metagRoot

F442424

General Info

Members	Datasets	Scaffolds	Average Seq Length
431	332	343	415

Family's Representative Sequence

Representative Sequence	3300041452\|Ga0451793_0140971\|Ga0451793_0140971_1431_2843
Length	470
Sequence	MQALCQTACHVSIIDTKRLVFDTWQLFVHIIGSQLAVRHALPFNPSTCTHPVNNTFSAPAALQVDGARLWQSLMDLARIGATPKGGVRRIALTDEDRHGRDLVLRWFHEAGMAVRIDEVGNVFARRAGTDPAARAVATGSHIDTQPSGGKFDGNFGVLAGLEVVRTLNDHGIRTRAPIEVAFWTNEEGTRFTPVMMGSGAFAGVFDTARILGEKDLAGLTVGDELERIGYRGTQACGEVPGGMFAAYFEAHIEQGPVLEAQGLPIGVVQGALGQQWYDVTVTGMDAHAGPTPMGLRHDAMLGTARMVEAVNRIALAEAPDGRGTVGFVQVMPNSRNVVPGEVRFSVDFRHAQQAGLDRMDAAMRREFAAIADAGRLQVAIAQVVKFDPCAFDAACVGSVRRAAEALGLPCMDIVSGAGHDAVYVARVAPTGMIFVPCKDGISHNEIEDARPEHIAAGANVLLHAMLDRAT

Samples

	Sample ID	Description	Type	Environment
1	2511231221	Azospirillum lipoferum 4B	Isolate	Rhizosphere
2	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
3	2524023250	Niveispirillum irakense DSM 11586	Isolate	Unclassified
4	2554235234	Klebsiella michiganensis SA2	Isolate	Unclassified
5	2585428058	Methylibium sp. CF468	Isolate	Rhizosphere
6	2585428062	Methylibium sp. CF059	Isolate	Rhizosphere
7	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
8	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
9	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
10	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
11	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
12	2600255256	Enterobacter sp. NFIX08	Isolate	Rhizoplane
13	2600255257	Enterobacter sp. NFIX03	Isolate	Rhizoplane
14	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
15	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
16	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
17	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
18	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
19	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
20	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
21	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
22	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
23	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
24	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
25	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
26	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
27	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
28	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
29	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
30	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
31	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
32	2600255310	Enterobacter sp. NFIX06	Isolate	Rhizoplane
33	2600255311	Enterobacter sp. NFIX04	Isolate	Rhizoplane
34	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
35	2602042046	Enterobacter sp. NFIX09	Isolate	Rhizoplane
36	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
37	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
38	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
39	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
40	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
41	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
42	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
43	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
44	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
45	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
46	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
47	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
48	2609459761	Enterobacter sp. NFR05	Isolate	Rhizoplane
49	2636415599	Klebsiella variicola DX120E	Isolate	Unclassified
50	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
51	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
52	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
53	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
54	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
55	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
56	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
57	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
58	2775507074	Klebsiella sp. D5A	Isolate	Unclassified
59	2811995292	Kosakonia oryzae Ola 51	Isolate	Unclassified
60	2814123068	Kosakonia radicincitans GXGL-4A	Isolate	Rhizosphere
61	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
62	2842718218	Acidovorax sp. R-73343	Isolate	Unclassified
63	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
64	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
65	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
66	2881412998	Achromobacter aloeverae AVA-1	Isolate	Unclassified
67	2894023352	Diaphorobacter ruginosibacter DSM 27467	Isolate	Nodule
68	2897803580	Azospirillum doebereinerae GSF71	Isolate	Unclassified
69	2904513164	Klebsiella variicola 1431	Isolate	Rhizosphere
70	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
71	2919704043	Hydrogenophaga palleronii 4249	Isolate	Unclassified
72	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
73	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
74	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
75	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
76	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
77	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
78	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
79	2945874760	Phytobacter diazotrophicus UAEU22	Isolate	Rhizosphere
80	2969079654	Klebsiella variicola E57-7	Isolate	Unclassified
81	2971820967	Klebsiella sp. MPUS7	Isolate	Rhizosphere
82	2984559226	Klebsiella variicola SORGH_AS834	Isolate	Aerial Root
83	2984595703	Klebsiella variicola SORGH_AS1070	Isolate	Aerial Root
84	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
85	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
86	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
87	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
88	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
89	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
90	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
91	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
92	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
93	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
94	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
95	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
96	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
97	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
98	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
99	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
100	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
101	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
102	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
103	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
104	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
105	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
106	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
107	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
108	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
109	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
110	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
111	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
112	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
113	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
114	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
115	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
116	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
117	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
118	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
119	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
120	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
121	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
122	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
123	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
124	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
125	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
126	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
127	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
128	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
129	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
130	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
131	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
132	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
133	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
134	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
135	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
136	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
137	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
138	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
139	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
140	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
141	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
142	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
143	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
144	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
145	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
146	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
147	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
148	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
149	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
150	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
151	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
152	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
153	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
154	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
155	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
156	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
157	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
158	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
159	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
160	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
161	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
162	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
163	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
164	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
165	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
167	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
169	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
172	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
212	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
215	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
218	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
219	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
220	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
221	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
222	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
223	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
224	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
225	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
226	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
227	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
228	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
229	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
230	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
231	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
232	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
233	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
234	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
235	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
236	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
237	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
238	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
239	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
240	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
241	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
242	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
243	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
244	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
245	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
246	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
247	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
248	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
249	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
250	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
251	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
252	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
253	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
254	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
255	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
256	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
257	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
258	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
259	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
260	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
261	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
262	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
263	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
264	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
265	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
266	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
267	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
268	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
269	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
270	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
271	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
272	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
273	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
274	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
275	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
276	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
277	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
278	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
279	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
280	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
281	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
282	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
283	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
284	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
285	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
286	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
287	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
288	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
289	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
290	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
291	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
292	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
293	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
294	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
295	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
296	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
297	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
298	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
299	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
300	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
301	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
302	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
303	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
304	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
305	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
306	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
307	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
308	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
309	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
310	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
311	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
312	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
313	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
314	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
315	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
316	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
317	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
318	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
319	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
320	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
321	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
322	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
323	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
324	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
325	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
326	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
327	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
328	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
329	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
330	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
331	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
332	8054002106	Azospirillum lipoferum 59b	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	79.58
Metatranscriptomes	0.23
Isolates	20.19

Biome Distribution

Category	Percentage (%)
Aerial Root	0.46
Bulb	0
Endosphere	10.9
Nodule	3.25
Rhizoplane	10.9
Rhizosphere	60.79
Stem	0
Stem Tuber	0
Unclassified	13.69

