F442479

General Info

Members Datasets Scaffolds Average Seq Length
431 273 399 215

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0112717|Ga0501043_0112717_1408_2064
Length 218
Sequence MGKVRVGGFAVSLDGYSAGPDQSLENPLGKRGPEIFQWFFHTKTFRAMHGEGETGDSEGVDEKYAFRAMDGFGAFILGRNMFGPIRGDWPDESWKGWWGDNPPYHAPTFVLTNHPRDPIVMEGGTTFYFVTDGIESALEKAREAAGDLDVKIGGGVSTVRQYLQARLIDEMHLAVGPVLLGRGENLFQGLDLSALGYSVTSSEQSDRAMHVIVTKQDR

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
4 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
5 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
6 2718217927 Rhizobium sp. N324 Isolate Nodule
7 2718218423 Rhizobium sp. N941 Isolate Nodule
8 2721755809 Rhizobium sp. N541 Isolate Nodule
9 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
10 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
11 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
12 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
13 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
14 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
15 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
16 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
17 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
18 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
19 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
20 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
21 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
22 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
23 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
24 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
25 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
26 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
27 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
28 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
29 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
30 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
31 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
92 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
186 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
227 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
263 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
272 8005275841 Rhizobium sp. N4311 Isolate Nodule
273 8018176218 Rhizobium sp. N122 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.23
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 6.73
Rhizoplane 2.32
Rhizosphere 73.78
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003883 3300001915 Bacteria 3446
2 JGI24739J22299_10008098 3300001989 Bacteria 3925
3 JGI24739J22299_10010640 3300001989 Bacteria 3413
4 JGI24737J22298_10041013 3300001990 Bacteria 1420
5 JGI24735J21928_10009285 3300002067 Bacteria 3162
6 JGI24735J21928_10031907 3300002067 Bacteria 1561
7 JGI24738J21930_10002588 3300002075 Bacteria 4685
8 JGI25165J46597_1000208 3300003214 Bacteria 84386
9 JGI25153J46596_10019371 3300003215 Bacteria 2610
10 Ga0055537_1006170 3300003773 Bacteria 3088
11 Ga0055534_1015068 3300003784 Bacteria 1427
12 Ga0055528_1024541 3300003790 Bacteria 1803
13 Ga0055540_1012669 3300003792 Bacteria 2629
14 Ga0070658_10000062 3300005327 Bacteria 107844
15 Ga0070658_10000624 3300005327 Bacteria 30563
16 Ga0070658_10098490 3300005327 Bacteria 2415
17 Ga0070658_10294015 3300005327 Bacteria 1384
18 Ga0070676_10005613 3300005328 Bacteria 6686
19 Ga0068869_100000110 3300005334 Bacteria 39194
20 Ga0070666_10000001 3300005335 Bacteria 543080
21 Ga0070680_100002628 3300005336 Bacteria 13310
22 Ga0068868_100062608 3300005338 Bacteria 2949
23 Ga0070660_100000103 3300005339 Bacteria 52286
24 Ga0070660_100000383 3300005339 Bacteria 29464
25 Ga0070661_100098410 3300005344 Bacteria 2173
26 Ga0070668_100005766 3300005347 Bacteria 9186
27 Ga0070669_100959167 3300005353 Bacteria 732
28 Ga0070671_100021924 3300005355 Bacteria 5218
29 Ga0070671_100024817 3300005355 Bacteria 4912
30 Ga0070673_100000017 3300005364 Bacteria 112829
31 Ga0070659_100002854 3300005366 Bacteria 12305
32 Ga0070659_100109043 3300005366 Bacteria 2234
33 Ga0070659_100229844 3300005366 Bacteria 1533
34 Ga0070667_100017228 3300005367 Bacteria 5984
35 Ga0070667_100025747 3300005367 Bacteria 4893
36 Ga0070713_100330625 3300005436 Bacteria 1409
37 Ga0070711_100168651 3300005439 Bacteria 1666
38 Ga0070663_100002166 3300005455 Bacteria 10982
39 Ga0070662_100362218 3300005457 Bacteria 1190
40 Ga0070662_100641538 3300005457 Bacteria 895
41 Ga0070681_10009897 3300005458 Bacteria 9393
42 Ga0070681_10028685 3300005458 Bacteria 5595
43 Ga0068867_100000013 3300005459 Bacteria 112835
44 Ga0070679_100008682 3300005530 Bacteria 9579
45 Ga0070679_100040529 3300005530 Bacteria 4633
46 Ga0070679_100633025 3300005530 Bacteria 1013
47 Ga0070684_100858224 3300005535 Bacteria 850
48 Ga0068853_100008844 3300005539 Bacteria 8100
49 Ga0068853_100108592 3300005539 Bacteria 2462
50 Ga0068853_100146088 3300005539 Bacteria 2125
51 Ga0068853_100411737 3300005539 Bacteria 1267
52 Ga0070672_100068040 3300005543 Bacteria 2824
53 Ga0070665_100000021 3300005548 Bacteria 389668
54 Ga0070665_100001251 3300005548 Bacteria 30694
55 Ga0070665_100010913 3300005548 Bacteria 9189
56 Ga0070665_100088488 3300005548 Bacteria 3103
57 Ga0070665_100295391 3300005548 Bacteria 1623
58 Ga0068855_100000911 3300005563 Bacteria 36718
59 Ga0068855_100012824 3300005563 Bacteria 10112
60 Ga0068855_100073294 3300005563 Bacteria 3979
61 Ga0068855_100115047 3300005563 Bacteria 3084
62 Ga0068855_100150604 3300005563 Bacteria 2646
63 Ga0068854_100000411 3300005578 Bacteria 26860
64 Ga0068854_100422812 3300005578 Bacteria 1107
65 Ga0068852_100005073 3300005616 Bacteria 9370
66 Ga0068852_100150563 3300005616 Bacteria 2163
67 Ga0068859_100001200 3300005617 Bacteria 26449
68 Ga0068866_10129322 3300005718 Bacteria 1434
69 Ga0068851_10307852 3300005834 Bacteria 912
70 Ga0068863_100834250 3300005841 Bacteria 920
71 Ga0068858_100024513 3300005842 Bacteria 5620
72 Ga0068860_100000070 3300005843 Bacteria 178676
73 Ga0068860_100028252 3300005843 Bacteria 5399
74 Ga0068860_100041052 3300005843 Bacteria 4420
