F442403

General Info

Members Datasets Scaffolds Average Seq Length
431 216 431 88

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_12161699|Ga0307414_121616991
Length 104
Sequence VTLEEDMVAQLKRDWRSTPGLTEAEHVMLEYVEQLTRDAVKIHPGYHERLRGAGFDDRGILQITMIASWFNYINRIADALGIGRYPATTPDVLPPTDKERRGEM

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0
Rhizoplane 2.32
Rhizosphere 95.13
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10010044 3300005293 Bacteria 2937
2 Ga0065715_10354639 3300005293 Bacteria 945
3 Ga0065707_10009744 3300005295 Bacteria 2784
4 Ga0070683_100478965 3300005329 Bacteria 1188
5 Ga0070683_101397961 3300005329 Bacteria 673
6 Ga0070690_100360084 3300005330 Bacteria 1058
7 Ga0070690_101652762 3300005330 Bacteria 520
8 Ga0070677_10034085 3300005333 Bacteria 1965
9 Ga0068869_100177077 3300005334 Bacteria 1670
10 Ga0068869_100203102 3300005334 Bacteria 1563
11 Ga0070680_100016281 3300005336 Bacteria 5850
12 Ga0070680_100613773 3300005336 Bacteria 934
13 Ga0070680_101486635 3300005336 Bacteria 587
14 Ga0068868_102154038 3300005338 Unclassified 531
15 Ga0070660_100744506 3300005339 Unclassified 823
16 Ga0070660_100903103 3300005339 Bacteria 745
17 Ga0070689_100024526 3300005340 Bacteria 4525
18 Ga0070689_100053155 3300005340 Bacteria 3134
19 Ga0070689_100845027 3300005340 Bacteria 807
20 Ga0070687_100008757 3300005343 Unclassified 4300
21 Ga0070661_101172234 3300005344 Bacteria 642
22 Ga0070661_101880695 3300005344 Bacteria 509
23 Ga0070692_10027118 3300005345 Bacteria 2836
24 Ga0070692_10726604 3300005345 Bacteria 671
25 Ga0070668_100000901 3300005347 Bacteria 20668
26 Ga0070668_100342438 3300005347 Bacteria 1263
27 Ga0070669_100001517 3300005353 Bacteria 16789
28 Ga0070669_100006688 3300005353 Bacteria 8302
29 Ga0070669_100037069 3300005353 Bacteria 3536
30 Ga0070675_100019377 3300005354 Bacteria 5421
31 Ga0070675_100035597 3300005354 Bacteria 4046
32 Ga0070671_101082274 3300005355 Bacteria 704
33 Ga0070674_100141697 3300005356 Bacteria 1805
34 Ga0070673_100002357 3300005364 Bacteria 11478
35 Ga0070673_100011640 3300005364 Bacteria 6010
36 Ga0070673_100136489 3300005364 Bacteria 2065
37 Ga0070673_100506269 3300005364 Bacteria 1093
38 Ga0070688_100038148 3300005365 Bacteria 2932
39 Ga0070659_100253521 3300005366 Unclassified 1459
40 Ga0070659_101937732 3300005366 Unclassified 529
41 Ga0070667_100015933 3300005367 Bacteria 6219
42 Ga0070667_100017907 3300005367 Bacteria 5872
43 Ga0070667_100097287 3300005367 Unclassified 2539
44 Ga0070667_100361231 3300005367 Bacteria 1316
45 Ga0070667_100813283 3300005367 Bacteria 868
46 Ga0070709_10007481 3300005434 Bacteria 5989
47 Ga0070709_11023382 3300005434 Bacteria 658
48 Ga0070713_100902472 3300005436 Bacteria 850
49 Ga0070701_10026312 3300005438 Bacteria 2836
50 Ga0070701_10135132 3300005438 Bacteria 1405
51 Ga0070700_100260886 3300005441 Bacteria 1248
52 Ga0070700_100315086 3300005441 Bacteria 1147
53 Ga0070700_101725241 3300005441 Bacteria 538
54 Ga0070694_100109541 3300005444 Bacteria 1966
55 Ga0070694_100822515 3300005444 Bacteria 763
56 Ga0070708_100019039 3300005445 Bacteria 5758
57 Ga0070708_100020656 3300005445 Bacteria 5558
58 Ga0070663_100293956 3300005455 Archaea 1298
59 Ga0070662_100072126 3300005457 Bacteria 2549
60 Ga0070662_100089162 3300005457 Bacteria 2313
61 Ga0070662_100134733 3300005457 Bacteria 1908
62 Ga0068867_100002077 3300005459 Bacteria 14032
63 Ga0068867_100068330 3300005459 Bacteria 2652
64 Ga0070685_10023322 3300005466 Bacteria 3388
65 Ga0070685_11209084 3300005466 Bacteria 575
66 Ga0070706_100076086 3300005467 Bacteria 3107
67 Ga0070706_102070628 3300005467 Unclassified 515
68 Ga0070707_100003322 3300005468 Bacteria 15188
69 Ga0070707_100394647 3300005468 Bacteria 1343
70 Ga0070707_101585713 3300005468 Bacteria 622
71 Ga0070698_100017740 3300005471 Bacteria 7497
72 Ga0070698_100051405 3300005471 Bacteria 4197
73 Ga0070698_100538071 3300005471 Bacteria 1107
74 Ga0070698_101848906 3300005471 Bacteria 557
75 Ga0070699_100344596 3300005518 Bacteria 1341
76 Ga0070684_100623161 3300005535 Unclassified 1003
77 Ga0070697_100000970 3300005536 Bacteria 21656
78 Ga0070697_100436095 3300005536 Bacteria 1140
79 Ga0070672_100006462 3300005543 Bacteria 7880
80 Ga0070672_100007061 3300005543 Bacteria 7595
81 Ga0070672_100027146 3300005543 Bacteria 4268
82 Ga0070696_100146175 3300005546 Bacteria 1732
83 Ga0070696_100793113 3300005546 Bacteria 779
84 Ga0070665_100000646 3300005548 Bacteria 47132
85 Ga0070665_100065440 3300005548 Bacteria 3646
86 Ga0070704_100122084 3300005549 Unclassified 2003
87 Ga0070704_100142972 3300005549 Bacteria 1871
88 Ga0070704_100895417 3300005549 Bacteria 798
89 Ga0068855_100818103 3300005563 Bacteria 989
90 Ga0070664_100105405 3300005564 Unclassified 2455
91 Ga0070664_100232268 3300005564 Bacteria 1653
92 Ga0070664_100878183 3300005564 Bacteria 840
93 Ga0070664_101597806 3300005564 Bacteria 618
94 Ga0068857_100063804 3300005577 Unclassified 3275
95 Ga0068857_100510396 3300005577 Bacteria 1129
96 Ga0068857_101037902 3300005577 Bacteria 790
97 Ga0068857_101643341 3300005577 Bacteria 627
98 Ga0068854_101426231 3300005578 Bacteria 627
99 Ga0068852_100310473 3300005616 Bacteria 1529
100 Ga0068852_101089467 3300005616 Bacteria 819
101 Ga0068859_100006963 3300005617 Bacteria 11476
102 Ga0068859_100172984 3300005617 Bacteria 2241
103 Ga0068859_100214689 3300005617 Bacteria 2011
104 Ga0068859_100242360 3300005617 Bacteria 1892
105 Ga0068859_100393962 3300005617 Bacteria 1481
106 Ga0068859_100412571 3300005617 Bacteria 1446
107 Ga0068859_100685572 3300005617 Bacteria 1116
108 Ga0068864_100121185 3300005618 Bacteria 2338
109 Ga0068864_100983469 3300005618 Bacteria 836
110 Ga0068861_100364628 3300005719 Bacteria 1272
111 Ga0068861_100512371 3300005719 Bacteria 1086
112 Ga0068861_101936516 3300005719 Bacteria 587
113 Ga0068870_10003108 3300005840 Bacteria 7004
114 Ga0068870_10006645 3300005840 Bacteria 5109
115 Ga0068863_101042040 3300005841 Bacteria 822
116 Ga0068858_100009514 3300005842 Bacteria 9272