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10001709	3300001989	Bacteria	8353
2	JGI25151J46595_10001932	3300003187	Bacteria	13142
3	JGI25151J46595_10002905	3300003187	Bacteria	9816
4	JGI25151J46595_10034452	3300003187	Bacteria	1936
5	JGI25406J46586_10001764	3300003203	Bacteria	10181
6	JGI25153J46596_10000684	3300003215	Bacteria	20715
7	Ga0055526_1006854	3300003771	Bacteria	6076
8	Ga0055537_1003773	3300003773	Bacteria	4555
9	Ga0055524_1003401	3300003775	Bacteria	7738
10	Ga0055536_1000034	3300003781	Bacteria	148178
11	Ga0055534_1001422	3300003784	Bacteria	9523
12	Ga0058692_1000108	3300003856	Bacteria	55254
13	JGI25405J52794_10013623	3300003911	Bacteria	1580
14	Ga0065715_10106051	3300005293	Bacteria	2854
15	Ga0070658_10016730	3300005327	Bacteria	5870
16	Ga0070676_10068255	3300005328	Bacteria	2128
17	Ga0070683_100000478	3300005329	Bacteria	28190
18	Ga0070683_100110795	3300005329	Bacteria	2589
19	Ga0070680_100002618	3300005336	Bacteria	13321
20	Ga0070682_100024534	3300005337	Bacteria	3590
21	Ga0070660_100006631	3300005339	Bacteria	8031
22	Ga0070661_100080032	3300005344	Bacteria	2411
23	Ga0070661_100097769	3300005344	Bacteria	2180
24	Ga0070669_100046086	3300005353	Bacteria	3179
25	Ga0070674_100085026	3300005356	Bacteria	2270
26	Ga0070659_100088802	3300005366	Bacteria	2476
27	Ga0070659_100200047	3300005366	Bacteria	1644
28	Ga0070714_100019649	3300005435	Bacteria	5507
29	Ga0070711_100037057	3300005439	Bacteria	3271
30	Ga0070700_100033650	3300005441	Bacteria	3089
31	Ga0070663_100011883	3300005455	Bacteria	5488
32	Ga0070663_100157687	3300005455	Bacteria	1745
33	Ga0070678_100012397	3300005456	Bacteria	5296
34	Ga0070678_100063501	3300005456	Bacteria	2733
35	Ga0070662_100267943	3300005457	Bacteria	1378
36	Ga0068867_100021641	3300005459	Bacteria	4589
37	Ga0070706_100007365	3300005467	Bacteria	10323
38	Ga0070707_100042160	3300005468	Bacteria	4369
39	Ga0070698_100247939	3300005471	Bacteria	1714
40	Ga0070679_100002618	3300005530	Bacteria	16368
41	Ga0070679_100096726	3300005530	Bacteria	2940
42	Ga0070684_100008117	3300005535	Bacteria	8194
43	Ga0070684_100037919	3300005535	Bacteria	4137
44	Ga0068853_100008744	3300005539	Bacteria	8146
45	Ga0070672_100031215	3300005543	Bacteria	4009
46	Ga0070693_100100757	3300005547	Bacteria	1759
47	Ga0070665_100270719	3300005548	Bacteria	1700
48	Ga0070664_100028326	3300005564	Bacteria	4659
49	Ga0070664_100030322	3300005564	Bacteria	4511
50	Ga0070664_100158554	3300005564	Bacteria	2001
51	Ga0068857_100038184	3300005577	Bacteria	4253
52	Ga0068854_100006135	3300005578	Bacteria	7627
53	Ga0068856_100057020	3300005614	Bacteria	3856
54	Ga0068852_100011894	3300005616	Bacteria	6581
55	Ga0068852_100092611	3300005616	Bacteria	2707
56	Ga0068861_100000302	3300005719	Bacteria	27656
57	Ga0068858_100187854	3300005842	Bacteria	1952
58	Ga0068860_100002702	3300005843	Bacteria	18453
59	Ga0068860_100182654	3300005843	Bacteria	2027
60	Ga0068862_100001956	3300005844	Bacteria	18681
61	Ga0081455_10001847	3300005937	Bacteria	25497
62	Ga0081538_10034297	3300005981	Bacteria	3357
63	Ga0081539_10000190	3300005985	Bacteria	142511
64	Ga0075364_10037279	3300006051	Bacteria	3147
65	Ga0075366_10000238	3300006195	Bacteria	24452
66	Ga0075370_10001096	3300006353	Bacteria	11299
67	Ga0075370_10009580	3300006353	Bacteria	5037
68	Ga0075428_100029395	3300006844	Bacteria	6081
69	Ga0075433_10269466	3300006852	Bacteria	1509
70	Ga0075434_100197228	3300006871	Bacteria	2033
71	Ga0068865_100020258	3300006881	Bacteria	4313
72	Ga0105251_10000082	3300009011	Bacteria	90513
73	Ga0105251_10002629	3300009011	Bacteria	13855
74	Ga0105251_10005818	3300009011	Bacteria	7991
75	Ga0105244_10001958	3300009036	Bacteria	15960
76	Ga0105244_10011055	3300009036	Bacteria	5438
77	Ga0105250_10000035	3300009092	Bacteria	153410
78	Ga0105240_10009582	3300009093	Bacteria	13712
79	Ga0105240_10014731	3300009093	Bacteria	10667
80	Ga0105240_10267399	3300009093	Bacteria	1970
81	Ga0111539_10000263	3300009094	Bacteria	62668
82	Ga0111539_10283143	3300009094	Bacteria	1929
83	Ga0105245_10064340	3300009098	Bacteria	3314
84	Ga0105245_10237950	3300009098	Bacteria	1763
85	Ga0105243_10011881	3300009148	Bacteria	6585
86	Ga0105243_10035117	3300009148	Bacteria	3886
87	Ga0105243_10096554	3300009148	Bacteria	2445
88	Ga0105241_10006345	3300009174	Bacteria	8716
89	Ga0105237_10000523	3300009545	Bacteria	54108
90	Ga0105237_10030226	3300009545	Bacteria	5505
91	Ga0105237_10034428	3300009545	Bacteria	5128
92	Ga0105238_10003659	3300009551	Bacteria	15328
93	Ga0105238_10022814	3300009551	Bacteria	6379
94	Ga0105238_10029835	3300009551	Bacteria	5555
95	Ga0105238_10151751	3300009551	Bacteria	2292
96	Ga0105249_10016619	3300009553	Bacteria	6532
97	Ga0105239_10007336	3300010375	Bacteria	12660
98	Ga0105239_10121293	3300010375	Bacteria	2904
99	Ga0157371_10087444	3300013102	Bacteria	2207
100	Ga0157370_10013510	3300013104	Bacteria	8407
101	Ga0157370_10112046	3300013104	Bacteria	2550
102	Ga0157369_10003951	3300013105	Bacteria	17588
103	Ga0157378_10005771	3300013297	Bacteria	10843
104	Ga0157378_10134173	3300013297	Bacteria	2294
105	Ga0163162_10000408	3300013306	Bacteria	39422
106	Ga0157372_10005263	3300013307	Bacteria	13740
107	Ga0157372_10085969	3300013307	Bacteria	3568
108	Ga0157379_10135076	3300014968	Bacteria	2222
109	Ga0157379_10168721	3300014968	Bacteria	1976
110	Ga0157376_10195213	3300014969	Bacteria	1859
111	Ga0157376_10346725	3300014969	Bacteria	1420
112	Ga0183361_10014	3300016635	Bacteria	171033
113	Ga0163161_10015073	3300017792	Bacteria	5388
114	Ga0213876_10000158	3300021384	Bacteria	70972
115	Ga0213876_10112312	3300021384	Bacteria	1446
116	Ga0209148_1000810	3300025254	Bacteria	22663
117	Ga0209565_1000066	3300025263	Bacteria	173062
118	Ga0209455_1001167	3300025272	Bacteria	12638
119	Ga0209675_1000084	3300025291	Bacteria	152066
120	Ga0209675_1003857	3300025291	Bacteria	6898
121	Ga0209675_1009187	3300025291	Bacteria	3517
122	Ga0209676_1000014	3300025292	Bacteria	793514
123	Ga0209676_1015169	3300025292	Bacteria	2851
124	Ga0209025_1000323	3300025294	Bacteria	106442
125	Ga0209025_1001111	3300025294	Bacteria	38546
126	Ga0209564_1000182	3300025295	Bacteria	150744
127	Ga0209564_1000679	3300025295	Bacteria	50214
128	Ga0209564_1001054	3300025295	Bacteria	33611
129	Ga0209758_1000207	3300025297	Bacteria	129217
130	Ga0209758_1000279	3300025297	Bacteria	101326
131	Ga0209050_1005549	3300025298	Bacteria	7865
132	Ga0209256_1000272	3300025299	Bacteria	90458
133	Ga0209256_1004709	3300025299	Bacteria	8359
134	Ga0209051_1005905	3300025303	Bacteria	7027
135	Ga0209257_1000297	3300025304	Bacteria	109481
136	Ga0207696_1000007	3300025711	Bacteria	578417
137	Ga0207713_1000005	3300025735	Bacteria	649958
138	Ga0207713_1000006	3300025735	Bacteria	586163
139	Ga0207699_10080696	3300025906	Bacteria	2016
140	Ga0207645_10067930	3300025907	Bacteria	2278
141	Ga0207705_10034303	3300025909	Bacteria	3627
142	Ga0207684_10025678	3300025910	Bacteria	5020
143	Ga0207707_10002398	3300025912	Bacteria	16865