75 Ga0070712_100177940 3300006175 Bacteria 1655
76 Ga0097621_100238978 3300006237 Bacteria 1587
77 Ga0075370_10093206 3300006353 Bacteria 1739
78 Ga0075370_10098001 3300006353 Bacteria 1695
79 Ga0068871_100004770 3300006358 Bacteria 9480
80 Ga0068871_100366630 3300006358 Bacteria 1277
81 Ga0068865_100000007 3300006881 Bacteria 185316
82 Ga0097620_100001200 3300006931 Bacteria 26449
83 Ga0105240_10088584 3300009093 Bacteria 3787
84 Ga0105240_10109058 3300009093 Bacteria 3353
85 Ga0105240_10201113 3300009093 Bacteria 2335
86 Ga0105247_10037412 3300009101 Bacteria 2962
87 Ga0105243_10000118 3300009148 Bacteria 91438
88 Ga0105241_10000062 3300009174 Bacteria 81327
89 Ga0105241_10017184 3300009174 Bacteria 5314
90 Ga0105241_11174717 3300009174 Bacteria 726
91 Ga0105242_10000221 3300009176 Bacteria 44918
92 Ga0105248_10005911 3300009177 Bacteria 13452
93 Ga0105237_10096426 3300009545 Bacteria 2948
94 Ga0105238_10000513 3300009551 Bacteria 40634
95 Ga0105238_10186265 3300009551 Bacteria 2052
96 Ga0105249_11813570 3300009553 Bacteria 683
97 Ga0123341_1000070 3300009765 Bacteria 43628
98 Ga0123342_1009863 3300009766 Bacteria 11192
99 Ga0105239_10014039 3300010375 Bacteria 8892
100 Ga0105246_10000135 3300011119 Bacteria 34300
101 Ga0157373_10005027 3300013100 Bacteria 9934
102 Ga0157373_10029431 3300013100 Bacteria 3956
103 Ga0157370_10003964 3300013104 Bacteria 17217
104 Ga0157370_10253809 3300013104 Bacteria 1626
105 Ga0157369_10005166 3300013105 Bacteria 15276
106 Ga0157369_10060930 3300013105 Bacteria 4069
107 Ga0157374_10000189 3300013296 Bacteria 57356
108 Ga0157378_10003688 3300013297 Bacteria 13578
109 Ga0157378_11136255 3300013297 Bacteria 819
110 Ga0163162_10003424 3300013306 Bacteria 15149
111 Ga0163162_10044333 3300013306 Bacteria 4455
112 Ga0163162_10096310 3300013306 Bacteria 3047
113 Ga0157372_10010820 3300013307 Bacteria 9712
114 Ga0157372_10071177 3300013307 Bacteria 3916
115 Ga0157372_10115937 3300013307 Bacteria 3071
116 Ga0157372_10124262 3300013307 Bacteria 2966
117 Ga0157372_10224618 3300013307 Bacteria 2177
118 Ga0157372_10384063 3300013307 Bacteria 1636
119 Ga0163163_10021342 3300014325 Bacteria 6110
120 Ga0182008_10033645 3300014497 Bacteria 2571
121 Ga0157376_10000081 3300014969 Bacteria 72584
122 Ga0157376_10105111 3300014969 Bacteria 2475
123 Ga0213873_10022314 3300021358 Bacteria 1498
124 Ga0213876_10014521 3300021384 Bacteria 4173
125 Ga0213876_10135595 3300021384 Bacteria 1309
126 Ga0213875_10052140 3300021388 Bacteria 1916
127 Ga0213875_10187605 3300021388 Bacteria 972
128 Ga0224712_10189356 3300022467 Unclassified 931
129 Ga0207427_102877 3300025231 Bacteria 4102
130 Ga0209437_101601 3300025233 Bacteria 5218
131 Ga0207425_1005009 3300025245 Bacteria 3853
132 Ga0209026_1006912 3300025250 Bacteria 2667
133 Ga0209129_1001683 3300025258 Bacteria 11965
134 Ga0209233_1000003 3300025261 Bacteria 1607366
135 Ga0209233_1000186 3300025261 Bacteria 133572
136 Ga0209565_1000234 3300025263 Bacteria 60830
137 Ga0209673_1012514 3300025273 Bacteria 3412
138 Ga0209675_1003603 3300025291 Bacteria 7273
139 Ga0209564_1026918 3300025295 Bacteria 1884
140 Ga0209564_1033422 3300025295 Bacteria 1529
141 Ga0209758_1002662 3300025297 Bacteria 17667
142 Ga0209758_1012312 3300025297 Bacteria 4801
143 Ga0209256_1001055 3300025299 Bacteria 32004
144 Ga0209256_1008262 3300025299 Bacteria 4870
145 Ga0207656_10067971 3300025321 Bacteria 1578
146 Ga0207692_10173795 3300025898 Bacteria 1250
147 Ga0207642_10053944 3300025899 Bacteria 1831
148 Ga0207710_10049662 3300025900 Bacteria 1880
149 Ga0207680_10000003 3300025903 Bacteria 925264
150 Ga0207680_10087198 3300025903 Bacteria 1975
151 Ga0207647_10000712 3300025904 Bacteria 26107
152 Ga0207647_10003703 3300025904 Bacteria 11430
153 Ga0207647_10024057 3300025904 Bacteria 4018
154 Ga0207647_10133525 3300025904 Bacteria 1457
155 Ga0207645_10002366 3300025907 Bacteria 14873
156 Ga0207705_10000110 3300025909 Bacteria 92932
157 Ga0207705_10000651 3300025909 Bacteria 28902
158 Ga0207705_10001909 3300025909 Bacteria 16291
159 Ga0207705_10001910 3300025909 Bacteria 16291
160 Ga0207705_10003816 3300025909 Bacteria 11462
161 Ga0207705_10012077 3300025909 Bacteria 6239
162 Ga0207654_10000077 3300025911 Bacteria 64031
163 Ga0207654_10012276 3300025911 Bacteria 4386
164 Ga0207707_10081271 3300025912 Bacteria 2829
165 Ga0207707_10351389 3300025912 Bacteria 1270
166 Ga0207695_10510551 3300025913 Bacteria 1084
167 Ga0207695_10642446 3300025913 Bacteria 942
168 Ga0207671_10450686 3300025914 Bacteria 1025
169 Ga0207663_10117324 3300025916 Bacteria 1816
170 Ga0207660_10006797 3300025917 Bacteria 7409
171 Ga0207657_10000243 3300025919 Bacteria 57852
172 Ga0207657_10001089 3300025919 Bacteria 28773
173 Ga0207657_10009569 3300025919 Bacteria 9728
174 Ga0207652_10009469 3300025921 Bacteria 7830
175 Ga0207652_10125068 3300025921 Bacteria 2290
176 Ga0207681_10003923 3300025923 Bacteria 9227
177 Ga0207694_10000151 3300025924 Bacteria 71870
178 Ga0207694_10133091 3300025924 Bacteria 1994
179 Ga0207650_10127022 3300025925 Bacteria 1992
180 Ga0207687_10115730 3300025927 Bacteria 1998
181 Ga0207664_10430127 3300025929 Bacteria 1177
182 Ga0207644_10018470 3300025931 Bacteria 4718
183 Ga0207644_10136614 3300025931 Bacteria 1883
184 Ga0207690_10084464 3300025932 Bacteria 2225
185 Ga0207706_10378752 3300025933 Bacteria 1228
186 Ga0207686_10000752 3300025934 Bacteria 19971
187 Ga0207709_10000306 3300025935 Bacteria 53253
188 Ga0207709_10088599 3300025935 Bacteria 2015
189 Ga0207669_10445939 3300025937 Bacteria 1024
190 Ga0207704_10000017 3300025938 Bacteria 154190
191 Ga0207691_10024245 3300025940 Bacteria 5706
192 Ga0207691_10182874 3300025940 Bacteria 1831
193 Ga0207711_10006158 3300025941 Bacteria 10141
194 Ga0207711_10008323 3300025941 Bacteria 8683
195 Ga0207689_10001243 3300025942 Bacteria 24569
196 Ga0207679_10734349 3300025945 Bacteria 897
197 Ga0207667_10000016 3300025949 Bacteria 391466
198 Ga0207667_10068140 3300025949 Bacteria 3706
199 Ga0207667_10072312 3300025949 Bacteria 3585
200 Ga0207667_10517255 3300025949 Bacteria 1209