117 Ga0068858_100127049 3300005842 Bacteria 2388
118 Ga0068858_100203027 3300005842 Bacteria 1875
119 Ga0068858_100900183 3300005842 Bacteria 865
120 Ga0068860_100080681 3300005843 Bacteria 3093
121 Ga0068860_100103253 3300005843 Bacteria 2721
122 Ga0068860_101276136 3300005843 Bacteria 755
123 Ga0068860_101867001 3300005843 Bacteria 622
124 Ga0068862_100011125 3300005844 Bacteria 7429
125 Ga0068862_100028997 3300005844 Bacteria 4662
126 Ga0070717_10654324 3300006028 Bacteria 954
127 Ga0070715_10208691 3300006163 Bacteria 997
128 Ga0070715_10415062 3300006163 Bacteria 752
129 Ga0070716_100186898 3300006173 Bacteria 1365
130 Ga0097621_102389135 3300006237 Bacteria 506
131 Ga0068871_101248947 3300006358 Unclassified 698
132 Ga0068871_101999124 3300006358 Bacteria 552
133 Ga0075428_100125276 3300006844 Bacteria 2796
134 Ga0075428_100420100 3300006844 Bacteria 1433
135 Ga0075428_100678836 3300006844 Bacteria 1098
136 Ga0075431_100122693 3300006847 Bacteria 2681
137 Ga0075431_100202446 3300006847 Bacteria 2031
138 Ga0075431_102012846 3300006847 Bacteria 533
139 Ga0075433_11487936 3300006852 Bacteria 585
140 Ga0075434_100026948 3300006871 Bacteria 5638
141 Ga0075434_100135417 3300006871 Bacteria 2483
142 Ga0075434_101903075 3300006871 Bacteria 601
143 Ga0075429_101332836 3300006880 Bacteria 626
144 Ga0068865_100023035 3300006881 Bacteria 4072
145 Ga0068865_100058276 3300006881 Bacteria 2697
146 Ga0068865_100534963 3300006881 Unclassified 982
147 Ga0068865_101096494 3300006881 Bacteria 701
148 Ga0075436_100081306 3300006914 Bacteria 2246
149 Ga0075436_100487354 3300006914 Bacteria 901
150 Ga0097620_100006963 3300006931 Bacteria 11476
151 Ga0097620_100172977 3300006931 Bacteria 2241
152 Ga0097620_100214694 3300006931 Bacteria 2011
153 Ga0097620_100242345 3300006931 Bacteria 1892
154 Ga0097620_100393953 3300006931 Bacteria 1481
155 Ga0097620_100412572 3300006931 Bacteria 1446
156 Ga0097620_100685612 3300006931 Bacteria 1116
157 Ga0097620_100713330 3300006931 Bacteria 1093
158 Ga0075435_100120870 3300007076 Bacteria 2186
159 Ga0075435_100526248 3300007076 Bacteria 1023
160 Ga0075435_101395859 3300007076 Bacteria 614
161 Ga0111539_10004336 3300009094 Bacteria 18565
162 Ga0111539_12038931 3300009094 Bacteria 665
163 Ga0105247_10006122 3300009101 Bacteria 7473
164 Ga0105247_10014304 3300009101 Bacteria 4764
165 Ga0105247_10018254 3300009101 Bacteria 4209
166 Ga0105247_11114564 3300009101 Bacteria 623
167 Ga0114129_10081540 3300009147 Bacteria 4497
168 Ga0114129_10467632 3300009147 Bacteria 1652
169 Ga0114129_10469071 3300009147 Bacteria 1649
170 Ga0114129_12176557 3300009147 Bacteria 668
171 Ga0114129_12459625 3300009147 Bacteria 623
172 Ga0105243_10067546 3300009148 Bacteria 2878
173 Ga0105243_10423552 3300009148 Bacteria 1242
174 Ga0105243_11834026 3300009148 Bacteria 638
175 Ga0105243_11885678 3300009148 Bacteria 630
176 Ga0105243_12693691 3300009148 Bacteria 537
177 Ga0105241_11321663 3300009174 Bacteria 687
178 Ga0105242_10027117 3300009176 Bacteria 4546
179 Ga0105242_10145124 3300009176 Bacteria 2064
180 Ga0105242_10986845 3300009176 Unclassified 849
181 Ga0105248_10012200 3300009177 Bacteria 9479
182 Ga0105248_10401427 3300009177 Bacteria 1543
183 Ga0105248_10470132 3300009177 Bacteria 1417
184 Ga0105248_10986651 3300009177 Bacteria 951
185 Ga0105248_11081583 3300009177 Bacteria 906
186 Ga0105237_10416764 3300009545 Bacteria 1348
187 Ga0105237_10911108 3300009545 Bacteria 886
188 Ga0105237_11820714 3300009545 Bacteria 616
189 Ga0105249_10002620 3300009553 Bacteria 15579
190 Ga0105249_10461499 3300009553 Unclassified 1310
191 Ga0105249_10511859 3300009553 Bacteria 1247
192 Ga0105246_10145306 3300011119 Bacteria 1789
193 Ga0105246_10358872 3300011119 Bacteria 1197
194 Ga0105246_10702542 3300011119 Bacteria 886
195 Ga0157314_1059505 3300012500 Bacteria 509
196 Ga0157371_10340340 3300013102 Bacteria 1091
197 Ga0157371_10921473 3300013102 Bacteria 663
198 Ga0157378_10067080 3300013297 Bacteria 3214
199 Ga0157378_10930474 3300013297 Bacteria 901
200 Ga0157378_12662213 3300013297 Bacteria 553
201 Ga0163162_10053165 3300013306 Bacteria 4070
202 Ga0163162_10172599 3300013306 Bacteria 2287
203 Ga0163162_10192218 3300013306 Unclassified 2169
204 Ga0163162_10883335 3300013306 Bacteria 1008
205 Ga0163162_12809625 3300013306 Bacteria 560
206 Ga0157372_10373640 3300013307 Bacteria 1661
207 Ga0157372_11662258 3300013307 Bacteria 735
208 Ga0157375_10017620 3300013308 Bacteria 6450
209 Ga0157375_10030935 3300013308 Bacteria 5053
210 Ga0157375_10077778 3300013308 Bacteria 3349
211 Ga0157375_10108459 3300013308 Bacteria 2871
212 Ga0157375_10276443 3300013308 Bacteria 1842
213 Ga0157375_10392377 3300013308 Bacteria 1555
214 Ga0157375_10442397 3300013308 Bacteria 1465
215 Ga0163163_10067080 3300014325 Bacteria 3566
216 Ga0163163_10238884 3300014325 Bacteria 1866
217 Ga0157380_10054957 3300014326 Bacteria 3161
218 Ga0157380_11978964 3300014326 Bacteria 644
219 Ga0157379_10436334 3300014968 Bacteria 1207
220 Ga0157379_10860588 3300014968 Bacteria 858
221 Ga0157379_11020937 3300014968 Bacteria 789
222 Ga0157376_10314407 3300014969 Bacteria 1487
223 Ga0163161_10079866 3300017792 Bacteria 2406
224 Ga0163161_10183527 3300017792 Bacteria 1605
225 Ga0206354_10844215 3300020081 Bacteria 615
226 Ga0228598_1091250 3300024227 Unclassified 613
227 Ga0207697_10017836 3300025315 Bacteria 2914
228 Ga0207697_10109548 3300025315 Bacteria 1182
229 Ga0207697_10376461 3300025315 Bacteria 630
230 Ga0207682_10006591 3300025893 Bacteria 4672
231 Ga0207642_10397336 3300025899 Bacteria 824
232 Ga0207710_10218698 3300025900 Bacteria 945
233 Ga0207688_10201343 3300025901 Bacteria 1194
234 Ga0207685_10154327 3300025905 Bacteria 1042
235 Ga0207645_10051113 3300025907 Bacteria 2640
236 Ga0207645_10986479 3300025907 Bacteria 571
237 Ga0207645_11048278 3300025907 Bacteria 551
238 Ga0207643_10010205 3300025908 Bacteria 5052
239 Ga0207643_10023577 3300025908 Bacteria 3393
240 Ga0207684_10107531 3300025910 Bacteria 2386
