga0207668_102088553 213
313 3300025981 Ga0207640_10321802 Ga0207640_103218022 213
314 3300025981 Ga0207640_10523379 Ga0207640_105233792 213
315 3300025986 Ga0207658_10000806 Ga0207658_1000080620 213
316 3300025986 Ga0207658_10000913 Ga0207658_100009139 213
317 3300026035 Ga0207703_10000647 Ga0207703_100006477 213
318 3300026041 Ga0207639_10207067 Ga0207639_102070672 213
319 3300026067 Ga0207678_10053717 Ga0207678_100537173 213
320 3300026078 Ga0207702_10123168 Ga0207702_101231683 213
321 3300026088 Ga0207641_10000671 Ga0207641_1000067121 213
322 3300026088 Ga0207641_10023080 Ga0207641_100230804 213
323 3300026095 Ga0207676_10000701 Ga0207676_100007015 213
324 3300026116 Ga0207674_10250833 Ga0207674_102508332 213
325 3300026142 Ga0207698_10064295 Ga0207698_100642953 213
326 3300028379 Ga0268266_10000134 Ga0268266_1000013447 213
327 3300028379 Ga0268266_10076324 Ga0268266_100763241 213
328 3300028380 Ga0268265_10002985 Ga0268265_100029858 213
329 3300028380 Ga0268265_10003997 Ga0268265_100039975 213
330 3300028380 Ga0268265_10218036 Ga0268265_102180362 213
331 3300028381 Ga0268264_10004378 Ga0268264_1000437811 213
332 3300028381 Ga0268264_10323757 Ga0268264_103237572 213
333 3300031456 Ga0307513_10096507 Ga0307513_100965073 213
334 3300031731 Ga0307405_10162833 Ga0307405_101628332 213
335 3300031731 Ga0307405_10322029 Ga0307405_103220292 213
336 3300031824 Ga0307413_10030947 Ga0307413_100309472 213
337 3300031824 Ga0307413_10102142 Ga0307413_101021422 213
338 3300031824 Ga0307413_10136126 Ga0307413_101361261 213
339 3300031824 Ga0307413_10324891 Ga0307413_103248912 213
340 3300031852 Ga0307410_10006402 Ga0307410_100064023 213
341 3300031852 Ga0307410_10017573 Ga0307410_100175732 213
342 3300031901 Ga0307406_10489680 Ga0307406_104896802 213
343 3300031903 Ga0307407_10664412 Ga0307407_106644121 213
344 3300031911 Ga0307412_10105952 Ga0307412_101059523 213
345 3300031911 Ga0307412_10331726 Ga0307412_103317262 213
346 3300031995 Ga0307409_100017211 Ga0307409_1000172112 213
347 3300031995 Ga0307409_100020060 Ga0307409_1000200603 213
348 3300031995 Ga0307409_100047658 Ga0307409_1000476582 213
349 3300031995 Ga0307409_100051698 Ga0307409_1000516982 213
350 3300031995 Ga0307409_101093537 Ga0307409_1010935371 213
351 3300032002 Ga0307416_100054716 Ga0307416_1000547162 213
352 3300032002 Ga0307416_100163344 Ga0307416_1001633442 213
353 3300032002 Ga0307416_100229032 Ga0307416_1002290322 213
354 3300032004 Ga0307414_10036160 Ga0307414_100361603 213
355 3300032004 Ga0307414_10047860 Ga0307414_100478605 213
356 3300032004 Ga0307414_10280648 Ga0307414_102806482 213
357 3300032005 Ga0307411_10004311 Ga0307411_100043114 213
358 3300032005 Ga0307411_10008364 Ga0307411_100083642 213
359 3300032005 Ga0307411_10049378 Ga0307411_100493782 213
360 3300032005 Ga0307411_10158282 Ga0307411_101582822 213
361 3300032005 Ga0307411_10375851 Ga0307411_103758511 213
362 3300032126 Ga0307415_100001430 Ga0307415_1000014308 213
363 3300032126 Ga0307415_100303313 Ga0307415_1003033132 213
364 3300037312 Ga0395899_0140256 Ga0395899_0140256_291_941 213
365 3300037418 Ga0395900_0059772 Ga0395900_0059772_2314_2964 213
366 3300037418 Ga0395900_0838608 Ga0395900_0838608_175_822 213
367 3300037466 Ga0395898_0032010 Ga0395898_0032010_1437_2087 213
368 3300037466 Ga0395898_0359390 Ga0395898_0359390_247_894 213
369 3300037471 Ga0395905_0080204 Ga0395905_0080204_1101_1751 213
370 3300037471 Ga0395905_0395962 Ga0395905_0395962_489_1136 213
371 3300037471 Ga0395905_0512886 Ga0395905_0512886_262_909 213
372 3300038443 Ga0395901_0103244 Ga0395901_0103244_1592_2242 213
373 3300039437 Ga0436365_0662033 Ga0436365_0662033_12099_12746 213
374 3300039437 Ga0436365_0747708 Ga0436365_0747708_1777_2424 213
375 3300039437 Ga0436365_1259234 Ga0436365_1259234_6371_7018 213
376 3300039437 Ga0436365_1425559 Ga0436365_1425559_57_704 213
377 3300039453 Ga0436362_0553655 Ga0436362_0553655_44193_44840 213
378 3300042118 Ga0450914_004191 Ga0450914_004191_62_709 213
379 3300042127 Ga0450890_000437 Ga0450890_000437_2068_2715 213
380 3300042142 Ga0450905_008981 Ga0450905_008981_132_779 213
381 3300042144 Ga0450889_000344 Ga0450889_000344_4407_5054 213
382 3300042439 Ga0439464_0015888 Ga0439464_0015888_293_940 213
383 3300044683 Ga0466965_0172870 Ga0466965_0172870_434_1081 213
384 3300044719 Ga0466971_0316383 Ga0466971_0316383_66_713 213
385 3300044765 Ga0466970_0346104 Ga0466970_0346104_156_803 213
386 3300044842 Ga0466957_0236428 Ga0466957_0236428_171_818 213
387 3300044842 Ga0466957_0343972 Ga0466957_0343972_163_810 213
388 3300045836 Ga0466958_0109386 Ga0466958_0109386_14_661 213
389 3300045976 Ga0466967_0854413 Ga0466967_0854413_37_684 213
390 3300046525 Ga0495663_0025934 Ga0495663_0025934_925_1569 213
391 3300046537 Ga0495598_0022650 Ga0495598_0022650_778_1419 213
392 3300046539 Ga0495621_0008352 Ga0495621_0008352_1531_2172 213
393 3300046558 Ga0495633_0007546 Ga0495633_0007546_2092_2733 213
394 3300046616 Ga0495668_0004309 Ga0495668_0004309_6275_6922 213
395 3300046660 Ga0495625_0127555 Ga0495625_0127555_62_709 213
396 3300046684 Ga0495669_0001045 Ga0495669_0001045_2560_3201 213
397 3300046684 Ga0495669_0235112 Ga0495669_0235112_187_840 213
398 3300048904 Ga0496101_0041055 Ga0496101_0041055_2420_3067 213
399 3300048904 Ga0496101_0175133 Ga0496101_0175133_484_1131 213
400 3300048905 Ga0496102_0258171 Ga0496102_0258171_938_1585 213
401 3300048905 Ga0496102_0731423 Ga0496102_0731423_248_895 213
402 3300048909 Ga0496106_0011582 Ga0496106_0011582_5728_6375 213
403 3300048910 Ga0496107_0004786 Ga0496107_0004786_708_1355 213
404 3300048910 Ga0496107_0028311 Ga0496107_0028311_2551_3198 213
405 3300048910 Ga0496107_0135122 Ga0496107_0135122_486_1133 213
406 3300048913 Ga0496110_0000806 Ga0496110_0000806_19480_20121 213
407 3300048913 Ga0496110_0062941 Ga0496110_0062941_515_1162 213
408 3300048914 Ga0496111_0003369 Ga0496111_0003369_7361_8002 213
409 3300048914 Ga0496111_0225583 Ga0496111_0225583_352_999 213
410 3300048917 Ga0496114_0118540 Ga0496114_0118540_1489_2136 213
411 3300048917 Ga0496114_0511822 Ga0496114_0511822_36_740 213
412 3300048918 Ga0496115_0000865 Ga0496115_0000865_12355_13002 213
413 3300048918 Ga0496115_0040701 Ga0496115_0040701_854_1501 213
414 3300048920 Ga0496117_0225755 Ga0496117_0225755_178_825 213
415 3300049569 Ga0501032_0170213 Ga0501032_0170213_140_790 213
416 3300049585 Ga0501069_0124788 Ga0501069_0124788_618_1271 213
417 3300049758 Ga0501241_003448 Ga0501241_003448_271_921 213
418 3300049764 Ga0501267_011600 Ga0501267_011600_112_759 213
419 3300050507 nmdc:mga05p37_174987_c1 nmdc:mga05p37_174987_c1_1805_2452 213
420 3300050511 nmdc:mga08y16_192797_c1 nmdc:mga08y16_192797_c1_519_1166 213
421 3300050512 nmdc:mga0n895_29537_c1 nmdc:mga0n895_29537_c1_2924_3571 213
422 3300053090 Ga0500646_0083074 Ga0500646_0083074_280_927 213
423 3300053094 Ga0500566_0002684 Ga0500566_0002684_8997_9647 213
424 3300053134 Ga0500658_0000249 Ga0500658_0000249_24365_25012 213
425 3300053134 Ga0500658_0012479 Ga0500658_0012479_1490_2164 213
426 3300053136 Ga0500559_0020301 Ga0500559_0020301_1258_1911 213
427 3300053139 Ga0500568_0006053 Ga0500568_0006053_892_1539 213
428 3300053151 Ga0500604_0000026 Ga0500604_0000026_27773_28420 213
429 3300053153 Ga0500616_0000737 Ga0500616_0000737_4632_5279 213
430 3300061719 Ga0466962_0204452 Ga0466962_0204452_14_661 213
431 iso_pu_bacteria 2946787523 2946789755 213