201 Ga0207667_10968910 3300025949 Bacteria 839
202 Ga0207651_10000011 3300025960 Bacteria 191950
203 Ga0207712_10120869 3300025961 Bacteria 1981
204 Ga0207712_11034237 3300025961 Bacteria 730
205 Ga0207668_10005371 3300025972 Bacteria 7538
206 Ga0207640_10000131 3300025981 Bacteria 56277
207 Ga0207658_10077347 3300025986 Bacteria 2538
208 Ga0207658_10109003 3300025986 Bacteria 2185
209 Ga0207677_10000191 3300026023 Bacteria 49459
210 Ga0207703_10186873 3300026035 Bacteria 1832
211 Ga0207639_10083839 3300026041 Bacteria 2531
212 Ga0207639_10096409 3300026041 Bacteria 2379
213 Ga0207639_10125671 3300026041 Bacteria 2115
214 Ga0207678_10006173 3300026067 Bacteria 10656
215 Ga0207678_10061807 3300026067 Bacteria 3222
216 Ga0207678_10229504 3300026067 Bacteria 1589
217 Ga0207702_10001090 3300026078 Bacteria 27792
218 Ga0207702_10012331 3300026078 Bacteria 7114
219 Ga0207702_10036410 3300026078 Bacteria 4116
220 Ga0207702_10348656 3300026078 Bacteria 1416
221 Ga0207641_10002251 3300026088 Bacteria 18000
222 Ga0207648_10000045 3300026089 Bacteria 111963
223 Ga0207674_10074675 3300026116 Bacteria 3401
224 Ga0268266_10000005 3300028379 Bacteria 1448194
225 Ga0268266_10000011 3300028379 Bacteria 757403
226 Ga0268266_10000015 3300028379 Bacteria 630629
227 Ga0268266_10057676 3300028379 Bacteria 3342
228 Ga0268265_10556744 3300028380 Bacteria 1089
229 Ga0268264_10000029 3300028381 Bacteria 419246
230 Ga0268264_10019594 3300028381 Bacteria 5526
231 Ga0268264_10176178 3300028381 Bacteria 1938
232 Ga0307517_10098949 3300028786 Bacteria 2317
233 Ga0307514_10186246 3300031649 Bacteria 1330
234 Ga0265314_10011824 3300031711 Bacteria 7171
235 Ga0307510_10005815 3300033180 Bacteria 14706
236 Ga0307510_10006432 3300033180 Bacteria 14013
237 Ga0373942_0005470 3300035207 Bacteria 2947
238 Ga0395899_0003884 3300037312 Bacteria 11775
239 Ga0395899_0101440 3300037312 Bacteria 2077
240 Ga0395899_0123619 3300037312 Bacteria 1852
241 Ga0395899_0201467 3300037312 Bacteria 1387
242 Ga0395900_0057951 3300037418 Bacteria 3987
243 Ga0395900_0440737 3300037418 Bacteria 1260
244 Ga0395900_0469484 3300037418 Bacteria 1212
245 Ga0395898_0021949 3300037466 Bacteria 6466
246 Ga0395898_0025388 3300037466 Bacteria 5971
247 Ga0395898_0026020 3300037466 Bacteria 5892
248 Ga0395898_0390883 3300037466 Bacteria 1326
249 Ga0395905_0016649 3300037471 Bacteria 6988
250 Ga0395905_0072835 3300037471 Bacteria 3221
251 Ga0395905_0199501 3300037471 Bacteria 1876
252 Ga0436364_0660992 3300037853 Bacteria 1214
253 Ga0436364_0948570 3300037853 Bacteria 829
254 Ga0395901_0029819 3300038443 Bacteria 5619
255 Ga0395901_0083601 3300038443 Bacteria 3337
256 Ga0395901_0217096 3300038443 Bacteria 2000
257 Ga0395901_0243430 3300038443 Bacteria 1875
258 Ga0395901_0355754 3300038443 Bacteria 1511
259 Ga0436365_0269680 3300039437 Bacteria 2736
260 Ga0436365_1913462 3300039437 Bacteria 1259
261 Ga0436360_0441467 3300039438 Bacteria 804
262 Ga0436363_0677543 3300039450 Bacteria 949
263 Ga0436363_1021666 3300039450 Bacteria 3871
264 Ga0436363_1226048 3300039450 Bacteria 940
265 Ga0436363_1586436 3300039450 Bacteria 1469
266 Ga0436362_0234033 3300039453 Bacteria 1738
267 Ga0451806_769466 3300041462 Bacteria 1960
268 Ga0450906_023836 3300042145 Bacteria 1089
269 Ga0466969_0102483 3300044656 Bacteria 1346
270 Ga0466972_0003234 3300044658 Bacteria 8078
271 Ga0453683_0000801 3300044673 Bacteria 30773
272 Ga0466966_0042394 3300044684 Bacteria 2921
273 Ga0466961_0042870 3300044693 Bacteria 2899
274 Ga0466963_0009071 3300044694 Bacteria 5979
275 Ga0466964_0001445 3300044706 Bacteria 8117
276 Ga0466964_0162068 3300044706 Bacteria 1046
277 Ga0466971_0008648 3300044719 Bacteria 4443
278 Ga0466971_0328296 3300044719 Bacteria 738
279 Ga0466968_0188998 3300044735 Bacteria 960
280 Ga0466970_0075907 3300044765 Bacteria 1810
281 Ga0466957_0026589 3300044842 Bacteria 3434
282 Ga0466960_0005477 3300044901 Bacteria 5031
283 Ga0466959_0032302 3300045049 Bacteria 3874
284 Ga0466959_0545791 3300045049 Bacteria 782
285 Ga0466958_0005624 3300045836 Bacteria 6763
286 Ga0466958_0444421 3300045836 Bacteria 839
287 Ga0466967_0162044 3300045976 Bacteria 2100
288 Ga0466967_0179723 3300045976 Bacteria 1995
289 Ga0466967_0269304 3300045976 Bacteria 1632
290 Ga0495617_036284 3300046452 Bacteria 1653
291 Ga0495590_0088958 3300046457 Bacteria 1091
292 Ga0495650_0000222 3300046471 Bacteria 118200
293 Ga0495594_0039549 3300046499 Bacteria 2580
294 Ga0495583_0130346 3300046506 Bacteria 1052
295 Ga0495606_0101908 3300046507 Bacteria 1746
296 Ga0495606_0143482 3300046507 Bacteria 1408
297 Ga0495632_0196453 3300046519 Bacteria 920
298 Ga0495654_0081268 3300046530 Bacteria 1519
299 Ga0495622_0005502 3300046557 Bacteria 5875
300 Ga0495668_0016110 3300046616 Bacteria 4349
301 Ga0495625_0065584 3300046660 Bacteria 2559
302 Ga0495658_0273837 3300046683 Bacteria 1064
303 Ga0495649_0075930 3300046694 Bacteria 1799
304 Ga0495660_0019291 3300046810 Bacteria 3916
305 Ga0495672_0007483 3300047320 Bacteria 8209
306 Ga0496101_0262594 3300048904 Bacteria 1347
307 Ga0496101_0426134 3300048904 Bacteria 1046
308 Ga0496102_0000010 3300048905 Bacteria 324617
309 Ga0496102_0228549 3300048905 Bacteria 1754
310 Ga0496103_0000029 3300048906 Bacteria 213326
311 Ga0496103_0456465 3300048906 Bacteria 819
312 Ga0496104_0090730 3300048907 Bacteria 2920
313 Ga0496108_0274286 3300048911 Bacteria 1468
314 Ga0496115_0029447 3300048918 Bacteria 4312
315 Ga0496116_0000362 3300048919 Bacteria 70379
316 Ga0496116_0231113 3300048919 Bacteria 938
317 Ga0496117_0000037 3300048920 Bacteria 324960
318 Ga0496117_0013834 3300048920 Bacteria 7001
319 Ga0496117_0016487 3300048920 Bacteria 6235
320 Ga0496117_0044251 3300048920 Bacteria 3227
321 Ga0496117_0052653 3300048920 Bacteria 2865
322 Ga0496118_0000034 3300048921 Bacteria 322764
323 Ga0496118_0000219 3300048921 Bacteria 99957
324 Ga0496119_0005688 3300048922 Bacteria 11824
325 Ga0496119_0043503 3300048922 Bacteria 2836
326 Ga0496120_0041879 3300048923 Bacteria 2678
327 Ga0496121_0000852 3300048924 Bacteria 55246
328 Ga0496121_0015667 3300048924 Bacteria 7910
329 Ga0496121_0017384 3300048924 Bacteria 7350