241 Ga0207684_10716461 3300025910 Unclassified 849
242 Ga0207684_11443800 3300025910 Bacteria 562
243 Ga0207671_10962668 3300025914 Bacteria 673
244 Ga0207663_10622261 3300025916 Bacteria 850
245 Ga0207660_10669856 3300025917 Bacteria 846
246 Ga0207662_10004310 3300025918 Bacteria 7468
247 Ga0207662_10065909 3300025918 Bacteria 2181
248 Ga0207657_10696409 3300025919 Unclassified 789
249 Ga0207649_10273155 3300025920 Bacteria 1226
250 Ga0207646_10000842 3300025922 Bacteria 39742
251 Ga0207646_10151015 3300025922 Bacteria 2095
252 Ga0207646_10651934 3300025922 Bacteria 943
253 Ga0207646_11674838 3300025922 Bacteria 547
254 Ga0207681_10006946 3300025923 Bacteria 6943
255 Ga0207681_10506210 3300025923 Unclassified 989
256 Ga0207681_10593931 3300025923 Bacteria 914
257 Ga0207650_11760282 3300025925 Bacteria 525
258 Ga0207659_10035603 3300025926 Bacteria 3442
259 Ga0207659_10201327 3300025926 Bacteria 1590
260 Ga0207700_10018760 3300025928 Bacteria 4657
261 Ga0207644_10237480 3300025931 Bacteria 1450
262 Ga0207644_11846020 3300025931 Bacteria 505
263 Ga0207690_10488221 3300025932 Bacteria 995
264 Ga0207690_10585932 3300025932 Bacteria 909
265 Ga0207706_10006808 3300025933 Bacteria 10569
266 Ga0207706_10083589 3300025933 Bacteria 2806
267 Ga0207686_10077438 3300025934 Bacteria 2159
268 Ga0207709_10249321 3300025935 Bacteria 1296
269 Ga0207709_11088331 3300025935 Bacteria 656
270 Ga0207670_10273252 3300025936 Bacteria 1314
271 Ga0207670_10917406 3300025936 Bacteria 734
272 Ga0207669_10190667 3300025937 Bacteria 1478
273 Ga0207704_10085758 3300025938 Bacteria 2051
274 Ga0207704_10131258 3300025938 Bacteria 1735
275 Ga0207704_10431076 3300025938 Unclassified 1048
276 Ga0207704_11392619 3300025938 Bacteria 601
277 Ga0207665_10048352 3300025939 Bacteria 2855
278 Ga0207691_10014340 3300025940 Bacteria 7556
279 Ga0207691_10040503 3300025940 Bacteria 4303
280 Ga0207691_10097418 3300025940 Unclassified 2629
281 Ga0207711_10085716 3300025941 Bacteria 2760
282 Ga0207711_10666311 3300025941 Bacteria 971
283 Ga0207689_10064949 3300025942 Bacteria 3002
284 Ga0207689_10124449 3300025942 Bacteria 2121
285 Ga0207661_10054385 3300025944 Bacteria 3207
286 Ga0207679_10127542 3300025945 Bacteria 2036
287 Ga0207679_10146422 3300025945 Bacteria 1916
288 Ga0207679_11205907 3300025945 Bacteria 695
289 Ga0207651_10529602 3300025960 Bacteria 1022
290 Ga0207651_10544038 3300025960 Bacteria 1009
291 Ga0207651_11034939 3300025960 Bacteria 734
292 Ga0207712_10165116 3300025961 Bacteria 1725
293 Ga0207712_10269113 3300025961 Bacteria 1385
294 Ga0207712_10507248 3300025961 Bacteria 1032
295 Ga0207712_11188522 3300025961 Bacteria 680
296 Ga0207668_10056228 3300025972 Bacteria 2739
297 Ga0207668_10347269 3300025972 Bacteria 1239
298 Ga0207640_12039143 3300025981 Unclassified 520
299 Ga0207658_10650264 3300025986 Bacteria 950
300 Ga0207658_10700340 3300025986 Bacteria 915
301 Ga0207658_10945672 3300025986 Bacteria 785
302 Ga0207658_11393928 3300025986 Bacteria 641
303 Ga0207677_10897502 3300026023 Bacteria 799
304 Ga0207677_11293837 3300026023 Bacteria 669
305 Ga0207703_10588205 3300026035 Bacteria 1052
306 Ga0207678_10313459 3300026067 Bacteria 1349
307 Ga0207678_10698285 3300026067 Bacteria 893
308 Ga0207708_10174079 3300026075 Bacteria 1706
309 Ga0207708_10221634 3300026075 Bacteria 1515
310 Ga0207708_10386681 3300026075 Bacteria 1155
311 Ga0207708_10517985 3300026075 Bacteria 1002
312 Ga0207641_11934866 3300026088 Bacteria 591
313 Ga0207648_10008279 3300026089 Bacteria 10098
314 Ga0207648_10047708 3300026089 Bacteria 3753
315 Ga0207648_10810347 3300026089 Unclassified 872
316 Ga0207676_10179515 3300026095 Bacteria 1852
317 Ga0207676_10188508 3300026095 Bacteria 1813
318 Ga0207676_10973951 3300026095 Unclassified 835
319 Ga0207674_10081942 3300026116 Bacteria 3228
320 Ga0207674_10471323 3300026116 Bacteria 1213
321 Ga0207674_10958102 3300026116 Bacteria 824
322 Ga0207675_100188067 3300026118 Bacteria 1980
323 Ga0207675_100476503 3300026118 Bacteria 1240
324 Ga0207698_10685241 3300026142 Bacteria 1018
325 Ga0207428_10198673 3300027907 Bacteria 1509
326 Ga0268266_10000349 3300028379 Bacteria 71878
327 Ga0268266_10234013 3300028379 Bacteria 1693
328 Ga0268265_10061189 3300028380 Bacteria 2889
329 Ga0268265_10424593 3300028380 Unclassified 1235
330 Ga0268265_10639653 3300028380 Bacteria 1021
331 Ga0268265_10743525 3300028380 Bacteria 951
332 Ga0268265_11140175 3300028380 Bacteria 775
333 Ga0268264_10126508 3300028381 Bacteria 2259
334 Ga0268264_10172201 3300028381 Bacteria 1959
335 Ga0268264_10298941 3300028381 Bacteria 1514
336 Ga0268264_10896875 3300028381 Bacteria 890
337 Ga0265770_1002734 3300030878 Bacteria 2396
338 Ga0265316_10416475 3300031344 Unclassified 966
339 Ga0307513_10466849 3300031456 Bacteria 984
340 Ga0307408_101319749 3300031548 Bacteria 677
341 Ga0307408_102381313 3300031548 Bacteria 514
342 Ga0307413_10390795 3300031824 Bacteria 1087
343 Ga0307407_10609708 3300031903 Bacteria 814
344 Ga0307412_10248514 3300031911 Bacteria 1380
345 Ga0307416_100802481 3300032002 Bacteria 1037
346 Ga0307414_12161699 3300032004 Bacteria 520
347 Ga0373938_0162414 3300034957 Bacteria 601
348 Ga0373929_0091684 3300035085 Bacteria 755
349 Ga0373931_0037101 3300035691 Bacteria 2544
350 Ga0373931_0995914 3300035691 Bacteria 567
351 Ga0395900_0291367 3300037418 Bacteria 1621
352 Ga0395898_0142220 3300037466 Bacteria 2297
353 Ga0395905_0024848 3300037471 Bacteria 5654
354 Ga0395901_0886496 3300038443 Bacteria 875
355 Ga0439445_0103723 3300042004 Bacteria 808
356 Ga0450890_051850 3300042127 Bacteria 627
357 Ga0453683_0319478 3300044673 Bacteria 995
358 Ga0453683_0598765 3300044673 Bacteria 719
359 Ga0451576_0555173 3300045051 Bacteria 1207
360 Ga0451576_1304693 3300045051 Bacteria 757
361 Ga0495592_0489379 3300046454 Bacteria 765
362 Ga0495653_0291718 3300046463 Bacteria 1067
363 Ga0495664_0175486 3300046477 Bacteria 1300
364 Ga0495585_0614120 3300046492 Bacteria 511
365 Ga0495608_0445758 3300046511 Bacteria 788
366 Ga0495628_0074163 3300046516 Bacteria 2651