144	Ga0207671_10004041	3300025914	Bacteria	14229
145	Ga0207660_10012740	3300025917	Bacteria	5505
146	Ga0207657_10000807	3300025919	Bacteria	33086
147	Ga0207657_10022992	3300025919	Bacteria	5816
148	Ga0207652_10038051	3300025921	Bacteria	4075
149	Ga0207681_10037092	3300025923	Bacteria	3220
150	Ga0207694_10015432	3300025924	Bacteria	5761
151	Ga0207644_10058823	3300025931	Bacteria	2779
152	Ga0207706_10287467	3300025933	Bacteria	1433
153	Ga0207669_10031919	3300025937	Bacteria	2950
154	Ga0207704_10010799	3300025938	Bacteria	4469
155	Ga0207691_10018064	3300025940	Bacteria	6679
156	Ga0207689_10053033	3300025942	Bacteria	3341
157	Ga0207661_10006452	3300025944	Bacteria	8293
158	Ga0207679_10012002	3300025945	Bacteria	5631
159	Ga0207679_10163564	3300025945	Bacteria	1824
160	Ga0207667_10007487	3300025949	Bacteria	13107
161	Ga0207640_10015209	3300025981	Bacteria	4450
162	Ga0207703_10150793	3300026035	Bacteria	2027
163	Ga0207703_10176450	3300026035	Bacteria	1883
164	Ga0207639_10186979	3300026041	Bacteria	1767
165	Ga0207678_10014919	3300026067	Bacteria	6835
166	Ga0207678_10054737	3300026067	Bacteria	3436
167	Ga0207708_10040907	3300026075	Bacteria	3535
168	Ga0207702_10206227	3300026078	Bacteria	1825
169	Ga0207648_10002057	3300026089	Bacteria	21925
170	Ga0207674_10020564	3300026116	Bacteria	7126
171	Ga0207675_100001959	3300026118	Bacteria	20579
172	Ga0207683_10010332	3300026121	Bacteria	7961
173	Ga0207698_10046850	3300026142	Bacteria	3269
174	Ga0207698_10127525	3300026142	Bacteria	2167
175	Ga0209371_1000234	3300027312	Bacteria	70154
176	Ga0209371_1000933	3300027312	Bacteria	22908
177	Ga0209371_1020102	3300027312	Bacteria	1651
178	Ga0209282_1000290	3300027666	Bacteria	24803
179	Ga0209971_1002632	3300027682	Bacteria	4300
180	Ga0209974_10009040	3300027876	Bacteria	3387
181	Ga0207428_10000110	3300027907	Bacteria	111885
182	Ga0207428_10000788	3300027907	Bacteria	35918
183	Ga0268265_10045596	3300028380	Bacteria	3272
184	Ga0268265_10190296	3300028380	Bacteria	1771
185	Ga0268264_10091274	3300028381	Bacteria	2627
186	Ga0307515_10000020	3300028794	Bacteria	411735
187	Ga0307515_10000051	3300028794	Bacteria	272100
188	Ga0307515_10000053	3300028794	Bacteria	266512
189	Ga0307515_10000305	3300028794	Bacteria	121634
190	Ga0307515_10040493	3300028794	Bacteria	7364
191	Ga0268256_1000076	3300030500	Bacteria	178295
192	Ga0307512_10041660	3300030522	Bacteria	3814
193	Ga0265760_10021141	3300031090	Bacteria	1881
194	Ga0265332_10000015	3300031238	Bacteria	243944
195	Ga0265328_10023563	3300031239	Bacteria	2335
196	Ga0265325_10041441	3300031241	Bacteria	2413
197	Ga0265340_10030435	3300031247	Bacteria	2705
198	Ga0265339_10022619	3300031249	Bacteria	3641
199	Ga0265331_10004242	3300031250	Bacteria	8973
200	Ga0265316_10172287	3300031344	Bacteria	1614
201	Ga0307513_10010920	3300031456	Bacteria	11341
202	Ga0307513_10032072	3300031456	Bacteria	5933
203	Ga0307509_10104406	3300031507	Bacteria	2859
204	Ga0307408_100015222	3300031548	Bacteria	5121
205	Ga0265313_10000267	3300031595	Bacteria	57016
206	Ga0265313_10037295	3300031595	Bacteria	2432
207	Ga0307508_10000072	3300031616	Bacteria	118449
208	Ga0307514_10030299	3300031649	Bacteria	4344
209	Ga0316575_10037190	3300031665	Unclassified	1917
210	Ga0265314_10030980	3300031711	Bacteria	3953
211	Ga0265342_10014957	3300031712	Bacteria	5128
212	Ga0316576_10051305	3300031727	Unclassified	3002
213	Ga0316576_10054046	3300031727	Bacteria	2928
214	Ga0316578_10082249	3300031728	Bacteria	1917
215	Ga0307516_10010499	3300031730	Bacteria	10170
216	Ga0307405_10008516	3300031731	Bacteria	5206
217	Ga0316577_10032447	3300031733	Bacteria	2918
218	Ga0316577_10069032	3300031733	Bacteria	1974
219	Ga0316577_10092503	3300031733	Unclassified	1693
220	Ga0307410_10021032	3300031852	Bacteria	4005
221	Ga0307410_10105302	3300031852	Bacteria	2030
222	Ga0307407_10005959	3300031903	Bacteria	5357
223	Ga0307409_100007250	3300031995	Bacteria	6612
224	Ga0307409_100135302	3300031995	Bacteria	2114
225	Ga0307416_100174484	3300032002	Bacteria	2006
226	Ga0307414_10016627	3300032004	Bacteria	4478
227	Ga0307415_100010680	3300032126	Bacteria	5212
228	Ga0316583_10021702	3300032133	Bacteria	2302
229	Ga0373940_0031458	3300035088	Bacteria	1417
230	Ga0316574_0000192	3300035398	Bacteria	21097
231	Ga0373927_0021896	3300035695	Bacteria	4189
232	Ga0316582_0006872	3300036647	Bacteria	6015
233	Ga0316582_0060125	3300036647	Bacteria	2435
234	Ga0316582_0077861	3300036647	Bacteria	2159
235	Ga0316584_0049041	3300036712	Bacteria	3156
236	Ga0316584_0057495	3300036712	Bacteria	2911
237	Ga0373925_0028031	3300037068	Bacteria	4124
238	Ga0395900_0086538	3300037418	Bacteria	3221
239	Ga0395905_0016413	3300037471	Bacteria	7038
240	Ga0395905_0024128	3300037471	Bacteria	5740
241	Ga0316581_0003692	3300037588	Unclassified	3834
242	Ga0395901_0023288	3300038443	Bacteria	6349
243	Ga0395901_0151147	3300038443	Bacteria	2440
244	Ga0400483_030850	3300039062	Bacteria	2813
245	Ga0400483_127369	3300039062	Bacteria	22770
246	Ga0400483_180553	3300039062	Bacteria	39429
247	Ga0400483_188821	3300039062	Bacteria	15768
248	Ga0400489_74640	3300039093	Bacteria	23158
249	Ga0436365_0117120	3300039437	Bacteria	67592
250	Ga0436365_0164804	3300039437	Bacteria	5931
251	Ga0451793_0140971	3300041452	Bacteria	4560
252	Ga0451795_0503610	3300041456	Bacteria	2937
253	Ga0451800_0755824	3300041459	Bacteria	1496
254	Ga0450911_000706	3300042115	Bacteria	9777
255	Ga0451577_0000093	3300042876	Bacteria	196838
256	Ga0451577_0063535	3300042876	Bacteria	3292
257	Ga0453683_0018281	3300044673	Bacteria	4501
258	Ga0453684_0008831	3300044712	Bacteria	17871
259	Ga0453684_0016246	3300044712	Bacteria	11660
260	Ga0495638_0070012	3300046460	Bacteria	2149
261	Ga0495605_0013101	3300046474	Bacteria	4581
262	Ga0495596_0000024	3300046500	Bacteria	108222
263	Ga0495610_0002206	3300046512	Bacteria	16490
264	Ga0495616_0004773	3300046513	Bacteria	8490
265	Ga0495609_0000230	3300046538	Bacteria	53380
266	Ga0495633_0044472	3300046558	Bacteria	2104
267	Ga0495625_0001698	3300046660	Bacteria	25654
268	Ga0495625_0009719	3300046660	Bacteria	8006
269	Ga0495661_0098171	3300046665	Bacteria	1654
270	Ga0495671_0031807	3300046692	Bacteria	2696
271	Ga0495687_000147	3300047443	Bacteria	107007
272	Ga0495687_049711	3300047443	Bacteria	1790
273	Ga0496101_0073910	3300048904	Bacteria	2505
274	Ga0496102_0019665	3300048905	Bacteria	5950
275	Ga0496116_0002711	3300048919	Bacteria	18241
276	Ga0496119_0001402	3300048922	Bacteria	29193
277	Ga0496121_0021190	3300048924	Bacteria	6381
278	Ga0496121_0030176	3300048924	Bacteria	4986
279	Ga0496122_0000029	3300048925	Bacteria	336396
280	Ga0496122_0000523	3300048925	Bacteria	79324
281	Ga0496122_0027809	3300048925	Bacteria	4822
282	Ga0496122_0076819	3300048925	Bacteria	2348
283	Ga0496123_0000216	3300048926	Bacteria	117098
284	Ga0496123_0000404	3300048926	Bacteria	79326
285	Ga0496123_0000608	3300048926	Bacteria	60350
286	Ga0496125_0002158	3300048928	Bacteria	26349
287	Ga0496125_0037099	3300048928	Bacteria	4242