330 Ga0496121_0037187 3300048924 Bacteria 4327
331 Ga0496122_0009902 3300048925 Bacteria 9931
332 Ga0496123_0009041 3300048926 Bacteria 9031
333 Ga0496124_0000033 3300048927 Bacteria 330586
334 Ga0496125_0036315 3300048928 Bacteria 4306
335 Ga0496126_0046585 3300048929 Bacteria 3975
336 Ga0501031_0000014 3300049568 Bacteria 127199
337 Ga0501032_0000015 3300049569 Bacteria 176755
338 Ga0501032_0252586 3300049569 Bacteria 1144
339 Ga0501033_0000023 3300049570 Bacteria 176725
340 Ga0501033_0006189 3300049570 Bacteria 9384
341 Ga0501033_0040002 3300049570 Bacteria 3501
342 Ga0501033_0145189 3300049570 Bacteria 1714
343 Ga0501034_0000073 3300049571 Bacteria 176737
344 Ga0501034_0001308 3300049571 Bacteria 33715
345 Ga0501034_0415317 3300049571 Bacteria 1267
346 Ga0501036_0000002 3300049572 Bacteria 293106
347 Ga0501037_0000048 3300049573 Bacteria 113375
348 Ga0501037_0171489 3300049573 Bacteria 1542
349 Ga0501037_0239892 3300049573 Bacteria 1271
350 Ga0501038_0000002 3300049574 Bacteria 330446
351 Ga0501039_0000002 3300049575 Bacteria 375152
352 Ga0501040_0006045 3300049576 Bacteria 7839
353 Ga0501043_0000298 3300049579 Bacteria 44905
354 Ga0501043_0112717 3300049579 Bacteria 2135
355 Ga0501046_0053183 3300049580 Bacteria 3190
356 Ga0501047_0000352 3300049581 Bacteria 52110
357 Ga0501047_0000533 3300049581 Bacteria 41217
358 Ga0501047_0101478 3300049581 Bacteria 2757
359 Ga0501047_0141378 3300049581 Bacteria 2285
360 Ga0501048_0350370 3300049582 Bacteria 1053
361 Ga0501048_0386376 3300049582 Bacteria 1000
362 Ga0501067_0000432 3300049583 Bacteria 22916
363 Ga0501068_0013575 3300049584 Bacteria 4637
364 Ga0501069_0006128 3300049585 Bacteria 6281
365 Ga0501070_0064231 3300049586 Bacteria 3040
366 Ga0501070_0532682 3300049586 Bacteria 942
367 Ga0501070_0746401 3300049586 Bacteria 771
368 Ga0501072_0281007 3300049588 Bacteria 1324
369 Ga0501072_0593341 3300049588 Bacteria 873
370 Ga0501073_0052917 3300049589 Bacteria 2842
371 Ga0501073_0417183 3300049589 Bacteria 927
372 Ga0501074_0232160 3300049590 Bacteria 1313
373 Ga0501076_0302777 3300049592 Bacteria 1311
374 Ga0501079_0905944 3300049741 Bacteria 694
375 Ga0501080_0159839 3300049742 Bacteria 2081
376 Ga0501083_0094508 3300049744 Bacteria 1973
377 Ga0501083_0116075 3300049744 Bacteria 1757
378 Ga0501035_0000022 3300049822 Bacteria 208622
379 Ga0501035_0020875 3300049822 Bacteria 6019
380 Ga0501035_0030851 3300049822 Bacteria 4884
381 Ga0501035_0142663 3300049822 Bacteria 2082
382 Ga0501044_0000002 3300049823 Bacteria 375152
383 Ga0501044_0035172 3300049823 Bacteria 5247
384 Ga0501044_0155864 3300049823 Bacteria 2263
385 Ga0501044_0248750 3300049823 Bacteria 1720
386 nmdc:mga07m45_130335_c1 3300050496 Unclassified 1455
387 Ga0500643_007300 3300053087 Bacteria 4484
388 Ga0500643_016935 3300053087 Bacteria 2454
389 Ga0500562_034959 3300053108 Bacteria 1330
390 Ga0500593_195791 3300053117 Bacteria 735
391 Ga0500559_0126312 3300053136 Bacteria 1192
392 Ga0500622_0002639 3300053156 Bacteria 12737
393 Ga0500637_0207162 3300053178 Bacteria 1114
394 Ga0500645_062834 3300053730 Bacteria 1072
395 Ga0501084_0491759 3300054114 Bacteria 1037
396 Ga0501082_0129490 3300060353 Bacteria 2189
397 Ga0501082_0507578 3300060353 Bacteria 1054
398 Ga0466962_0000734 3300061719 Bacteria 14701
399 Ga0530510_0404654 3300061734 Bacteria 1029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10098490 Ga0070658_100984903 203
2 3300005353 Ga0070669_100959167 Ga0070669_1009591671 205
3 iso_pu_bacteria 2509276033 2509446693 209
4 iso_pu_bacteria 2511231027 2511390955 209
5 iso_pu_bacteria 2513237138 2513866229 209
6 iso_pu_bacteria 2597489875 2597814400 209
7 iso_pu_bacteria 2617270742 2617385559 209
8 iso_pu_bacteria 2718217927 2719386041 209
9 iso_pu_bacteria 2718218423 2721399821 209
10 iso_pu_bacteria 2721755809 2724038634 209
11 iso_pu_bacteria 2791355259 2793312518 209
12 iso_pu_bacteria 2802429606 2805935882 209
13 iso_pu_bacteria 2838668709 2838673601 209
14 iso_pu_bacteria 2838701080 2838705997 209
15 iso_pu_bacteria 2842146304 2842150849 209
16 iso_pu_bacteria 2842192696 2842194252 209
17 iso_pu_bacteria 2842250916 2842255811 209
18 iso_pu_bacteria 2842317721 2842322925 209
19 iso_pu_bacteria 2842489311 2842490284 209
20 iso_pu_bacteria 2842495871 2842495920 209
21 iso_pu_bacteria 2842871566 2842874321 209
22 iso_pu_bacteria 2856342000 2856342290 209
23 iso_pu_bacteria 2876392853 2876395427 209
24 iso_pu_bacteria 2881161766 2881161964 209
25 iso_pu_bacteria 2885312484 2885316686 209
26 iso_pu_bacteria 2904659560 2904662057 209
27 iso_pu_bacteria 2961114664 2961117211 209
28 iso_pu_bacteria 2968110612 2968113119 209
29 iso_pu_bacteria 2970524798 2970531430 209
30 iso_pu_bacteria 2970540015 2970545472 209
31 iso_pu_bacteria 3002141150 3002144213 209
32 iso_pu_bacteria 3005445848 3005448184 209
33 iso_pu_bacteria 8005275841 8005280826 209
34 iso_pu_bacteria 8018176218 8018178785 209
35 3300049569 Ga0501032_0252586 Ga0501032_0252586_473_1120 212
36 3300049571 Ga0501034_0001308 Ga0501034_0001308_31496_32143 212
37 3300049573 Ga0501037_0171489 Ga0501037_0171489_539_1186 212
38 3300049581 Ga0501047_0000533 Ga0501047_0000533_15919_16566 212
39 3300049583 Ga0501067_0000432 Ga0501067_0000432_218_865 212
40 3300049584 Ga0501068_0013575 Ga0501068_0013575_192_839 212
41 3300049585 Ga0501069_0006128 Ga0501069_0006128_338_985 212
42 3300049588 Ga0501072_0593341 Ga0501072_0593341_47_694 212
43 3300049589 Ga0501073_0052917 Ga0501073_0052917_506_1153 212
44 3300049590 Ga0501074_0232160 Ga0501074_0232160_115_762 212
45 3300049741 Ga0501079_0905944 Ga0501079_0905944_31_678 212
46 3300049744 Ga0501083_0116075 Ga0501083_0116075_1075_1722 212
47 3300049823 Ga0501044_0035172 Ga0501044_0035172_45_692 212
48 3300060353 Ga0501082_0129490 Ga0501082_0129490_245_892 212
49 3300001915 JGI24741J21665_1003883 JGI24741J21665_10038832 213
50 3300001989 JGI24739J22299_10008098 JGI24739J22299_100080985 213
51 3300001989 JGI24739J22299_10010640 JGI24739J22299_100106404 213
52 3300001990 JGI24737J22298_10041013 JGI24737J22298_100410132 213
53 3300002067 JGI24735J21928_10009285 JGI24735J21928_100092852 213