367 Ga0495632_0510420 3300046519 Bacteria 518
368 Ga0495652_0224175 3300046529 Bacteria 1411
369 Ga0495587_0164695 3300046536 Bacteria 1261
370 Ga0495598_0205983 3300046537 Bacteria 712
371 Ga0495621_0493354 3300046539 Bacteria 528
372 Ga0495656_0104935 3300046615 Unclassified 1313
373 Ga0495668_0454832 3300046616 Bacteria 705
374 Ga0495599_0399093 3300046678 Bacteria 819
375 Ga0495623_0045128 3300046679 Bacteria 2800
376 Ga0495669_0179287 3300046684 Bacteria 1010
377 Ga0495669_0509195 3300046684 Bacteria 585
378 Ga0495600_0769924 3300046809 Bacteria 575
379 Ga0495604_0155462 3300047317 Bacteria 1620
380 Ga0495604_0214927 3300047317 Bacteria 1327
381 Ga0495674_1398297 3300047319 Bacteria 522
382 Ga0495672_0002220 3300047320 Bacteria 18058
383 Ga0495672_0264657 3300047320 Bacteria 828
384 Ga0495675_0019548 3300047444 Bacteria 4303
385 Ga0495602_0237583 3300048088 Bacteria 1365
386 Ga0495602_0335456 3300048088 Unclassified 1095
387 Ga0496100_0145917 3300048903 Bacteria 1683
388 Ga0496100_1591316 3300048903 Bacteria 516
389 Ga0496106_0218393 3300048909 Bacteria 1520
390 Ga0496106_0340776 3300048909 Bacteria 1204
391 Ga0496107_0243942 3300048910 Bacteria 1337
392 Ga0496107_0779481 3300048910 Bacteria 701
393 Ga0496112_1422108 3300048915 Bacteria 608
394 Ga0496113_1488956 3300048916 Bacteria 523
395 Ga0496114_0530589 3300048917 Bacteria 1041
396 Ga0496115_0933249 3300048918 Bacteria 667
397 Ga0501042_0774846 3300049578 Bacteria 698
398 Ga0501067_0098283 3300049583 Bacteria 1626
399 Ga0501074_0217809 3300049590 Bacteria 1360
400 Ga0501081_0231415 3300049743 Bacteria 1346
401 nmdc:mga03n38_297957_c1 3300050490 Bacteria 865
402 nmdc:mga03n38_552060_c1 3300050490 Bacteria 652
403 nmdc:mga00v17_141512_c1 3300050491 Bacteria 1543
404 nmdc:mga0yw44_276989_c1 3300050492 Bacteria 1121
405 nmdc:mga0k408_152499_c1 3300050493 Bacteria 1376
406 nmdc:mga0k408_24542_c2 3300050493 Bacteria 3224
407 nmdc:mga06z11_3392_c1 3300050494 Bacteria 6161
408 nmdc:mga06z11_45024_c1 3300050494 Bacteria 2229
409 nmdc:mga04h51_107784_c1 3300050495 Bacteria 1023
410 nmdc:mga05p37_158810_c1 3300050507 Bacteria 2762
411 nmdc:mga05p37_508910_c1 3300050507 Bacteria 1380
412 nmdc:mga09592_118268_c1 3300050508 Bacteria 2275
413 nmdc:mga09592_1407037_c1 3300050508 Bacteria 570
414 nmdc:mga0qj67_123628_c1 3300050509 Bacteria 2093
415 nmdc:mga0qj67_1294756_c1 3300050509 Bacteria 565
416 nmdc:mga0qj67_352729_c1 3300050509 Bacteria 1189
417 nmdc:mga0qj67_975712_c1 3300050509 Bacteria 665
418 nmdc:mga06r32_33321_c1 3300050510 Bacteria 4852
419 nmdc:mga06r32_37859_c1 3300050510 Bacteria 4564
420 nmdc:mga06r32_413474_c1 3300050510 Bacteria 1330
421 nmdc:mga08y16_190306_c1 3300050511 Bacteria 2128
422 nmdc:mga08y16_411200_c1 3300050511 Bacteria 1384
423 nmdc:mga0n895_135426_c1 3300050512 Bacteria 2490
424 nmdc:mga0n895_2169936_c1 3300050512 Bacteria 511
425 nmdc:mga0n895_54912_c1 3300050512 Bacteria 3919
426 nmdc:mga0rr50_324256_c1 3300050513 Bacteria 1292
427 nmdc:mga08x19_36381_c1 3300050514 Bacteria 2206
428 nmdc:mga0a205_78428_c1 3300050515 Bacteria 3191
429 Ga0495655_0196560 3300053083 Unclassified 657
430 Ga0495619_0025087 3300053085 Bacteria 3826
431 Ga0500568_0001735 3300053139 Bacteria 13517

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006880 Ga0075429_101332836 Ga0075429_1013328362 76
2 3300009147 Ga0114129_12459625 Ga0114129_124596251 76
3 3300050508 nmdc:mga09592_1407037_c1 nmdc:mga09592_1407037_c1_137_367 76
4 3300005578 Ga0068854_101426231 Ga0068854_1014262312 77
5 3300009148 Ga0105243_11834026 Ga0105243_118340262 77
6 3300025961 Ga0207712_11188522 Ga0207712_111885221 77
7 3300037418 Ga0395900_0291367 Ga0395900_0291367_1223_1459 77
8 3300037466 Ga0395898_0142220 Ga0395898_0142220_1311_1547 77
9 3300037471 Ga0395905_0024848 Ga0395905_0024848_3270_3506 77
10 3300038443 Ga0395901_0886496 Ga0395901_0886496_503_739 77
11 3300005336 Ga0070680_100016281 Ga0070680_1000162813 78
12 3300005471 Ga0070698_100538071 Ga0070698_1005380711 78
13 3300005577 Ga0068857_101643341 Ga0068857_1016433412 78
14 3300006173 Ga0070716_100186898 Ga0070716_1001868981 78
15 3300013306 Ga0163162_12809625 Ga0163162_128096252 78
16 3300025917 Ga0207660_10669856 Ga0207660_106698561 78
17 3300030878 Ga0265770_1002734 Ga0265770_10027344 78
18 3300031456 Ga0307513_10466849 Ga0307513_104668492 78
19 3300031548 Ga0307408_101319749 Ga0307408_1013197492 78
20 3300032002 Ga0307416_100802481 Ga0307416_1008024812 78
21 3300042004 Ga0439445_0103723 Ga0439445_0103723_140_436 78
22 3300046454 Ga0495592_0489379 Ga0495592_0489379_13_267 78
23 3300046463 Ga0495653_0291718 Ga0495653_0291718_645_899 78
24 3300046477 Ga0495664_0175486 Ga0495664_0175486_144_398 78
25 3300046516 Ga0495628_0074163 Ga0495628_0074163_1930_2184 78
26 3300046529 Ga0495652_0224175 Ga0495652_0224175_1091_1345 78
27 3300046536 Ga0495587_0164695 Ga0495587_0164695_749_1003 78
28 3300046678 Ga0495599_0399093 Ga0495599_0399093_282_536 78
29 3300046809 Ga0495600_0769924 Ga0495600_0769924_221_475 78
30 3300047317 Ga0495604_0155462 Ga0495604_0155462_1205_1459 78
31 3300048088 Ga0495602_0237583 Ga0495602_0237583_266_520 78
32 3300049578 Ga0501042_0774846 Ga0501042_0774846_173_409 78
33 3300049590 Ga0501074_0217809 Ga0501074_0217809_538_774 78
34 3300049743 Ga0501081_0231415 Ga0501081_0231415_561_797 78
35 3300053085 Ga0495619_0025087 Ga0495619_0025087_1161_1415 78
36 3300009147 Ga0114129_10469071 Ga0114129_104690711 81
37 3300005330 Ga0070690_100360084 Ga0070690_1003600843 82
38 3300005333 Ga0070677_10034085 Ga0070677_100340853 82
39 3300005334 Ga0068869_100203102 Ga0068869_1002031022 82
40 3300005347 Ga0070668_100342438 Ga0070668_1003424382 82
41 3300005353 Ga0070669_100037069 Ga0070669_1000370695 82
42 3300005354 Ga0070675_100019377 Ga0070675_1000193776 82
43 3300005356 Ga0070674_100141697 Ga0070674_1001416972 82
44 3300005367 Ga0070667_100813283 Ga0070667_1008132832 82
45 3300005434 Ga0070709_10007481 Ga0070709_100074814 82
46 3300005436 Ga0070713_100902472 Ga0070713_1009024722 82