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ep9-assembly1.cif.gz_A crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7505 6 191
1dgw-assembly1.cif.gz_A structure of the rhombohedral crystal of canavalin from jack bean 0.7482 84 189
7ani-assembly1.cif.gz_A ddahb, gdp-mannoheptose c3,5 epimerase from campylobacter jejuni 0.7469 75 189
5ep9-assembly2.cif.gz_B crystal structure of the non-heme alpha ketoglutarate dependent epimerase snon from nogalamycin biosynthesis 0.7411 6 191
7ang-assembly2.cif.gz_B mlghb, gdp-mannoheptose c3,5 epimerase from campylobacter jejuni 0.7261 76 191
ID Description Score Start End Superfamily
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7985 88 193 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7842 88 190 2.60.120.10
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.764 91 192 2.60.120.10
af_Q9FZH5_335_433_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7545 88 189 2.60.120.10
af_I1JF86_104_298_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7484 90 195 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0J7Y7Y9-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9563 7 210
AF-A0A257YCY9-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9538 15 210
AF-A0A7Y2CEP7-F1-model_v4 Phytanoyl-CoA dioxygenase 0.9513 7 212
AF-A0A1H7R2E8-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9491 6 201
AF-A0A3R9WSW8-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9477 6 201

Feature Viewer

pLDDT pTM Quality
94.49 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map