54 3300002067 JGI24735J21928_10031907 JGI24735J21928_100319072 213
55 3300002075 JGI24738J21930_10002588 JGI24738J21930_100025882 213
56 3300003214 JGI25165J46597_1000208 JGI25165J46597_100020834 213
57 3300003215 JGI25153J46596_10019371 JGI25153J46596_100193712 213
58 3300003773 Ga0055537_1006170 Ga0055537_10061705 213
59 3300003784 Ga0055534_1015068 Ga0055534_10150682 213
60 3300003790 Ga0055528_1024541 Ga0055528_10245412 213
61 3300003792 Ga0055540_1012669 Ga0055540_10126691 213
62 3300005327 Ga0070658_10000062 Ga0070658_100000623 213
63 3300005327 Ga0070658_10000624 Ga0070658_1000062414 213
64 3300005327 Ga0070658_10294015 Ga0070658_102940151 213
65 3300005328 Ga0070676_10005613 Ga0070676_100056136 213
66 3300005334 Ga0068869_100000110 Ga0068869_10000011026 213
67 3300005335 Ga0070666_10000001 Ga0070666_10000001215 213
68 3300005336 Ga0070680_100002628 Ga0070680_1000026281 213
69 3300005338 Ga0068868_100062608 Ga0068868_1000626083 213
70 3300005339 Ga0070660_100000103 Ga0070660_10000010312 213
71 3300005339 Ga0070660_100000383 Ga0070660_10000038319 213
72 3300005344 Ga0070661_100098410 Ga0070661_1000984102 213
73 3300005347 Ga0070668_100005766 Ga0070668_1000057664 213
74 3300005355 Ga0070671_100021924 Ga0070671_1000219247 213
75 3300005355 Ga0070671_100024817 Ga0070671_1000248173 213
76 3300005364 Ga0070673_100000017 Ga0070673_10000001752 213
77 3300005366 Ga0070659_100002854 Ga0070659_1000028546 213
78 3300005366 Ga0070659_100109043 Ga0070659_1001090432 213
79 3300005366 Ga0070659_100229844 Ga0070659_1002298442 213
80 3300005367 Ga0070667_100017228 Ga0070667_1000172288 213
81 3300005367 Ga0070667_100025747 Ga0070667_1000257472 213
82 3300005436 Ga0070713_100330625 Ga0070713_1003306252 213
83 3300005439 Ga0070711_100168651 Ga0070711_1001686512 213
84 3300005455 Ga0070663_100002166 Ga0070663_1000021668 213
85 3300005457 Ga0070662_100362218 Ga0070662_1003622182 213
86 3300005457 Ga0070662_100641538 Ga0070662_1006415382 213
87 3300005458 Ga0070681_10009897 Ga0070681_100098978 213
88 3300005458 Ga0070681_10028685 Ga0070681_100286853 213
89 3300005459 Ga0068867_100000013 Ga0068867_10000001352 213
90 3300005530 Ga0070679_100008682 Ga0070679_1000086822 213
91 3300005530 Ga0070679_100040529 Ga0070679_1000405294 213
92 3300005530 Ga0070679_100633025 Ga0070679_1006330251 213
93 3300005535 Ga0070684_100858224 Ga0070684_1008582241 213
94 3300005539 Ga0068853_100008844 Ga0068853_1000088448 213
95 3300005539 Ga0068853_100108592 Ga0068853_1001085922 213
96 3300005539 Ga0068853_100146088 Ga0068853_1001460883 213
97 3300005539 Ga0068853_100411737 Ga0068853_1004117373 213
98 3300005543 Ga0070672_100068040 Ga0070672_1000680403 213
99 3300005548 Ga0070665_100000021 Ga0070665_10000002141 213
100 3300005548 Ga0070665_100001251 Ga0070665_10000125130 213
101 3300005548 Ga0070665_100010913 Ga0070665_1000109139 213
102 3300005548 Ga0070665_100088488 Ga0070665_1000884882 213
103 3300005548 Ga0070665_100295391 Ga0070665_1002953912 213
104 3300005563 Ga0068855_100000911 Ga0068855_1000009117 213
105 3300005563 Ga0068855_100012824 Ga0068855_1000128244 213
106 3300005563 Ga0068855_100073294 Ga0068855_1000732942 213
107 3300005563 Ga0068855_100115047 Ga0068855_1001150474 213
108 3300005563 Ga0068855_100150604 Ga0068855_1001506042 213
109 3300005578 Ga0068854_100000411 Ga0068854_10000041111 213
110 3300005578 Ga0068854_100422812 Ga0068854_1004228122 213
111 3300005616 Ga0068852_100005073 Ga0068852_1000050739 213
112 3300005616 Ga0068852_100150563 Ga0068852_1001505632 213
113 3300005617 Ga0068859_100001200 Ga0068859_10000120025 213
114 3300005718 Ga0068866_10129322 Ga0068866_101293222 213
115 3300005834 Ga0068851_10307852 Ga0068851_103078521 213
116 3300005841 Ga0068863_100834250 Ga0068863_1008342501 213
117 3300005842 Ga0068858_100024513 Ga0068858_1000245135 213
118 3300005843 Ga0068860_100000070 Ga0068860_10000007039 213
119 3300005843 Ga0068860_100028252 Ga0068860_1000282523 213
120 3300005843 Ga0068860_100041052 Ga0068860_1000410523 213
121 3300006175 Ga0070712_100177940 Ga0070712_1001779402 213
122 3300006237 Ga0097621_100238978 Ga0097621_1002389782 213
123 3300006353 Ga0075370_10093206 Ga0075370_100932062 213
124 3300006353 Ga0075370_10098001 Ga0075370_100980012 213
125 3300006358 Ga0068871_100004770 Ga0068871_1000047704 213
126 3300006358 Ga0068871_100366630 Ga0068871_1003666302 213
127 3300006881 Ga0068865_100000007 Ga0068865_100000007169 213
128 3300006931 Ga0097620_100001200 Ga0097620_10000120025 213
129 3300009093 Ga0105240_10088584 Ga0105240_100885842 213
130 3300009093 Ga0105240_10109058 Ga0105240_101090583 213
131 3300009093 Ga0105240_10201113 Ga0105240_102011133 213
132 3300009101 Ga0105247_10037412 Ga0105247_100374124 213
133 3300009148 Ga0105243_10000118 Ga0105243_1000011853 213
134 3300009174 Ga0105241_10000062 Ga0105241_1000006257 213
135 3300009174 Ga0105241_10017184 Ga0105241_100171846 213
136 3300009174 Ga0105241_11174717 Ga0105241_111747171 213
137 3300009176 Ga0105242_10000221 Ga0105242_1000022113 213
138 3300009177 Ga0105248_10005911 Ga0105248_100059114 213
139 3300009545 Ga0105237_10096426 Ga0105237_100964263 213
140 3300009551 Ga0105238_10000513 Ga0105238_100005139 213
141 3300009551 Ga0105238_10186265 Ga0105238_101862653 213
142 3300009553 Ga0105249_11813570 Ga0105249_118135701 213
143 3300009765 Ga0123341_1000070 Ga0123341_100007046 213
144 3300009766 Ga0123342_1009863 Ga0123342_10098639 213
145 3300010375 Ga0105239_10014039 Ga0105239_100140392 213
146 3300011119 Ga0105246_10000135 Ga0105246_1000013516 213
147 3300013100 Ga0157373_10005027 Ga0157373_100050274 213
148 3300013100 Ga0157373_10029431 Ga0157373_100294316 213
149 3300013104 Ga0157370_10003964 Ga0157370_100039644 213
150 3300013104 Ga0157370_10253809 Ga0157370_102538091 213
151 3300013105 Ga0157369_10005166 Ga0157369_100051663 213
152 3300013105 Ga0157369_10060930 Ga0157369_100609305 213
153 3300013296 Ga0157374_10000189 Ga0157374_1000018912 213
154 3300013297 Ga0157378_10003688 Ga0157378_1000368813 213
155 3300013297 Ga0157378_11136255 Ga0157378_111362551 213
156 3300013306 Ga0163162_10003424 Ga0163162_1000342416 213