47 3300005441 Ga0070700_100260886 Ga0070700_1002608861 82
48 3300005455 Ga0070663_100293956 Ga0070663_1002939561 82
49 3300005457 Ga0070662_100134733 Ga0070662_1001347332 82
50 3300005459 Ga0068867_100068330 Ga0068867_1000683303 82
51 3300005468 Ga0070707_101585713 Ga0070707_1015857132 82
52 3300005543 Ga0070672_100006462 Ga0070672_1000064623 82
53 3300005546 Ga0070696_100793113 Ga0070696_1007931131 82
54 3300005548 Ga0070665_100065440 Ga0070665_1000654403 82
55 3300005564 Ga0070664_100878183 Ga0070664_1008781832 82
56 3300005616 Ga0068852_101089467 Ga0068852_1010894673 82
57 3300005617 Ga0068859_100393962 Ga0068859_1003939623 82
58 3300005618 Ga0068864_100121185 Ga0068864_1001211853 82
59 3300005719 Ga0068861_100512371 Ga0068861_1005123712 82
60 3300005840 Ga0068870_10003108 Ga0068870_100031083 82
61 3300005842 Ga0068858_100900183 Ga0068858_1009001832 82
62 3300005843 Ga0068860_100103253 Ga0068860_1001032533 82
63 3300006881 Ga0068865_100058276 Ga0068865_1000582764 82
64 3300006931 Ga0097620_100393953 Ga0097620_1003939533 82
65 3300007076 Ga0075435_101395859 Ga0075435_1013958592 82
66 3300009101 Ga0105247_10006122 Ga0105247_100061225 82
67 3300009101 Ga0105247_10014304 Ga0105247_100143042 82
68 3300009101 Ga0105247_10018254 Ga0105247_100182543 82
69 3300009101 Ga0105247_11114564 Ga0105247_111145642 82
70 3300009147 Ga0114129_10467632 Ga0114129_104676324 82
71 3300009148 Ga0105243_10423552 Ga0105243_104235522 82
72 3300009176 Ga0105242_10027117 Ga0105242_100271171 82
73 3300009177 Ga0105248_10470132 Ga0105248_104701321 82
74 3300009177 Ga0105248_10986651 Ga0105248_109866511 82
75 3300009177 Ga0105248_11081583 Ga0105248_110815832 82
76 3300009545 Ga0105237_10416764 Ga0105237_104167642 82
77 3300009545 Ga0105237_11820714 Ga0105237_118207142 82
78 3300011119 Ga0105246_10358872 Ga0105246_103588722 82
79 3300011119 Ga0105246_10702542 Ga0105246_107025422 82
80 3300013297 Ga0157378_12662213 Ga0157378_126622132 82
81 3300013306 Ga0163162_10053165 Ga0163162_100531653 82
82 3300013307 Ga0157372_11662258 Ga0157372_116622581 82
83 3300013308 Ga0157375_10017620 Ga0157375_100176206 82
84 3300013308 Ga0157375_10108459 Ga0157375_101084592 82
85 3300013308 Ga0157375_10276443 Ga0157375_102764433 82
86 3300013308 Ga0157375_10442397 Ga0157375_104423972 82
87 3300014325 Ga0163163_10067080 Ga0163163_100670802 82
88 3300014325 Ga0163163_10238884 Ga0163163_102388843 82
89 3300014326 Ga0157380_10054957 Ga0157380_100549575 82
90 3300014326 Ga0157380_11978964 Ga0157380_119789642 82
91 3300014968 Ga0157379_10860588 Ga0157379_108605882 82
92 3300014969 Ga0157376_10314407 Ga0157376_103144073 82
93 3300017792 Ga0163161_10183527 Ga0163161_101835272 82
94 3300025315 Ga0207697_10017836 Ga0207697_100178362 82
95 3300025893 Ga0207682_10006591 Ga0207682_100065914 82
96 3300025908 Ga0207643_10023577 Ga0207643_100235772 82
97 3300025923 Ga0207681_10593931 Ga0207681_105939311 82
98 3300025926 Ga0207659_10201327 Ga0207659_102013272 82
99 3300025933 Ga0207706_10006808 Ga0207706_100068082 82
100 3300025935 Ga0207709_11088331 Ga0207709_110883312 82
101 3300025937 Ga0207669_10190667 Ga0207669_101906673 82
102 3300025938 Ga0207704_10131258 Ga0207704_101312583 82
103 3300025940 Ga0207691_10014340 Ga0207691_100143407 82
104 3300025942 Ga0207689_10124449 Ga0207689_101244493 82
105 3300025945 Ga0207679_11205907 Ga0207679_112059071 82
106 3300025961 Ga0207712_10269113 Ga0207712_102691132 82
107 3300025961 Ga0207712_10507248 Ga0207712_105072482 82
108 3300025972 Ga0207668_10056228 Ga0207668_100562285 82
109 3300025986 Ga0207658_11393928 Ga0207658_113939282 82
110 3300026023 Ga0207677_10897502 Ga0207677_108975021 82
111 3300026035 Ga0207703_10588205 Ga0207703_105882052 82
112 3300026067 Ga0207678_10313459 Ga0207678_103134593 82
113 3300026075 Ga0207708_10174079 Ga0207708_101740793 82
114 3300026089 Ga0207648_10047708 Ga0207648_100477085 82
115 3300026095 Ga0207676_10179515 Ga0207676_101795153 82
116 3300027907 Ga0207428_10198673 Ga0207428_101986732 82
117 3300028379 Ga0268266_10234013 Ga0268266_102340131 82
118 3300028381 Ga0268264_10172201 Ga0268264_101722013 82
119 3300031344 Ga0265316_10416475 Ga0265316_104164752 82
120 3300035691 Ga0373931_0037101 Ga0373931_0037101_1269_1535 82
121 3300035691 Ga0373931_0995914 Ga0373931_0995914_22_270 82
122 3300044673 Ga0453683_0319478 Ga0453683_0319478_526_792 82
123 3300044673 Ga0453683_0598765 Ga0453683_0598765_14_262 82
124 3300045051 Ga0451576_0555173 Ga0451576_0555173_673_939 82
125 3300045051 Ga0451576_1304693 Ga0451576_1304693_98_364 82
126 3300046492 Ga0495585_0614120 Ga0495585_0614120_40_306 82
127 3300046519 Ga0495632_0510420 Ga0495632_0510420_29_277 82
128 3300046539 Ga0495621_0493354 Ga0495621_0493354_116_364 82
129 3300046615 Ga0495656_0104935 Ga0495656_0104935_15_281 82
130 3300046616 Ga0495668_0454832 Ga0495668_0454832_340_588 82
131 3300046684 Ga0495669_0179287 Ga0495669_0179287_65_313 82
132 3300047320 Ga0495672_0002220 Ga0495672_0002220_4602_4850 82
133 3300048903 Ga0496100_0145917 Ga0496100_0145917_1122_1388 82
134 3300048910 Ga0496107_0243942 Ga0496107_0243942_113_379 82
135 3300048918 Ga0496115_0933249 Ga0496115_0933249_367_633 82
136 3300050490 nmdc:mga03n38_552060_c1 nmdc:mga03n38_552060_c1_82_333 82
137 3300050492 nmdc:mga0yw44_276989_c1 nmdc:mga0yw44_276989_c1_634_885 82
138 3300050493 nmdc:mga0k408_24542_c2 nmdc:mga0k408_24542_c2_137_388 82
139 3300050494 nmdc:mga06z11_45024_c1 nmdc:mga06z11_45024_c1_242_493 82
140 3300050495 nmdc:mga04h51_107784_c1 nmdc:mga04h51_107784_c1_207_458 82
141 3300050507 nmdc:mga05p37_508910_c1 nmdc:mga05p37_508910_c1_777_1025 82
142 3300050508 nmdc:mga09592_118268_c1 nmdc:mga09592_118268_c1_1988_2239 82
143 3300050509 nmdc:mga0qj67_123628_c1 nmdc:mga0qj67_123628_c1_877_1128 82
144 3300050509 nmdc:mga0qj67_975712_c1 nmdc:mga0qj67_975712_c1_170_421 82
145 3300050510 nmdc:mga06r32_33321_c1 nmdc:mga06r32_33321_c1_227_475 82
146 3300050511 nmdc:mga08y16_190306_c1 nmdc:mga08y16_190306_c1_702_950 82