288	Ga0496125_0086036	3300048928	Bacteria	2379
289	Ga0496125_0091277	3300048928	Bacteria	2283
290	Ga0496126_0070653	3300048929	Bacteria	3110
291	Ga0496126_0102737	3300048929	Bacteria	2498
292	Ga0501032_0021433	3300049569	Bacteria	4491
293	Ga0501033_0004631	3300049570	Bacteria	11011
294	Ga0501034_0042075	3300049571	Bacteria	4623
295	Ga0501036_0006755	3300049572	Bacteria	9323
296	Ga0501037_0003100	3300049573	Bacteria	12051
297	Ga0501038_0029129	3300049574	Bacteria	4896
298	Ga0501039_0003225	3300049575	Bacteria	12198
299	Ga0501043_0004670	3300049579	Bacteria	11103
300	Ga0501043_0209912	3300049579	Bacteria	1509
301	Ga0501046_0004463	3300049580	Bacteria	12696
302	Ga0501047_0022013	3300049581	Bacteria	6122
303	Ga0501048_0027470	3300049582	Bacteria	4135
304	Ga0501048_0143284	3300049582	Bacteria	1690
305	Ga0501067_0011473	3300049583	Bacteria	4908
306	Ga0501068_0030322	3300049584	Bacteria	3207
307	Ga0501069_0000617	3300049585	Bacteria	16400
308	Ga0501070_0003980	3300049586	Bacteria	12720
309	Ga0501070_0153649	3300049586	Bacteria	1898
310	Ga0501072_0042849	3300049588	Bacteria	3556
311	Ga0501072_0193866	3300049588	Bacteria	1620
312	Ga0501073_0000595	3300049589	Bacteria	25488
313	Ga0501074_0001163	3300049590	Bacteria	17238
314	Ga0501076_0098403	3300049592	Bacteria	2357
315	Ga0501077_0102339	3300049593	Bacteria	1815
316	Ga0501080_0003223	3300049742	Bacteria	14399
317	Ga0501083_0006565	3300049744	Bacteria	8254
318	Ga0501035_0007772	3300049822	Bacteria	10017
319	Ga0501044_0005874	3300049823	Bacteria	13595
320	Ga0501044_0071942	3300049823	Bacteria	3516
321	nmdc:mga0k408_10832_c1	3300050493	Bacteria	4944
322	nmdc:mga0k408_2416_c1	3300050493	Bacteria	9935
323	nmdc:mga07m45_28377_c1	3300050496	Bacteria	3089
324	nmdc:mga07m45_6849_c1	3300050496	Bacteria	5794
325	nmdc:mga09592_273008_c1	3300050508	Bacteria	1467
326	nmdc:mga08y16_47_c1	3300050511	Bacteria	111829
327	nmdc:mga0n895_219150_c1	3300050512	Bacteria	1932
328	nmdc:mga0n895_405276_c1	3300050512	Bacteria	1379
329	nmdc:mga0a205_8894_c1	3300050515	Bacteria	9151
330	Ga0495601_0090569	3300053077	Bacteria	1968
331	Ga0500644_0017118	3300053088	Bacteria	2098
332	Ga0500651_0071593	3300053093	Bacteria	2157
333	Ga0500641_0005426	3300053096	Bacteria	4520
334	Ga0500595_011020	3300053119	Bacteria	3563
335	Ga0500658_0011533	3300053134	Bacteria	3257
336	Ga0500568_0003295	3300053139	Bacteria	9106
337	Ga0500568_0014766	3300053139	Bacteria	3515
338	Ga0500616_0000932	3300053153	Bacteria	31998
339	Ga0500616_0117819	3300053153	Bacteria	1273
340	Ga0500622_0000028	3300053156	Bacteria	218994
341	Ga0501084_0137932	3300054114	Bacteria	2053
342	Ga0590075_003539	3300059424	Bacteria	3710
343	Ga0501082_0002291	3300060353	Bacteria	16749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300035088	Ga0373940_0031458	Ga0373940_0031458_36_1034	332
2	3300039062	Ga0400483_188821	Ga0400483_188821_14730_15731	333
3	3300053153	Ga0500616_0117819	Ga0500616_0117819_13_1056	347
4	3300013297	Ga0157378_10134173	Ga0157378_101341732	351
5	3300009098	Ga0105245_10237950	Ga0105245_102379501	380
6	3300005564	Ga0070664_100158554	Ga0070664_1001585541	389
7	3300013102	Ga0157371_10087444	Ga0157371_100874442	389
8	3300025945	Ga0207679_10163564	Ga0207679_101635642	389
9	iso_pu_bacteria	2588253510	2588293252	390
10	3300005327	Ga0070658_10016730	Ga0070658_100167302	392
11	3300005329	Ga0070683_100110795	Ga0070683_1001107952	392
12	3300005344	Ga0070661_100080032	Ga0070661_1000800321	392
13	3300005366	Ga0070659_100200047	Ga0070659_1002000471	392
14	3300005435	Ga0070714_100019649	Ga0070714_1000196492	392
15	3300005439	Ga0070711_100037057	Ga0070711_1000370571	392
16	3300005455	Ga0070663_100011883	Ga0070663_1000118833	392
17	3300005457	Ga0070662_100267943	Ga0070662_1002679431	392
18	3300005535	Ga0070684_100008117	Ga0070684_1000081178	392
19	3300005539	Ga0068853_100008744	Ga0068853_1000087448	392
20	3300005564	Ga0070664_100028326	Ga0070664_1000283262	392
21	3300005577	Ga0068857_100038184	Ga0068857_1000381843	392
22	3300005578	Ga0068854_100006135	Ga0068854_1000061352	392
23	3300005614	Ga0068856_100057020	Ga0068856_1000570204	392
24	3300005616	Ga0068852_100092611	Ga0068852_1000926112	392
25	3300009093	Ga0105240_10009582	Ga0105240_100095822	392
26	3300009174	Ga0105241_10006345	Ga0105241_100063456	392
27	3300009545	Ga0105237_10030226	Ga0105237_100302264	392
28	3300009551	Ga0105238_10003659	Ga0105238_100036593	392
29	3300025909	Ga0207705_10034303	Ga0207705_100343032	392
30	3300025919	Ga0207657_10000807	Ga0207657_1000080729	392
31	3300025933	Ga0207706_10287467	Ga0207706_102874671	392
32	3300025949	Ga0207667_10007487	Ga0207667_100074872	392
33	3300025981	Ga0207640_10015209	Ga0207640_100152092	392
34	3300026067	Ga0207678_10014919	Ga0207678_100149194	392
35	3300026116	Ga0207674_10020564	Ga0207674_100205643	392
36	3300026142	Ga0207698_10127525	Ga0207698_101275252	392
37	3300037471	Ga0395905_0024128	Ga0395905_0024128_1516_2706	392
38	3300005937	Ga0081455_10001847	Ga0081455_1000184714	393
39	3300036712	Ga0316584_0057495	Ga0316584_0057495_24_1217	396
40	3300050508	nmdc:mga09592_273008_c1	nmdc:mga09592_273008_c1_113_1372	398
41	3300044712	Ga0453684_0008831	Ga0453684_0008831_9259_10482	402
42	iso_pu_bacteria	2874628541	2874631588	404
43	iso_pu_bacteria	2935908558	2935912464	404
44	iso_pu_bacteria	2935916978	2935921701	404
45	iso_pu_bacteria	2935926038	2935929647	404
46	iso_pu_bacteria	2935934488	2935938879	404
47	iso_pu_bacteria	2935942939	2935948286	404
48	iso_pu_bacteria	2935951376	2935955010	404
49	iso_pu_bacteria	2935967501	2935971956	404
50	iso_pu_bacteria	8019687851	8019693869	404
51	3300053096	Ga0500641_0005426	Ga0500641_0005426_3092_4318	407
52	iso_pu_bacteria	2855730933	2855732267	407
53	iso_pu_bacteria	2855767633	2855768975	407
54	iso_pu_bacteria	3003665799	3003669253	407
55	3300005339	Ga0070660_100006631	Ga0070660_1000066312	408
56	3300013104	Ga0157370_10013510	Ga0157370_100135108	408
57	3300013104	Ga0157370_10112046	Ga0157370_101120462	408
58	3300013307	Ga0157372_10085969	Ga0157372_100859693	408
59	3300021384	Ga0213876_10112312	Ga0213876_101123122	408
60	3300036712	Ga0316584_0049041	Ga0316584_0049041_1721_2959	408
61	3300039437	Ga0436365_0164804	Ga0436365_0164804_2166_3395	408
62	iso_pu_bacteria	2513237165	2514040645	408
63	iso_pu_bacteria	2842718218	2842720743	408
64	3300026035	Ga0207703_10176450	Ga0207703_101764502	409
65	3300053139	Ga0500568_0003295	Ga0500568_0003295_1562_2794	409
66	iso_pu_bacteria	2881412998	2881417712	409
67	3300005293	Ga0065715_10106051	Ga0065715_101060512	410
68	3300005344	Ga0070661_100097769	Ga0070661_1000977692	410
69	3300005366	Ga0070659_100088802	Ga0070659_1000888022	410
70	3300005530	Ga0070679_100096726	Ga0070679_1000967261	410
71	3300005564	Ga0070664_100030322	Ga0070664_1000303222	410
72	3300005616	Ga0068852_100011894	Ga0068852_1000118943	410
73	3300013105	Ga0157369_10003951	Ga0157369_100039514	410
74	3300025919	Ga0207657_10022992	Ga0207657_100229922	410