157 3300013306 Ga0163162_10044333 Ga0163162_100443335 213
158 3300013306 Ga0163162_10096310 Ga0163162_100963103 213
159 3300013307 Ga0157372_10010820 Ga0157372_100108208 213
160 3300013307 Ga0157372_10071177 Ga0157372_100711773 213
161 3300013307 Ga0157372_10115937 Ga0157372_101159371 213
162 3300013307 Ga0157372_10124262 Ga0157372_101242621 213
163 3300013307 Ga0157372_10224618 Ga0157372_102246182 213
164 3300013307 Ga0157372_10384063 Ga0157372_103840632 213
165 3300014325 Ga0163163_10021342 Ga0163163_100213424 213
166 3300014497 Ga0182008_10033645 Ga0182008_100336453 213
167 3300014969 Ga0157376_10000081 Ga0157376_1000008171 213
168 3300014969 Ga0157376_10105111 Ga0157376_101051114 213
169 3300021358 Ga0213873_10022314 Ga0213873_100223142 213
170 3300021384 Ga0213876_10014521 Ga0213876_100145215 213
171 3300021384 Ga0213876_10135595 Ga0213876_101355951 213
172 3300021388 Ga0213875_10052140 Ga0213875_100521401 213
173 3300021388 Ga0213875_10187605 Ga0213875_101876052 213
174 3300022467 Ga0224712_10189356 Ga0224712_101893561 213
175 3300025231 Ga0207427_102877 Ga0207427_1028774 213
176 3300025233 Ga0209437_101601 Ga0209437_1016014 213
177 3300025245 Ga0207425_1005009 Ga0207425_10050092 213
178 3300025250 Ga0209026_1006912 Ga0209026_10069123 213
179 3300025258 Ga0209129_1001683 Ga0209129_10016833 213
180 3300025261 Ga0209233_1000003 Ga0209233_10000031465 213
181 3300025261 Ga0209233_1000186 Ga0209233_1000186103 213
182 3300025263 Ga0209565_1000234 Ga0209565_10002349 213
183 3300025273 Ga0209673_1012514 Ga0209673_10125143 213
184 3300025291 Ga0209675_1003603 Ga0209675_10036034 213
185 3300025295 Ga0209564_1026918 Ga0209564_10269182 213
186 3300025295 Ga0209564_1033422 Ga0209564_10334222 213
187 3300025297 Ga0209758_1002662 Ga0209758_100266215 213
188 3300025297 Ga0209758_1012312 Ga0209758_10123126 213
189 3300025299 Ga0209256_1001055 Ga0209256_100105517 213
190 3300025299 Ga0209256_1008262 Ga0209256_10082624 213
191 3300025321 Ga0207656_10067971 Ga0207656_100679711 213
192 3300025898 Ga0207692_10173795 Ga0207692_101737952 213
193 3300025899 Ga0207642_10053944 Ga0207642_100539443 213
194 3300025900 Ga0207710_10049662 Ga0207710_100496622 213
195 3300025903 Ga0207680_10000003 Ga0207680_10000003263 213
196 3300025903 Ga0207680_10087198 Ga0207680_100871982 213
197 3300025904 Ga0207647_10000712 Ga0207647_1000071212 213
198 3300025904 Ga0207647_10003703 Ga0207647_100037039 213
199 3300025904 Ga0207647_10024057 Ga0207647_100240573 213
200 3300025904 Ga0207647_10133525 Ga0207647_101335252 213
201 3300025907 Ga0207645_10002366 Ga0207645_1000236613 213
202 3300025909 Ga0207705_10000110 Ga0207705_1000011049 213
203 3300025909 Ga0207705_10000651 Ga0207705_100006514 213
204 3300025909 Ga0207705_10001909 Ga0207705_100019092 213
205 3300025909 Ga0207705_10001910 Ga0207705_100019102 213
206 3300025909 Ga0207705_10003816 Ga0207705_100038165 213
207 3300025909 Ga0207705_10012077 Ga0207705_100120776 213
208 3300025911 Ga0207654_10000077 Ga0207654_100000778 213
209 3300025911 Ga0207654_10012276 Ga0207654_100122766 213
210 3300025912 Ga0207707_10081271 Ga0207707_100812713 213
211 3300025912 Ga0207707_10351389 Ga0207707_103513892 213
212 3300025913 Ga0207695_10510551 Ga0207695_105105512 213
213 3300025913 Ga0207695_10642446 Ga0207695_106424461 213
214 3300025914 Ga0207671_10450686 Ga0207671_104506862 213
215 3300025916 Ga0207663_10117324 Ga0207663_101173241 213
216 3300025917 Ga0207660_10006797 Ga0207660_100067973 213
217 3300025919 Ga0207657_10000243 Ga0207657_1000024317 213
218 3300025919 Ga0207657_10001089 Ga0207657_100010895 213
219 3300025919 Ga0207657_10009569 Ga0207657_100095693 213
220 3300025921 Ga0207652_10009469 Ga0207652_100094696 213
221 3300025921 Ga0207652_10125068 Ga0207652_101250683 213
222 3300025923 Ga0207681_10003923 Ga0207681_100039234 213
223 3300025924 Ga0207694_10000151 Ga0207694_1000015137 213
224 3300025924 Ga0207694_10133091 Ga0207694_101330912 213
225 3300025925 Ga0207650_10127022 Ga0207650_101270222 213
226 3300025927 Ga0207687_10115730 Ga0207687_101157302 213
227 3300025929 Ga0207664_10430127 Ga0207664_104301271 213
228 3300025931 Ga0207644_10018470 Ga0207644_100184706 213
229 3300025931 Ga0207644_10136614 Ga0207644_101366142 213
230 3300025932 Ga0207690_10084464 Ga0207690_100844642 213
231 3300025933 Ga0207706_10378752 Ga0207706_103787522 213
232 3300025934 Ga0207686_10000752 Ga0207686_1000075218 213
233 3300025935 Ga0207709_10000306 Ga0207709_1000030610 213
234 3300025935 Ga0207709_10088599 Ga0207709_100885993 213
235 3300025937 Ga0207669_10445939 Ga0207669_104459392 213
236 3300025938 Ga0207704_10000017 Ga0207704_1000001721 213
237 3300025940 Ga0207691_10024245 Ga0207691_100242456 213
238 3300025940 Ga0207691_10182874 Ga0207691_101828744 213
239 3300025941 Ga0207711_10006158 Ga0207711_100061587 213
240 3300025941 Ga0207711_10008323 Ga0207711_100083234 213
241 3300025942 Ga0207689_10001243 Ga0207689_1000124318 213
242 3300025945 Ga0207679_10734349 Ga0207679_107343491 213
243 3300025949 Ga0207667_10000016 Ga0207667_10000016373 213
244 3300025949 Ga0207667_10068140 Ga0207667_100681403 213
245 3300025949 Ga0207667_10072312 Ga0207667_100723125 213
246 3300025949 Ga0207667_10517255 Ga0207667_105172552 213
247 3300025949 Ga0207667_10968910 Ga0207667_109689101 213
248 3300025960 Ga0207651_10000011 Ga0207651_1000001123 213
249 3300025961 Ga0207712_10120869 Ga0207712_101208693 213
250 3300025961 Ga0207712_11034237 Ga0207712_110342371 213
251 3300025972 Ga0207668_10005371 Ga0207668_100053714 213
252 3300025981 Ga0207640_10000131 Ga0207640_1000013145 213
253 3300025986 Ga0207658_10077347 Ga0207658_100773473 213
254 3300025986 Ga0207658_10109003 Ga0207658_101090032 213
255 3300026023 Ga0207677_10000191 Ga0207677_1000019112 213
256 3300026035 Ga0207703_10186873 Ga0207703_101868732 213
257 3300026041 Ga0207639_10083839 Ga0207639_100838394 213
258 3300026041 Ga0207639_10096409 Ga0207639_100964093 213
259 3300026041 Ga0207639_10125671 Ga0207639_101256713 213
260 3300026067 Ga0207678_10006173 Ga0207678_100061739 213
261 3300026067 Ga0207678_10061807 Ga0207678_100618073 213