147 3300050511 nmdc:mga08y16_411200_c1 nmdc:mga08y16_411200_c1_963_1214 82
148 3300050512 nmdc:mga0n895_135426_c1 nmdc:mga0n895_135426_c1_86_334 82
149 3300050512 nmdc:mga0n895_2169936_c1 nmdc:mga0n895_2169936_c1_74_325 82
150 3300050513 nmdc:mga0rr50_324256_c1 nmdc:mga0rr50_324256_c1_904_1152 82
151 3300050515 nmdc:mga0a205_78428_c1 nmdc:mga0a205_78428_c1_2276_2524 82
152 3300005295 Ga0065707_10009744 Ga0065707_100097443 83
153 3300005336 Ga0070680_100613773 Ga0070680_1006137732 83
154 3300005339 Ga0070660_100744506 Ga0070660_1007445062 83
155 3300005344 Ga0070661_101172234 Ga0070661_1011722342 83
156 3300005345 Ga0070692_10726604 Ga0070692_107266042 83
157 3300005353 Ga0070669_100001517 Ga0070669_1000015177 83
158 3300005441 Ga0070700_101725241 Ga0070700_1017252411 83
159 3300005549 Ga0070704_100895417 Ga0070704_1008954171 83
160 3300005577 Ga0068857_100510396 Ga0068857_1005103962 83
161 3300006237 Ga0097621_102389135 Ga0097621_1023891352 83
162 3300009094 Ga0111539_10004336 Ga0111539_1000433611 83
163 3300009174 Ga0105241_11321663 Ga0105241_113216632 83
164 3300009553 Ga0105249_10002620 Ga0105249_100026203 83
165 3300011119 Ga0105246_10145306 Ga0105246_101453062 83
166 3300013307 Ga0157372_10373640 Ga0157372_103736402 83
167 3300025907 Ga0207645_11048278 Ga0207645_110482782 83
168 3300025981 Ga0207640_12039143 Ga0207640_120391432 83
169 3300005293 Ga0065715_10010044 Ga0065715_100100442 84
170 3300005293 Ga0065715_10354639 Ga0065715_103546393 84
171 3300005329 Ga0070683_100478965 Ga0070683_1004789652 84
172 3300005329 Ga0070683_101397961 Ga0070683_1013979612 84
173 3300005330 Ga0070690_101652762 Ga0070690_1016527621 84
174 3300005334 Ga0068869_100177077 Ga0068869_1001770773 84
175 3300005336 Ga0070680_101486635 Ga0070680_1014866351 84
176 3300005338 Ga0068868_102154038 Ga0068868_1021540382 84
177 3300005339 Ga0070660_100903103 Ga0070660_1009031031 84
178 3300005340 Ga0070689_100024526 Ga0070689_1000245262 84
179 3300005340 Ga0070689_100053155 Ga0070689_1000531553 84
180 3300005340 Ga0070689_100845027 Ga0070689_1008450272 84
181 3300005343 Ga0070687_100008757 Ga0070687_1000087574 84
182 3300005344 Ga0070661_101880695 Ga0070661_1018806952 84
183 3300005345 Ga0070692_10027118 Ga0070692_100271183 84
184 3300005347 Ga0070668_100000901 Ga0070668_10000090120 84
185 3300005353 Ga0070669_100006688 Ga0070669_1000066886 84
186 3300005354 Ga0070675_100035597 Ga0070675_1000355973 84
187 3300005355 Ga0070671_101082274 Ga0070671_1010822741 84
188 3300005364 Ga0070673_100002357 Ga0070673_1000023573 84
189 3300005364 Ga0070673_100011640 Ga0070673_1000116404 84
190 3300005364 Ga0070673_100136489 Ga0070673_1001364892 84
191 3300005364 Ga0070673_100506269 Ga0070673_1005062692 84
192 3300005365 Ga0070688_100038148 Ga0070688_1000381483 84
193 3300005366 Ga0070659_100253521 Ga0070659_1002535212 84
194 3300005366 Ga0070659_101937732 Ga0070659_1019377321 84
195 3300005367 Ga0070667_100015933 Ga0070667_1000159337 84
196 3300005367 Ga0070667_100017907 Ga0070667_1000179078 84
197 3300005367 Ga0070667_100097287 Ga0070667_1000972873 84
198 3300005367 Ga0070667_100361231 Ga0070667_1003612312 84
199 3300005434 Ga0070709_11023382 Ga0070709_110233822 84
200 3300005438 Ga0070701_10026312 Ga0070701_100263123 84
201 3300005438 Ga0070701_10135132 Ga0070701_101351323 84
202 3300005441 Ga0070700_100315086 Ga0070700_1003150862 84
203 3300005444 Ga0070694_100109541 Ga0070694_1001095412 84
204 3300005444 Ga0070694_100822515 Ga0070694_1008225152 84
205 3300005445 Ga0070708_100019039 Ga0070708_1000190394 84
206 3300005445 Ga0070708_100020656 Ga0070708_1000206563 84
207 3300005457 Ga0070662_100072126 Ga0070662_1000721265 84
208 3300005457 Ga0070662_100089162 Ga0070662_1000891623 84
209 3300005459 Ga0068867_100002077 Ga0068867_1000020777 84
210 3300005466 Ga0070685_10023322 Ga0070685_100233223 84
211 3300005466 Ga0070685_11209084 Ga0070685_112090842 84
212 3300005467 Ga0070706_100076086 Ga0070706_1000760863 84
213 3300005467 Ga0070706_102070628 Ga0070706_1020706281 84
214 3300005468 Ga0070707_100003322 Ga0070707_1000033229 84
215 3300005468 Ga0070707_100394647 Ga0070707_1003946471 84
216 3300005471 Ga0070698_100017740 Ga0070698_1000177404 84
217 3300005471 Ga0070698_100051405 Ga0070698_1000514053 84
218 3300005471 Ga0070698_101848906 Ga0070698_1018489061 84
219 3300005518 Ga0070699_100344596 Ga0070699_1003445963 84
220 3300005535 Ga0070684_100623161 Ga0070684_1006231612 84
221 3300005536 Ga0070697_100000970 Ga0070697_1000009703 84
222 3300005536 Ga0070697_100436095 Ga0070697_1004360951 84
223 3300005543 Ga0070672_100007061 Ga0070672_1000070618 84
224 3300005543 Ga0070672_100027146 Ga0070672_1000271463 84
225 3300005546 Ga0070696_100146175 Ga0070696_1001461753 84
226 3300005548 Ga0070665_100000646 Ga0070665_10000064623 84
227 3300005549 Ga0070704_100122084 Ga0070704_1001220842 84
228 3300005549 Ga0070704_100142972 Ga0070704_1001429723 84
229 3300005563 Ga0068855_100818103 Ga0068855_1008181033 84
230 3300005564 Ga0070664_100105405 Ga0070664_1001054053 84
231 3300005564 Ga0070664_100232268 Ga0070664_1002322682 84
232 3300005564 Ga0070664_101597806 Ga0070664_1015978062 84
233 3300005577 Ga0068857_100063804 Ga0068857_1000638043 84
234 3300005577 Ga0068857_101037902 Ga0068857_1010379022 84
235 3300005616 Ga0068852_100310473 Ga0068852_1003104734 84
236 3300005617 Ga0068859_100006963 Ga0068859_10000696311 84
237 3300005617 Ga0068859_100172984 Ga0068859_1001729842 84
238 3300005617 Ga0068859_100214689 Ga0068859_1002146892 84
239 3300005617 Ga0068859_100242360 Ga0068859_1002423601 84
240 3300005617 Ga0068859_100412571 Ga0068859_1004125712 84
241 3300005617 Ga0068859_100685572 Ga0068859_1006855722 84
242 3300005618 Ga0068864_100983469 Ga0068864_1009834693 84
243 3300005719 Ga0068861_100364628 Ga0068861_1003646281 84
244 3300005719 Ga0068861_101936516 Ga0068861_1019365162 84
245 3300005840 Ga0068870_10006645 Ga0068870_100066452 84
246 3300005841 Ga0068863_101042040 Ga0068863_1010420402 84
247 3300005842 Ga0068858_100009514 Ga0068858_1000095147 84