75	3300025945	Ga0207679_10012002	Ga0207679_100120025	410
76	3300026142	Ga0207698_10046850	Ga0207698_100468502	410
77	3300027682	Ga0209971_1002632	Ga0209971_10026324	410
78	3300027876	Ga0209974_10009040	Ga0209974_100090403	410
79	3300031548	Ga0307408_100015222	Ga0307408_1000152225	410
80	3300031731	Ga0307405_10008516	Ga0307405_100085165	410
81	3300031852	Ga0307410_10021032	Ga0307410_100210322	410
82	3300031903	Ga0307407_10005959	Ga0307407_100059595	410
83	3300031995	Ga0307409_100007250	Ga0307409_1000072504	410
84	3300032004	Ga0307414_10016627	Ga0307414_100166274	410
85	3300032126	Ga0307415_100010680	Ga0307415_1000106803	410
86	iso_pu_bacteria	2643221652	2644293268	410
87	3300006871	Ga0075434_100197228	Ga0075434_1001972282	411
88	3300009093	Ga0105240_10267399	Ga0105240_102673992	411
89	3300009545	Ga0105237_10034428	Ga0105237_100344284	411
90	3300009551	Ga0105238_10151751	Ga0105238_101517512	411
91	3300013307	Ga0157372_10005263	Ga0157372_100052634	411
92	3300031665	Ga0316575_10037190	Ga0316575_100371902	411
93	3300031727	Ga0316576_10051305	Ga0316576_100513052	411
94	3300031733	Ga0316577_10032447	Ga0316577_100324472	411
95	3300031995	Ga0307409_100135302	Ga0307409_1001353021	411
96	3300035398	Ga0316574_0000192	Ga0316574_0000192_859_2094	411
97	3300036647	Ga0316582_0006872	Ga0316582_0006872_2063_3298	411
98	3300037588	Ga0316581_0003692	Ga0316581_0003692_2500_3735	411
99	3300038443	Ga0395901_0023288	Ga0395901_0023288_4116_5372	411
100	3300049588	Ga0501072_0193866	Ga0501072_0193866_238_1473	411
101	3300050512	nmdc:mga0n895_219150_c1	nmdc:mga0n895_219150_c1_613_1848	411
102	3300050515	nmdc:mga0a205_8894_c1	nmdc:mga0a205_8894_c1_2079_3314	411
103	iso_pu_bacteria	2524023250	2524613779	411
104	3300003187	JGI25151J46595_10001932	JGI25151J46595_100019327	412
105	3300003187	JGI25151J46595_10002905	JGI25151J46595_100029056	412
106	3300003215	JGI25153J46596_10000684	JGI25153J46596_1000068417	412
107	3300003771	Ga0055526_1006854	Ga0055526_10068543	412
108	3300003773	Ga0055537_1003773	Ga0055537_10037734	412
109	3300003775	Ga0055524_1003401	Ga0055524_10034015	412
110	3300003781	Ga0055536_1000034	Ga0055536_100003453	412
111	3300003784	Ga0055534_1001422	Ga0055534_10014227	412
112	3300005981	Ga0081538_10034297	Ga0081538_100342972	412
113	3300009094	Ga0111539_10283143	Ga0111539_102831432	412
114	3300010375	Ga0105239_10121293	Ga0105239_101212932	412
115	3300025263	Ga0209565_1000066	Ga0209565_100006623	412
116	3300025291	Ga0209675_1000084	Ga0209675_100008482	412
117	3300025291	Ga0209675_1003857	Ga0209675_10038573	412
118	3300025291	Ga0209675_1009187	Ga0209675_10091871	412
119	3300025292	Ga0209676_1000014	Ga0209676_1000014328	412
120	3300025292	Ga0209676_1015169	Ga0209676_10151693	412
121	3300025294	Ga0209025_1000323	Ga0209025_100032381	412
122	3300025294	Ga0209025_1001111	Ga0209025_100111123	412
123	3300025295	Ga0209564_1000182	Ga0209564_1000182142	412
124	3300025295	Ga0209564_1000679	Ga0209564_100067921	412
125	3300025295	Ga0209564_1001054	Ga0209564_100105413	412
126	3300025297	Ga0209758_1000279	Ga0209758_100027994	412
127	3300025298	Ga0209050_1005549	Ga0209050_10055493	412
128	3300025299	Ga0209256_1004709	Ga0209256_10047094	412
129	3300025303	Ga0209051_1005905	Ga0209051_10059051	412
130	3300025304	Ga0209257_1000297	Ga0209257_100029788	412
131	3300027666	Ga0209282_1000290	Ga0209282_10002903	412
132	3300027907	Ga0207428_10000110	Ga0207428_1000011082	412
133	3300031595	Ga0265313_10037295	Ga0265313_100372952	412
134	3300031852	Ga0307410_10105302	Ga0307410_101053022	412
135	3300032002	Ga0307416_100174484	Ga0307416_1001744842	412
136	3300042876	Ga0451577_0063535	Ga0451577_0063535_361_1599	412
137	3300046460	Ga0495638_0070012	Ga0495638_0070012_507_1745	412
138	3300046474	Ga0495605_0013101	Ga0495605_0013101_916_2163	412
139	3300046500	Ga0495596_0000024	Ga0495596_0000024_105280_106527	412
140	3300046512	Ga0495610_0002206	Ga0495610_0002206_11363_12610	412
141	3300046513	Ga0495616_0004773	Ga0495616_0004773_1229_2476	412
142	3300046538	Ga0495609_0000230	Ga0495609_0000230_50987_52234	412
143	3300046665	Ga0495661_0098171	Ga0495661_0098171_349_1596	412
144	3300046692	Ga0495671_0031807	Ga0495671_0031807_1192_2439	412
145	3300048919	Ga0496116_0002711	Ga0496116_0002711_1492_2739	412
146	3300048924	Ga0496121_0021190	Ga0496121_0021190_1279_2526	412
147	3300048925	Ga0496122_0076819	Ga0496122_0076819_507_1754	412
148	3300048926	Ga0496123_0000608	Ga0496123_0000608_2885_4132	412
149	3300049569	Ga0501032_0021433	Ga0501032_0021433_1036_2274	412
150	3300049570	Ga0501033_0004631	Ga0501033_0004631_215_1453	412
151	3300049571	Ga0501034_0042075	Ga0501034_0042075_3171_4409	412
152	3300049572	Ga0501036_0006755	Ga0501036_0006755_5916_7154	412
153	3300049573	Ga0501037_0003100	Ga0501037_0003100_3408_4646	412
154	3300049574	Ga0501038_0029129	Ga0501038_0029129_1504_2742	412
155	3300049575	Ga0501039_0003225	Ga0501039_0003225_9841_11079	412
156	3300049579	Ga0501043_0004670	Ga0501043_0004670_9549_10787	412
157	3300049579	Ga0501043_0209912	Ga0501043_0209912_221_1459	412
158	3300049580	Ga0501046_0004463	Ga0501046_0004463_215_1453	412
159	3300049581	Ga0501047_0022013	Ga0501047_0022013_4798_6036	412
160	3300049582	Ga0501048_0027470	Ga0501048_0027470_2778_4016	412
161	3300049582	Ga0501048_0143284	Ga0501048_0143284_365_1603	412
162	3300049583	Ga0501067_0011473	Ga0501067_0011473_860_2098	412
163	3300049584	Ga0501068_0030322	Ga0501068_0030322_527_1765	412
164	3300049585	Ga0501069_0000617	Ga0501069_0000617_2455_3693	412
165	3300049586	Ga0501070_0003980	Ga0501070_0003980_10642_11880	412
166	3300049586	Ga0501070_0153649	Ga0501070_0153649_473_1711	412
167	3300049588	Ga0501072_0042849	Ga0501072_0042849_377_1615	412
168	3300049589	Ga0501073_0000595	Ga0501073_0000595_24164_25402	412
169	3300049590	Ga0501074_0001163	Ga0501074_0001163_3508_4746	412
170	3300049592	Ga0501076_0098403	Ga0501076_0098403_398_1636	412
171	3300049742	Ga0501080_0003223	Ga0501080_0003223_5086_6324	412
172	3300049744	Ga0501083_0006565	Ga0501083_0006565_6930_8168	412
173	3300049822	Ga0501035_0007772	Ga0501035_0007772_215_1453	412
174	3300049823	Ga0501044_0005874	Ga0501044_0005874_2574_3812	412
175	3300049823	Ga0501044_0071942	Ga0501044_0071942_56_1294	412
176	3300050511	nmdc:mga08y16_47_c1	nmdc:mga08y16_47_c1_43142_44380	412
177	3300053119	Ga0500595_011020	Ga0500595_011020_1121_2359	412
178	3300053134	Ga0500658_0011533	Ga0500658_0011533_1538_2776	412
179	3300053139	Ga0500568_0014766	Ga0500568_0014766_1328_2566	412
180	3300053153	Ga0500616_0000932	Ga0500616_0000932_17075_18313	412
181	3300054114	Ga0501084_0137932	Ga0501084_0137932_398_1636	412
182	3300059424	Ga0590075_003539	Ga0590075_003539_180_1418	412
183	3300060353	Ga0501082_0002291	Ga0501082_0002291_5101_6339	412
184	iso_pu_bacteria	2511231221	2512038173	412
185	iso_pu_bacteria	2585428058	2587734072	412
186	iso_pu_bacteria	2897803580	2897805374	412
187	iso_pu_bacteria	8054002106	8054006923	412
188	3300025254	Ga0209148_1000810	Ga0209148_100081014	413