262 3300026067 Ga0207678_10229504 Ga0207678_102295042 213
263 3300026078 Ga0207702_10001090 Ga0207702_1000109017 213
264 3300026078 Ga0207702_10012331 Ga0207702_100123317 213
265 3300026078 Ga0207702_10036410 Ga0207702_100364103 213
266 3300026078 Ga0207702_10348656 Ga0207702_103486561 213
267 3300026088 Ga0207641_10002251 Ga0207641_1000225110 213
268 3300026089 Ga0207648_10000045 Ga0207648_1000004571 213
269 3300026116 Ga0207674_10074675 Ga0207674_100746753 213
270 3300028379 Ga0268266_10000005 Ga0268266_10000005624 213
271 3300028379 Ga0268266_10000011 Ga0268266_10000011208 213
272 3300028379 Ga0268266_10000015 Ga0268266_10000015410 213
273 3300028379 Ga0268266_10057676 Ga0268266_100576762 213
274 3300028380 Ga0268265_10556744 Ga0268265_105567443 213
275 3300028381 Ga0268264_10000029 Ga0268264_1000002966 213
276 3300028381 Ga0268264_10019594 Ga0268264_100195943 213
277 3300028381 Ga0268264_10176178 Ga0268264_101761783 213
278 3300028786 Ga0307517_10098949 Ga0307517_100989493 213
279 3300031649 Ga0307514_10186246 Ga0307514_101862462 213
280 3300031711 Ga0265314_10011824 Ga0265314_100118245 213
281 3300033180 Ga0307510_10005815 Ga0307510_100058158 213
282 3300033180 Ga0307510_10006432 Ga0307510_100064326 213
283 3300035207 Ga0373942_0005470 Ga0373942_0005470_70_711 213
284 3300037312 Ga0395899_0003884 Ga0395899_0003884_9173_9814 213
285 3300037312 Ga0395899_0101440 Ga0395899_0101440_147_788 213
286 3300037312 Ga0395899_0123619 Ga0395899_0123619_842_1486 213
287 3300037312 Ga0395899_0201467 Ga0395899_0201467_486_1127 213
288 3300037418 Ga0395900_0057951 Ga0395900_0057951_2040_2681 213
289 3300037418 Ga0395900_0440737 Ga0395900_0440737_188_829 213
290 3300037418 Ga0395900_0469484 Ga0395900_0469484_502_1143 213
291 3300037466 Ga0395898_0021949 Ga0395898_0021949_5809_6450 213
292 3300037466 Ga0395898_0025388 Ga0395898_0025388_1254_1895 213
293 3300037466 Ga0395898_0026020 Ga0395898_0026020_3066_3707 213
294 3300037466 Ga0395898_0390883 Ga0395898_0390883_492_1133 213
295 3300037471 Ga0395905_0016649 Ga0395905_0016649_3989_4648 213
296 3300037471 Ga0395905_0072835 Ga0395905_0072835_2408_3049 213
297 3300037471 Ga0395905_0199501 Ga0395905_0199501_737_1378 213
298 3300037853 Ga0436364_0660992 Ga0436364_0660992_324_965 213
299 3300037853 Ga0436364_0948570 Ga0436364_0948570_18_659 213
300 3300038443 Ga0395901_0029819 Ga0395901_0029819_4516_5157 213
301 3300038443 Ga0395901_0083601 Ga0395901_0083601_279_935 213
302 3300038443 Ga0395901_0217096 Ga0395901_0217096_1039_1680 213
303 3300038443 Ga0395901_0243430 Ga0395901_0243430_335_994 213
304 3300038443 Ga0395901_0355754 Ga0395901_0355754_284_928 213
305 3300039437 Ga0436365_0269680 Ga0436365_0269680_1310_1951 213
306 3300039437 Ga0436365_1913462 Ga0436365_1913462_26_667 213
307 3300039438 Ga0436360_0441467 Ga0436360_0441467_10_651 213
308 3300039450 Ga0436363_0677543 Ga0436363_0677543_91_732 213
309 3300039450 Ga0436363_1021666 Ga0436363_1021666_2824_3465 213
310 3300039450 Ga0436363_1226048 Ga0436363_1226048_143_784 213
311 3300039450 Ga0436363_1586436 Ga0436363_1586436_265_906 213
312 3300039453 Ga0436362_0234033 Ga0436362_0234033_390_1031 213
313 3300041462 Ga0451806_769466 Ga0451806_769466_922_1587 213
314 3300042145 Ga0450906_023836 Ga0450906_023836_70_723 213
315 3300044656 Ga0466969_0102483 Ga0466969_0102483_160_801 213
316 3300044658 Ga0466972_0003234 Ga0466972_0003234_3877_4518 213
317 3300044673 Ga0453683_0000801 Ga0453683_0000801_20660_21304 213
318 3300044684 Ga0466966_0042394 Ga0466966_0042394_386_1027 213
319 3300044693 Ga0466961_0042870 Ga0466961_0042870_94_735 213
320 3300044694 Ga0466963_0009071 Ga0466963_0009071_4681_5334 213
321 3300044706 Ga0466964_0001445 Ga0466964_0001445_6060_6701 213
322 3300044706 Ga0466964_0162068 Ga0466964_0162068_126_779 213
323 3300044719 Ga0466971_0008648 Ga0466971_0008648_769_1422 213
324 3300044719 Ga0466971_0328296 Ga0466971_0328296_43_684 213
325 3300044735 Ga0466968_0188998 Ga0466968_0188998_266_907 213
326 3300044765 Ga0466970_0075907 Ga0466970_0075907_517_1158 213
327 3300044842 Ga0466957_0026589 Ga0466957_0026589_1463_2104 213
328 3300044901 Ga0466960_0005477 Ga0466960_0005477_3831_4472 213
329 3300045049 Ga0466959_0032302 Ga0466959_0032302_707_1348 213
330 3300045049 Ga0466959_0545791 Ga0466959_0545791_11_652 213
331 3300045836 Ga0466958_0005624 Ga0466958_0005624_1076_1729 213
332 3300045836 Ga0466958_0444421 Ga0466958_0444421_42_683 213
333 3300045976 Ga0466967_0162044 Ga0466967_0162044_874_1515 213
334 3300045976 Ga0466967_0179723 Ga0466967_0179723_1212_1865 213
335 3300045976 Ga0466967_0269304 Ga0466967_0269304_98_739 213
336 3300046452 Ga0495617_036284 Ga0495617_036284_174_830 213
337 3300046457 Ga0495590_0088958 Ga0495590_0088958_210_851 213
338 3300046471 Ga0495650_0000222 Ga0495650_0000222_65385_66026 213
339 3300046499 Ga0495594_0039549 Ga0495594_0039549_168_809 213
340 3300046506 Ga0495583_0130346 Ga0495583_0130346_266_907 213
341 3300046507 Ga0495606_0101908 Ga0495606_0101908_179_820 213
342 3300046507 Ga0495606_0143482 Ga0495606_0143482_637_1278 213
343 3300046519 Ga0495632_0196453 Ga0495632_0196453_115_768 213
344 3300046530 Ga0495654_0081268 Ga0495654_0081268_537_1178 213
345 3300046557 Ga0495622_0005502 Ga0495622_0005502_3356_3997 213
346 3300046616 Ga0495668_0016110 Ga0495668_0016110_3196_3843 213
347 3300046660 Ga0495625_0065584 Ga0495625_0065584_1499_2143 213
348 3300046683 Ga0495658_0273837 Ga0495658_0273837_49_690 213
349 3300046694 Ga0495649_0075930 Ga0495649_0075930_888_1529 213
350 3300046810 Ga0495660_0019291 Ga0495660_0019291_2990_3637 213
351 3300047320 Ga0495672_0007483 Ga0495672_0007483_3144_3785 213
352 3300048904 Ga0496101_0262594 Ga0496101_0262594_508_1149 213
353 3300048904 Ga0496101_0426134 Ga0496101_0426134_394_1035 213
354 3300048905 Ga0496102_0000010 Ga0496102_0000010_145633_146274 213
355 3300048905 Ga0496102_0228549 Ga0496102_0228549_264_905 213
356 3300048906 Ga0496103_0000029 Ga0496103_0000029_34342_34983 213
357 3300048906 Ga0496103_0456465 Ga0496103_0456465_134_775 213
358 3300048907 Ga0496104_0090730 Ga0496104_0090730_182_823 213