248 3300005842 Ga0068858_100127049 Ga0068858_1001270495 84
249 3300005842 Ga0068858_100203027 Ga0068858_1002030272 84
250 3300005843 Ga0068860_100080681 Ga0068860_1000806813 84
251 3300005843 Ga0068860_101276136 Ga0068860_1012761362 84
252 3300005843 Ga0068860_101867001 Ga0068860_1018670012 84
253 3300005844 Ga0068862_100011125 Ga0068862_1000111252 84
254 3300005844 Ga0068862_100028997 Ga0068862_1000289972 84
255 3300006028 Ga0070717_10654324 Ga0070717_106543242 84
256 3300006163 Ga0070715_10208691 Ga0070715_102086912 84
257 3300006163 Ga0070715_10415062 Ga0070715_104150622 84
258 3300006358 Ga0068871_101248947 Ga0068871_1012489472 84
259 3300006358 Ga0068871_101999124 Ga0068871_1019991242 84
260 3300006844 Ga0075428_100125276 Ga0075428_1001252764 84
261 3300006844 Ga0075428_100420100 Ga0075428_1004201002 84
262 3300006844 Ga0075428_100678836 Ga0075428_1006788361 84
263 3300006847 Ga0075431_100122693 Ga0075431_1001226933 84
264 3300006847 Ga0075431_100202446 Ga0075431_1002024463 84
265 3300006847 Ga0075431_102012846 Ga0075431_1020128462 84
266 3300006852 Ga0075433_11487936 Ga0075433_114879362 84
267 3300006871 Ga0075434_100026948 Ga0075434_1000269481 84
268 3300006871 Ga0075434_100135417 Ga0075434_1001354174 84
269 3300006871 Ga0075434_101903075 Ga0075434_1019030752 84
270 3300006881 Ga0068865_100023035 Ga0068865_1000230357 84
271 3300006881 Ga0068865_100534963 Ga0068865_1005349632 84
272 3300006881 Ga0068865_101096494 Ga0068865_1010964942 84
273 3300006914 Ga0075436_100081306 Ga0075436_1000813062 84
274 3300006914 Ga0075436_100487354 Ga0075436_1004873541 84
275 3300006931 Ga0097620_100006963 Ga0097620_10000696311 84
276 3300006931 Ga0097620_100172977 Ga0097620_1001729772 84
277 3300006931 Ga0097620_100214694 Ga0097620_1002146942 84
278 3300006931 Ga0097620_100242345 Ga0097620_1002423453 84
279 3300006931 Ga0097620_100412572 Ga0097620_1004125722 84
280 3300006931 Ga0097620_100685612 Ga0097620_1006856122 84
281 3300006931 Ga0097620_100713330 Ga0097620_1007133302 84
282 3300007076 Ga0075435_100120870 Ga0075435_1001208703 84
283 3300007076 Ga0075435_100526248 Ga0075435_1005262483 84
284 3300009094 Ga0111539_12038931 Ga0111539_120389312 84
285 3300009147 Ga0114129_10081540 Ga0114129_100815403 84
286 3300009147 Ga0114129_12176557 Ga0114129_121765571 84
287 3300009148 Ga0105243_10067546 Ga0105243_100675465 84
288 3300009148 Ga0105243_11885678 Ga0105243_118856781 84
289 3300009148 Ga0105243_12693691 Ga0105243_126936912 84
290 3300009176 Ga0105242_10145124 Ga0105242_101451243 84
291 3300009176 Ga0105242_10986845 Ga0105242_109868452 84
292 3300009177 Ga0105248_10012200 Ga0105248_100122002 84
293 3300009177 Ga0105248_10401427 Ga0105248_104014272 84
294 3300009545 Ga0105237_10911108 Ga0105237_109111082 84
295 3300009553 Ga0105249_10461499 Ga0105249_104614993 84
296 3300009553 Ga0105249_10511859 Ga0105249_105118591 84
297 3300012500 Ga0157314_1059505 Ga0157314_10595051 84
298 3300013102 Ga0157371_10340340 Ga0157371_103403402 84
299 3300013102 Ga0157371_10921473 Ga0157371_109214732 84
300 3300013297 Ga0157378_10067080 Ga0157378_100670802 84
301 3300013297 Ga0157378_10930474 Ga0157378_109304742 84
302 3300013306 Ga0163162_10172599 Ga0163162_101725993 84
303 3300013306 Ga0163162_10192218 Ga0163162_101922182 84
304 3300013306 Ga0163162_10883335 Ga0163162_108833352 84
305 3300013308 Ga0157375_10030935 Ga0157375_100309353 84
306 3300013308 Ga0157375_10077778 Ga0157375_100777786 84
307 3300013308 Ga0157375_10392377 Ga0157375_103923772 84
308 3300014968 Ga0157379_10436334 Ga0157379_104363342 84
309 3300014968 Ga0157379_11020937 Ga0157379_110209372 84
310 3300017792 Ga0163161_10079866 Ga0163161_100798664 84
311 3300020081 Ga0206354_10844215 Ga0206354_108442151 84
312 3300024227 Ga0228598_1091250 Ga0228598_10912501 84
313 3300025315 Ga0207697_10109548 Ga0207697_101095483 84
314 3300025315 Ga0207697_10376461 Ga0207697_103764612 84
315 3300025899 Ga0207642_10397336 Ga0207642_103973362 84
316 3300025900 Ga0207710_10218698 Ga0207710_102186982 84
317 3300025901 Ga0207688_10201343 Ga0207688_102013433 84
318 3300025905 Ga0207685_10154327 Ga0207685_101543272 84
319 3300025907 Ga0207645_10051113 Ga0207645_100511131 84
320 3300025907 Ga0207645_10986479 Ga0207645_109864792 84
321 3300025908 Ga0207643_10010205 Ga0207643_100102054 84
322 3300025910 Ga0207684_10107531 Ga0207684_101075312 84
323 3300025910 Ga0207684_10716461 Ga0207684_107164611 84
324 3300025910 Ga0207684_11443800 Ga0207684_114438002 84
325 3300025914 Ga0207671_10962668 Ga0207671_109626682 84
326 3300025916 Ga0207663_10622261 Ga0207663_106222612 84
327 3300025918 Ga0207662_10004310 Ga0207662_100043106 84
328 3300025918 Ga0207662_10065909 Ga0207662_100659092 84
329 3300025919 Ga0207657_10696409 Ga0207657_106964092 84
330 3300025920 Ga0207649_10273155 Ga0207649_102731552 84
331 3300025922 Ga0207646_10000842 Ga0207646_100008425 84
332 3300025922 Ga0207646_10151015 Ga0207646_101510152 84
333 3300025922 Ga0207646_10651934 Ga0207646_106519342 84
334 3300025922 Ga0207646_11674838 Ga0207646_116748382 84
335 3300025923 Ga0207681_10006946 Ga0207681_100069465 84
336 3300025923 Ga0207681_10506210 Ga0207681_105062102 84
337 3300025925 Ga0207650_11760282 Ga0207650_117602822 84
338 3300025926 Ga0207659_10035603 Ga0207659_100356033 84
339 3300025928 Ga0207700_10018760 Ga0207700_100187604 84
340 3300025931 Ga0207644_10237480 Ga0207644_102374802 84
341 3300025931 Ga0207644_11846020 Ga0207644_118460201 84
342 3300025932 Ga0207690_10488221 Ga0207690_104882212 84
343 3300025932 Ga0207690_10585932 Ga0207690_105859322 84
344 3300025933 Ga0207706_10083589 Ga0207706_100835893 84
345 3300025934 Ga0207686_10077438 Ga0207686_100774383 84
346 3300025935 Ga0207709_10249321 Ga0207709_102493213 84
347 3300025936 Ga0207670_10273252 Ga0207670_102732522 84
348 3300025936 Ga0207670_10917406 Ga0207670_109174062 84
349 3300025938 Ga0207704_10085758 Ga0207704_100857582 84
350 3300025938 Ga0207704_10431076 Ga0207704_104310762 84
351 3300025938 Ga0207704_11392619 Ga0207704_113926192 84