189	3300025272	Ga0209455_1001167	Ga0209455_10011679	413
190	3300025297	Ga0209758_1000207	Ga0209758_100020761	413
191	3300031733	Ga0316577_10069032	Ga0316577_100690322	413
192	3300031733	Ga0316577_10092503	Ga0316577_100925031	413
193	3300032133	Ga0316583_10021702	Ga0316583_100217021	413
194	3300036647	Ga0316582_0060125	Ga0316582_0060125_191_1432	413
195	3300036647	Ga0316582_0077861	Ga0316582_0077861_203_1444	413
196	3300039062	Ga0400483_030850	Ga0400483_030850_298_1557	413
197	3300039062	Ga0400483_127369	Ga0400483_127369_12471_13712	413
198	3300039093	Ga0400489_74640	Ga0400489_74640_21570_22811	413
199	3300049593	Ga0501077_0102339	Ga0501077_0102339_412_1653	413
200	3300053093	Ga0500651_0071593	Ga0500651_0071593_371_1630	413
201	iso_pu_bacteria	2855730933	2855733651	413
202	3300003187	JGI25151J46595_10034452	JGI25151J46595_100344522	414
203	3300009551	Ga0105238_10029835	Ga0105238_100298352	414
204	3300025299	Ga0209256_1000272	Ga0209256_100027227	414
205	3300025906	Ga0207699_10080696	Ga0207699_100806962	414
206	3300031239	Ga0265328_10023563	Ga0265328_100235632	414
207	3300031241	Ga0265325_10041441	Ga0265325_100414412	414
208	3300031247	Ga0265340_10030435	Ga0265340_100304352	414
209	3300031249	Ga0265339_10022619	Ga0265339_100226192	414
210	3300031250	Ga0265331_10004242	Ga0265331_100042428	414
211	3300031344	Ga0265316_10172287	Ga0265316_101722872	414
212	3300031595	Ga0265313_10000267	Ga0265313_1000026723	414
213	3300031711	Ga0265314_10030980	Ga0265314_100309803	414
214	3300031712	Ga0265342_10014957	Ga0265342_100149575	414
215	iso_pu_bacteria	2643221544	2643741908	414
216	iso_pu_bacteria	2643221609	2644062299	414
217	iso_pu_bacteria	2643221611	2644071486	414
218	iso_pu_bacteria	2643221717	2644648581	414
219	iso_pu_bacteria	2738543012	2739245909	414
220	iso_pu_bacteria	2816332133	2816470605	414
221	iso_pu_bacteria	2919704043	2919706406	414
222	3300005329	Ga0070683_100000478	Ga0070683_10000047815	415
223	3300005336	Ga0070680_100002618	Ga0070680_1000026183	415
224	3300005530	Ga0070679_100002618	Ga0070679_10000261812	415
225	3300005535	Ga0070684_100037919	Ga0070684_1000379194	415
226	3300005547	Ga0070693_100100757	Ga0070693_1001007572	415
227	3300025912	Ga0207707_10002398	Ga0207707_1000239813	415
228	3300025917	Ga0207660_10012740	Ga0207660_100127404	415
229	3300025921	Ga0207652_10038051	Ga0207652_100380513	415
230	3300025944	Ga0207661_10006452	Ga0207661_100064526	415
231	3300031727	Ga0316576_10054046	Ga0316576_100540462	415
232	3300031728	Ga0316578_10082249	Ga0316578_100822492	415
233	iso_pu_bacteria	2585428062	2587759575	415
234	3300003203	JGI25406J46586_10001764	JGI25406J46586_100017643	416
235	3300005985	Ga0081539_10000190	Ga0081539_1000019069	416
236	3300041452	Ga0451793_0140971	Ga0451793_0140971_1431_2843	416
237	3300041456	Ga0451795_0503610	Ga0451795_0503610_1282_2694	416
238	3300048925	Ga0496122_0027809	Ga0496122_0027809_1443_2714	416
239	3300053156	Ga0500622_0000028	Ga0500622_0000028_142658_144070	416
240	3300003911	JGI25405J52794_10013623	JGI25405J52794_100136232	417
241	3300005337	Ga0070682_100024534	Ga0070682_1000245343	417
242	3300005455	Ga0070663_100157687	Ga0070663_1001576872	417
243	3300005456	Ga0070678_100063501	Ga0070678_1000635012	417
244	3300005548	Ga0070665_100270719	Ga0070665_1002707191	417
245	3300009098	Ga0105245_10064340	Ga0105245_100643402	417
246	3300014969	Ga0157376_10195213	Ga0157376_101952132	417
247	3300026067	Ga0207678_10054737	Ga0207678_100547372	417
248	3300026078	Ga0207702_10206227	Ga0207702_102062272	417
249	3300028794	Ga0307515_10000020	Ga0307515_10000020174	417
250	3300037418	Ga0395900_0086538	Ga0395900_0086538_1556_2821	417
251	3300038443	Ga0395901_0151147	Ga0395901_0151147_658_1923	417
252	3300048904	Ga0496101_0073910	Ga0496101_0073910_629_1882	417
253	3300048905	Ga0496102_0019665	Ga0496102_0019665_3726_4979	417
254	3300050512	nmdc:mga0n895_405276_c1	nmdc:mga0n895_405276_c1_66_1319	417
255	3300053077	Ga0495601_0090569	Ga0495601_0090569_275_1570	417
256	iso_pu_bacteria	2599185292	2599905690	417
257	iso_pu_bacteria	2894023352	2894027154	417
258	3300042876	Ga0451577_0000093	Ga0451577_0000093_54854_56191	418
259	3300044673	Ga0453683_0018281	Ga0453683_0018281_143_1399	418
260	3300044712	Ga0453684_0016246	Ga0453684_0016246_2252_3508	418
261	3300046558	Ga0495633_0044472	Ga0495633_0044472_304_1560	418
262	3300053088	Ga0500644_0017118	Ga0500644_0017118_461_1735	418
263	iso_pu_bacteria	2554235234	2555259161	418
264	iso_pu_bacteria	2599185169	2599413523	418
265	iso_pu_bacteria	2600255254	2601526197	418
266	iso_pu_bacteria	2600255255	2601531292	418
267	iso_pu_bacteria	2600255256	2601535392	418
268	iso_pu_bacteria	2600255257	2601539949	418
269	iso_pu_bacteria	2600255280	2601618089	418
270	iso_pu_bacteria	2600255281	2601623124	418
271	iso_pu_bacteria	2600255287	2601646532	418
272	iso_pu_bacteria	2600255288	2601651542	418
273	iso_pu_bacteria	2600255289	2601656574	418
274	iso_pu_bacteria	2600255290	2601661467	418
275	iso_pu_bacteria	2600255291	2601666499	418
276	iso_pu_bacteria	2600255298	2601699459	418
277	iso_pu_bacteria	2600255299	2601704401	418
278	iso_pu_bacteria	2600255300	2601709310	418
279	iso_pu_bacteria	2600255301	2601714397	418
280	iso_pu_bacteria	2600255302	2601719432	418
281	iso_pu_bacteria	2600255303	2601724304	418
282	iso_pu_bacteria	2600255304	2601729351	418
283	iso_pu_bacteria	2600255305	2601734338	418
284	iso_pu_bacteria	2600255306	2601739327	418
285	iso_pu_bacteria	2600255307	2601744292	418
286	iso_pu_bacteria	2600255309	2601754975	418
287	iso_pu_bacteria	2600255310	2601758572	418
288	iso_pu_bacteria	2600255311	2601764686	418
289	iso_pu_bacteria	2600255392	2602022155	418
290	iso_pu_bacteria	2602042046	2603636733	418
291	iso_pu_bacteria	2602042052	2603661683	418
292	iso_pu_bacteria	2602042053	2603666580	418
293	iso_pu_bacteria	2602042103	2603836687	418
294	iso_pu_bacteria	2602042104	2603841766	418
295	iso_pu_bacteria	2602042105	2603846838	418
296	iso_pu_bacteria	2602042106	2603851947	418
297	iso_pu_bacteria	2602042110	2603869519	418
298	iso_pu_bacteria	2602042111	2603877765	418
299	iso_pu_bacteria	2603880178	2606046667	418
300	iso_pu_bacteria	2603880184	2606071012	418
301	iso_pu_bacteria	2603880202	2606144340	418
302	iso_pu_bacteria	2603880211	2606174557	418
303	iso_pu_bacteria	2636415599	2637226584	418
304	iso_pu_bacteria	2675903046	2676407264	418
305	iso_pu_bacteria	2775507074	2777022311	418
306	iso_pu_bacteria	2811995292	2813727745	418
307	iso_pu_bacteria	2814123068	2814695294	418
308	iso_pu_bacteria	2904513164	2904514852	418
309	iso_pu_bacteria	2919108558	2919109665	418
310	iso_pu_bacteria	2969079654	2969083568	418
311	iso_pu_bacteria	2971820967	2971825008	418
312	iso_pu_bacteria	2984559226	2984560587	418
313	iso_pu_bacteria	2984595703	2984598662	418
314	3300006844	Ga0075428_100029395	Ga0075428_1000293954	419
315	3300006852	Ga0075433_10269466	Ga0075433_102694662	419
316	3300027907	Ga0207428_10000788	Ga0207428_1000078832	419