359 3300048911 Ga0496108_0274286 Ga0496108_0274286_598_1239 213
360 3300048918 Ga0496115_0029447 Ga0496115_0029447_2192_2833 213
361 3300048919 Ga0496116_0000362 Ga0496116_0000362_57376_58017 213
362 3300048919 Ga0496116_0231113 Ga0496116_0231113_54_695 213
363 3300048920 Ga0496117_0000037 Ga0496117_0000037_146235_146876 213
364 3300048920 Ga0496117_0013834 Ga0496117_0013834_268_909 213
365 3300048920 Ga0496117_0016487 Ga0496117_0016487_1401_2297 213
366 3300048920 Ga0496117_0044251 Ga0496117_0044251_1648_2289 213
367 3300048920 Ga0496117_0052653 Ga0496117_0052653_947_1588 213
368 3300048921 Ga0496118_0000034 Ga0496118_0000034_144039_144680 213
369 3300048921 Ga0496118_0000219 Ga0496118_0000219_64513_65154 213
370 3300048922 Ga0496119_0005688 Ga0496119_0005688_9522_10163 213
371 3300048922 Ga0496119_0043503 Ga0496119_0043503_1304_1957 213
372 3300048923 Ga0496120_0041879 Ga0496120_0041879_1097_1738 213
373 3300048924 Ga0496121_0000852 Ga0496121_0000852_11490_12131 213
374 3300048924 Ga0496121_0015667 Ga0496121_0015667_4948_5589 213
375 3300048924 Ga0496121_0017384 Ga0496121_0017384_2189_2830 213
376 3300048924 Ga0496121_0037187 Ga0496121_0037187_784_1425 213
377 3300048925 Ga0496122_0009902 Ga0496122_0009902_3016_3660 213
378 3300048926 Ga0496123_0009041 Ga0496123_0009041_84_728 213
379 3300048927 Ga0496124_0000033 Ga0496124_0000033_144039_144680 213
380 3300048928 Ga0496125_0036315 Ga0496125_0036315_2274_2975 213
381 3300048929 Ga0496126_0046585 Ga0496126_0046585_504_1205 213
382 3300049568 Ga0501031_0000014 Ga0501031_0000014_99852_100496 213
383 3300049569 Ga0501032_0000015 Ga0501032_0000015_99852_100496 213
384 3300049570 Ga0501033_0000023 Ga0501033_0000023_99852_100496 213
385 3300049570 Ga0501033_0006189 Ga0501033_0006189_1019_1672 213
386 3300049570 Ga0501033_0040002 Ga0501033_0040002_2216_2956 213
387 3300049570 Ga0501033_0145189 Ga0501033_0145189_944_1588 213
388 3300049571 Ga0501034_0000073 Ga0501034_0000073_76242_76886 213
389 3300049571 Ga0501034_0415317 Ga0501034_0415317_228_869 213
390 3300049572 Ga0501036_0000002 Ga0501036_0000002_99852_100496 213
391 3300049573 Ga0501037_0000048 Ga0501037_0000048_76260_76904 213
392 3300049573 Ga0501037_0239892 Ga0501037_0239892_61_708 213
393 3300049574 Ga0501038_0000002 Ga0501038_0000002_165973_166617 213
394 3300049575 Ga0501039_0000002 Ga0501039_0000002_181896_182540 213
395 3300049576 Ga0501040_0006045 Ga0501040_0006045_276_920 213
396 3300049579 Ga0501043_0000298 Ga0501043_0000298_17694_18338 213
397 3300049579 Ga0501043_0112717 Ga0501043_0112717_1408_2064 213
398 3300049580 Ga0501046_0053183 Ga0501046_0053183_2314_2958 213
399 3300049581 Ga0501047_0000352 Ga0501047_0000352_7063_7707 213
400 3300049581 Ga0501047_0101478 Ga0501047_0101478_1792_2433 213
401 3300049581 Ga0501047_0141378 Ga0501047_0141378_811_1458 213
402 3300049582 Ga0501048_0350370 Ga0501048_0350370_332_976 213
403 3300049582 Ga0501048_0386376 Ga0501048_0386376_224_868 213
404 3300049586 Ga0501070_0064231 Ga0501070_0064231_481_1125 213
405 3300049586 Ga0501070_0532682 Ga0501070_0532682_167_829 213
406 3300049586 Ga0501070_0746401 Ga0501070_0746401_30_677 213
407 3300049588 Ga0501072_0281007 Ga0501072_0281007_460_1104 213
408 3300049589 Ga0501073_0417183 Ga0501073_0417183_70_732 213
409 3300049592 Ga0501076_0302777 Ga0501076_0302777_253_900 213
410 3300049742 Ga0501080_0159839 Ga0501080_0159839_1221_1883 213
411 3300049744 Ga0501083_0094508 Ga0501083_0094508_432_1094 213
412 3300049822 Ga0501035_0000022 Ga0501035_0000022_85365_86009 213
413 3300049822 Ga0501035_0020875 Ga0501035_0020875_1165_1818 213
414 3300049822 Ga0501035_0030851 Ga0501035_0030851_3220_3867 213
415 3300049822 Ga0501035_0142663 Ga0501035_0142663_1383_2027 213
416 3300049823 Ga0501044_0000002 Ga0501044_0000002_192613_193257 213
417 3300049823 Ga0501044_0155864 Ga0501044_0155864_832_1479 213
418 3300049823 Ga0501044_0248750 Ga0501044_0248750_826_1488 213
419 3300050496 nmdc:mga07m45_130335_c1 nmdc:mga07m45_130335_c1_440_1102 213
420 3300053087 Ga0500643_007300 Ga0500643_007300_1678_2319 213
421 3300053087 Ga0500643_016935 Ga0500643_016935_197_850 213
422 3300053108 Ga0500562_034959 Ga0500562_034959_383_1024 213
423 3300053117 Ga0500593_195791 Ga0500593_195791_28_669 213
424 3300053136 Ga0500559_0126312 Ga0500559_0126312_18_668 213
425 3300053156 Ga0500622_0002639 Ga0500622_0002639_9232_9873 213
426 3300053178 Ga0500637_0207162 Ga0500637_0207162_72_713 213
427 3300053730 Ga0500645_062834 Ga0500645_062834_415_1062 213
428 3300054114 Ga0501084_0491759 Ga0501084_0491759_205_849 213
429 3300060353 Ga0501082_0507578 Ga0501082_0507578_323_985 213
430 3300061719 Ga0466962_0000734 Ga0466962_0000734_2184_2837 213
431 3300061734 Ga0530510_0404654 Ga0530510_0404654_101_745 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

6

211

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8659 1 213
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.8543 1 213
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.814 1 213
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.7991 1 213
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7389 1 213
ID Description Score Start End Superfamily
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8758 2 213 3.40.430.10
3kgyB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.844 2 213 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.814 1 213 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7991 1 213 3.40.430.10
af_O59697_47_319_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7885 195 213 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A6B9YSD1-F1-model_v4 Dihydrofolate reductase 0.9919 1 213 GO:0008703
GO:0009231
AF-A0A154IKA4-F1-model_v4 Deaminase 0.9914 1 213 GO:0008703
GO:0009231
AF-A0A158CQV0-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9913 1 213 GO:0008703
GO:0009231
AF-A0A2A6JSK4-F1-model_v4 Deaminase 0.9906 1 213 GO:0008703
GO:0009231
AF-A0A239M7J6-F1-model_v4 RibD C-terminal domain-containing protein 0.9901 1 213 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
93.88 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map