352 3300025939 Ga0207665_10048352 Ga0207665_100483522 84
353 3300025940 Ga0207691_10040503 Ga0207691_100405033 84
354 3300025940 Ga0207691_10097418 Ga0207691_100974183 84
355 3300025941 Ga0207711_10085716 Ga0207711_100857162 84
356 3300025941 Ga0207711_10666311 Ga0207711_106663113 84
357 3300025942 Ga0207689_10064949 Ga0207689_100649495 84
358 3300025944 Ga0207661_10054385 Ga0207661_100543853 84
359 3300025945 Ga0207679_10127542 Ga0207679_101275422 84
360 3300025945 Ga0207679_10146422 Ga0207679_101464222 84
361 3300025960 Ga0207651_10529602 Ga0207651_105296021 84
362 3300025960 Ga0207651_10544038 Ga0207651_105440382 84
363 3300025960 Ga0207651_11034939 Ga0207651_110349392 84
364 3300025961 Ga0207712_10165116 Ga0207712_101651163 84
365 3300025972 Ga0207668_10347269 Ga0207668_103472692 84
366 3300025986 Ga0207658_10650264 Ga0207658_106502642 84
367 3300025986 Ga0207658_10700340 Ga0207658_107003402 84
368 3300025986 Ga0207658_10945672 Ga0207658_109456721 84
369 3300026023 Ga0207677_11293837 Ga0207677_112938372 84
370 3300026067 Ga0207678_10698285 Ga0207678_106982852 84
371 3300026075 Ga0207708_10221634 Ga0207708_102216342 84
372 3300026075 Ga0207708_10386681 Ga0207708_103866812 84
373 3300026075 Ga0207708_10517985 Ga0207708_105179851 84
374 3300026088 Ga0207641_11934866 Ga0207641_119348661 84
375 3300026089 Ga0207648_10008279 Ga0207648_1000827910 84
376 3300026089 Ga0207648_10810347 Ga0207648_108103472 84
377 3300026095 Ga0207676_10188508 Ga0207676_101885082 84
378 3300026095 Ga0207676_10973951 Ga0207676_109739512 84
379 3300026116 Ga0207674_10081942 Ga0207674_100819421 84
380 3300026116 Ga0207674_10471323 Ga0207674_104713231 84
381 3300026116 Ga0207674_10958102 Ga0207674_109581022 84
382 3300026118 Ga0207675_100188067 Ga0207675_1001880673 84
383 3300026118 Ga0207675_100476503 Ga0207675_1004765032 84
384 3300026142 Ga0207698_10685241 Ga0207698_106852412 84
385 3300028379 Ga0268266_10000349 Ga0268266_1000034944 84
386 3300028380 Ga0268265_10061189 Ga0268265_100611893 84
387 3300028380 Ga0268265_10424593 Ga0268265_104245932 84
388 3300028380 Ga0268265_10639653 Ga0268265_106396531 84
389 3300028380 Ga0268265_10743525 Ga0268265_107435253 84
390 3300028380 Ga0268265_11140175 Ga0268265_111401751 84
391 3300028381 Ga0268264_10126508 Ga0268264_101265085 84
392 3300028381 Ga0268264_10298941 Ga0268264_102989413 84
393 3300028381 Ga0268264_10896875 Ga0268264_108968753 84
394 3300031548 Ga0307408_102381313 Ga0307408_1023813132 84
395 3300031824 Ga0307413_10390795 Ga0307413_103907953 84
396 3300031903 Ga0307407_10609708 Ga0307407_106097082 84
397 3300031911 Ga0307412_10248514 Ga0307412_102485142 84
398 3300032004 Ga0307414_12161699 Ga0307414_121616991 84
399 3300034957 Ga0373938_0162414 Ga0373938_0162414_238_522 84
400 3300035085 Ga0373929_0091684 Ga0373929_0091684_324_608 84
401 3300042127 Ga0450890_051850 Ga0450890_051850_184_438 84
402 3300046511 Ga0495608_0445758 Ga0495608_0445758_469_753 84
403 3300046537 Ga0495598_0205983 Ga0495598_0205983_394_678 84
404 3300046679 Ga0495623_0045128 Ga0495623_0045128_2226_2510 84
405 3300046684 Ga0495669_0509195 Ga0495669_0509195_221_505 84
406 3300047317 Ga0495604_0214927 Ga0495604_0214927_559_843 84
407 3300047319 Ga0495674_1398297 Ga0495674_1398297_209_463 84
408 3300047320 Ga0495672_0264657 Ga0495672_0264657_400_714 84
409 3300047444 Ga0495675_0019548 Ga0495675_0019548_1488_1772 84
410 3300048088 Ga0495602_0335456 Ga0495602_0335456_421_705 84
411 3300048903 Ga0496100_1591316 Ga0496100_1591316_156_440 84
412 3300048909 Ga0496106_0218393 Ga0496106_0218393_534_818 84
413 3300048909 Ga0496106_0340776 Ga0496106_0340776_267_551 84
414 3300048910 Ga0496107_0779481 Ga0496107_0779481_27_311 84
415 3300048915 Ga0496112_1422108 Ga0496112_1422108_173_427 84
416 3300048916 Ga0496113_1488956 Ga0496113_1488956_129_413 84
417 3300048917 Ga0496114_0530589 Ga0496114_0530589_90_374 84
418 3300049583 Ga0501067_0098283 Ga0501067_0098283_1319_1576 84
419 3300050490 nmdc:mga03n38_297957_c1 nmdc:mga03n38_297957_c1_315_629 84
420 3300050491 nmdc:mga00v17_141512_c1 nmdc:mga00v17_141512_c1_281_595 84
421 3300050493 nmdc:mga0k408_152499_c1 nmdc:mga0k408_152499_c1_191_505 84
422 3300050494 nmdc:mga06z11_3392_c1 nmdc:mga06z11_3392_c1_3036_3350 84
423 3300050507 nmdc:mga05p37_158810_c1 nmdc:mga05p37_158810_c1_2126_2392 84
424 3300050509 nmdc:mga0qj67_1294756_c1 nmdc:mga0qj67_1294756_c1_32_322 84
425 3300050509 nmdc:mga0qj67_352729_c1 nmdc:mga0qj67_352729_c1_714_986 84
426 3300050510 nmdc:mga06r32_37859_c1 nmdc:mga06r32_37859_c1_3446_3736 84
427 3300050510 nmdc:mga06r32_413474_c1 nmdc:mga06r32_413474_c1_973_1230 84
428 3300050512 nmdc:mga0n895_54912_c1 nmdc:mga0n895_54912_c1_1165_1437 84
429 3300050514 nmdc:mga08x19_36381_c1 nmdc:mga08x19_36381_c1_618_890 84
430 3300053083 Ga0495655_0196560 Ga0495655_0196560_332_634 84
431 3300053139 Ga0500568_0001735 Ga0500568_0001735_4099_4413 84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8592 14 78
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.828 6 78
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.801 4 78
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.7844 4 81
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.7637 4 78
ID Description Score Start End Superfamily
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8558 14 80 1.20.1290.10
af_P47148_92_275_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8073 17 75 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8065 4 79 1.20.1290.10
3c1lA02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7997 4 79 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.7548 4 80 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7Y2JRC2-F1-model_v4 Peroxidase 0.9921 23 81 GO:0004601
AF-A0A317HBX9-F1-model_v4 Peroxidase 0.9886 20 82
AF-A0A3E0NWF6-F1-model_v4 Peroxidase 0.9859 27 82
AF-A0A536PHN8-F1-model_v4 Peroxidase 0.9772 28 80 GO:0004601
AF-A0A524MHH9-F1-model_v4 Peroxidase 0.9678 25 83

Feature Viewer

pLDDT pTM Quality
92.26 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map