317	3300028794	Ga0307515_10000051	Ga0307515_10000051172	419
318	3300028794	Ga0307515_10000305	Ga0307515_1000030538	419
319	3300028794	Ga0307515_10040493	Ga0307515_100404936	419
320	3300030522	Ga0307512_10041660	Ga0307512_100416606	419
321	3300031090	Ga0265760_10021141	Ga0265760_100211412	419
322	3300031238	Ga0265332_10000015	Ga0265332_10000015178	419
323	3300031456	Ga0307513_10032072	Ga0307513_100320728	419
324	3300031507	Ga0307509_10104406	Ga0307509_101044062	419
325	3300031616	Ga0307508_10000072	Ga0307508_10000072106	419
326	3300031649	Ga0307514_10030299	Ga0307514_100302994	419
327	3300031730	Ga0307516_10010499	Ga0307516_100104999	419
328	3300046660	Ga0495625_0001698	Ga0495625_0001698_1032_2291	419
329	3300048929	Ga0496126_0070653	Ga0496126_0070653_181_1449	419
330	3300006195	Ga0075366_10000238	Ga0075366_1000023817	420
331	3300009094	Ga0111539_10000263	Ga0111539_1000026321	420
332	3300025942	Ga0207689_10053033	Ga0207689_100530332	420
333	3300037471	Ga0395905_0016413	Ga0395905_0016413_4516_5778	420
334	3300039062	Ga0400483_180553	Ga0400483_180553_25102_26397	420
335	3300041459	Ga0451800_0755824	Ga0451800_0755824_170_1444	420
336	3300047443	Ga0495687_000147	Ga0495687_000147_58014_59282	420
337	3300048925	Ga0496122_0000029	Ga0496122_0000029_305650_306921	420
338	3300048926	Ga0496123_0000216	Ga0496123_0000216_29476_30747	420
339	3300048928	Ga0496125_0037099	Ga0496125_0037099_377_1648	420
340	3300050493	nmdc:mga0k408_2416_c1	nmdc:mga0k408_2416_c1_4660_5922	420
341	3300003856	Ga0058692_1000108	Ga0058692_100010849	421
342	3300005328	Ga0070676_10068255	Ga0070676_100682552	421
343	3300005353	Ga0070669_100046086	Ga0070669_1000460863	421
344	3300005356	Ga0070674_100085026	Ga0070674_1000850262	421
345	3300005441	Ga0070700_100033650	Ga0070700_1000336503	421
346	3300005456	Ga0070678_100012397	Ga0070678_1000123972	421
347	3300005459	Ga0068867_100021641	Ga0068867_1000216414	421
348	3300005543	Ga0070672_100031215	Ga0070672_1000312152	421
349	3300005719	Ga0068861_100000302	Ga0068861_1000003028	421
350	3300005842	Ga0068858_100187854	Ga0068858_1001878542	421
351	3300005843	Ga0068860_100002702	Ga0068860_10000270216	421
352	3300005844	Ga0068862_100001956	Ga0068862_10000195612	421
353	3300006881	Ga0068865_100020258	Ga0068865_1000202583	421
354	3300009011	Ga0105251_10000082	Ga0105251_1000008214	421
355	3300009011	Ga0105251_10002629	Ga0105251_1000262911	421
356	3300009011	Ga0105251_10005818	Ga0105251_100058184	421
357	3300009036	Ga0105244_10001958	Ga0105244_1000195811	421
358	3300009092	Ga0105250_10000035	Ga0105250_1000003570	421
359	3300009093	Ga0105240_10014731	Ga0105240_100147314	421
360	3300009148	Ga0105243_10035117	Ga0105243_100351173	421
361	3300009545	Ga0105237_10000523	Ga0105237_1000052327	421
362	3300009551	Ga0105238_10022814	Ga0105238_100228144	421
363	3300009553	Ga0105249_10016619	Ga0105249_100166195	421
364	3300010375	Ga0105239_10007336	Ga0105239_1000733611	421
365	3300013297	Ga0157378_10005771	Ga0157378_100057716	421
366	3300013306	Ga0163162_10000408	Ga0163162_1000040818	421
367	3300014968	Ga0157379_10135076	Ga0157379_101350762	421
368	3300014968	Ga0157379_10168721	Ga0157379_101687212	421
369	3300014969	Ga0157376_10346725	Ga0157376_103467252	421
370	3300017792	Ga0163161_10015073	Ga0163161_100150732	421
371	3300025711	Ga0207696_1000007	Ga0207696_1000007152	421
372	3300025735	Ga0207713_1000005	Ga0207713_1000005299	421
373	3300025735	Ga0207713_1000006	Ga0207713_1000006192	421
374	3300025907	Ga0207645_10067930	Ga0207645_100679302	421
375	3300025914	Ga0207671_10004041	Ga0207671_1000404112	421
376	3300025923	Ga0207681_10037092	Ga0207681_100370922	421
377	3300025924	Ga0207694_10015432	Ga0207694_100154324	421
378	3300025937	Ga0207669_10031919	Ga0207669_100319192	421
379	3300025938	Ga0207704_10010799	Ga0207704_100107993	421
380	3300025940	Ga0207691_10018064	Ga0207691_100180643	421
381	3300026035	Ga0207703_10150793	Ga0207703_101507932	421
382	3300026075	Ga0207708_10040907	Ga0207708_100409073	421
383	3300026089	Ga0207648_10002057	Ga0207648_1000205717	421
384	3300026118	Ga0207675_100001959	Ga0207675_1000019592	421
385	3300026121	Ga0207683_10010332	Ga0207683_100103323	421
386	3300027312	Ga0209371_1000234	Ga0209371_100023443	421
387	3300027312	Ga0209371_1000933	Ga0209371_10009339	421
388	3300027312	Ga0209371_1020102	Ga0209371_10201022	421
389	3300028380	Ga0268265_10045596	Ga0268265_100455962	421
390	3300028380	Ga0268265_10190296	Ga0268265_101902962	421
391	3300028381	Ga0268264_10091274	Ga0268264_100912743	421
392	3300028794	Ga0307515_10000053	Ga0307515_10000053212	421
393	3300030500	Ga0268256_1000076	Ga0268256_100007622	421
394	3300031456	Ga0307513_10010920	Ga0307513_100109202	421
395	3300035695	Ga0373927_0021896	Ga0373927_0021896_1814_3079	421
396	3300037068	Ga0373925_0028031	Ga0373925_0028031_1537_2802	421
397	3300048922	Ga0496119_0001402	Ga0496119_0001402_2523_3791	421
398	3300048928	Ga0496125_0091277	Ga0496125_0091277_990_2261	421
399	3300048929	Ga0496126_0102737	Ga0496126_0102737_426_1694	421
400	3300009036	Ga0105244_10011055	Ga0105244_100110552	422
401	3300009148	Ga0105243_10011881	Ga0105243_100118812	422
402	3300021384	Ga0213876_10000158	Ga0213876_1000015866	422
403	3300039437	Ga0436365_0117120	Ga0436365_0117120_22605_23891	422
404	3300042115	Ga0450911_000706	Ga0450911_000706_1014_2294	422
405	3300048924	Ga0496121_0030176	Ga0496121_0030176_2947_4227	422
406	3300048925	Ga0496122_0000523	Ga0496122_0000523_62232_63518	422
407	3300048926	Ga0496123_0000404	Ga0496123_0000404_62250_63536	422
408	3300048928	Ga0496125_0002158	Ga0496125_0002158_1216_2496	422
409	3300048928	Ga0496125_0086036	Ga0496125_0086036_436_1716	422
410	iso_pu_bacteria	2609459761	2609913262	422
411	iso_pu_bacteria	2751185846	2753570594	422
412	iso_pu_bacteria	2945874760	2945879147	422
413	3300005467	Ga0070706_100007365	Ga0070706_1000073651	423
414	3300005468	Ga0070707_100042160	Ga0070707_1000421602	423
415	3300005471	Ga0070698_100247939	Ga0070698_1002479392	423
416	3300006051	Ga0075364_10037279	Ga0075364_100372792	423
417	3300006353	Ga0075370_10009580	Ga0075370_100095805	423
418	3300009148	Ga0105243_10096554	Ga0105243_100965542	423
419	3300025910	Ga0207684_10025678	Ga0207684_100256782	423
420	3300025931	Ga0207644_10058823	Ga0207644_100588232	423
421	3300026041	Ga0207639_10186979	Ga0207639_101869792	423
422	3300046660	Ga0495625_0009719	Ga0495625_0009719_179_1450	423
423	3300047443	Ga0495687_000147	Ga0495687_000147_81934_83205	423
424	3300047443	Ga0495687_049711	Ga0495687_049711_193_1464	423
425	3300050493	nmdc:mga0k408_10832_c1	nmdc:mga0k408_10832_c1_3376_4647	423
426	3300050496	nmdc:mga07m45_28377_c1	nmdc:mga07m45_28377_c1_712_1983	423
427	3300005843	Ga0068860_100182654	Ga0068860_1001826542	424
428	3300006353	Ga0075370_10001096	Ga0075370_100010962	424
429	3300050496	nmdc:mga07m45_6849_c1	nmdc:mga07m45_6849_c1_1003_2277	424
430	3300016635	Ga0183361_10014	Ga0183361_1001431	425
431	3300001989	JGI24739J22299_10001709	JGI24739J22299_100017097	426

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

137

467

0.95 PF04389

Peptidase_M28

Peptidase family M28

121

234

0.92 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5i4m-assembly1.cif.gz_B	crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis	0.9942	14	424
8aq0-assembly1.cif.gz_B	crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c	0.9896	17	421
8apz-assembly1.cif.gz_B	crystal structure of wild-type l-n-carbamoylase from sinorhizobium meliloti	0.9878	18	421
5i4m-assembly1.cif.gz_B	crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis	0.987	14	424
8aq0-assembly1.cif.gz_B	crystal structure of l-n-carbamoylase from sinorhizobium meliloti mutant l217g/f329c	0.9752	17	421

ID	Description	Score	Start	End	Superfamily
5i4mA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	1.004	226	338	3.30.70.360
5i4mB01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9912	14	424	3.40.630.10
5i4mB01	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9812	14	424	3.40.630.10
5i4mA02	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.9781	226	338	3.30.70.360
af_C0P5R8_269_385_3.40.630.10	Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases	0.9701	226	338	3.40.630.10

ID	Description	Score	Start	End	GO Terms
AF-A0A382V0H9-F1-model_v4	Zn-dependent hydrolase	1.003	18	120	GO:0016813
AF-A0A356HR59-F1-model_v4	deleted	1.002	17	143
AF-A0A6I2IWC1-F1-model_v4	deleted	0.9972	223	301
AF-X1QY92-F1-model_v4	Peptidase M20 dimerisation domain-containing protein	0.9952	17	139	GO:0016813
AF-A0A228QAI6-F1-model_v4	Zn-dependent hydrolase	0.9938	18	424	GO:0016813 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
94.09	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442424

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

137

467

0.95

PF04389

Peptidase_M28

Peptidase family M28

121

234

0.92

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map