F442479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 431 | 273 | 399 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300049579|Ga0501043_0112717|Ga0501043_0112717_1408_2064 |
| Length | 218 |
| Sequence | MGKVRVGGFAVSLDGYSAGPDQSLENPLGKRGPEIFQWFFHTKTFRAMHGEGETGDSEGVDEKYAFRAMDGFGAFILGRNMFGPIRGDWPDESWKGWWGDNPPYHAPTFVLTNHPRDPIVMEGGTTFYFVTDGIESALEKAREAAGDLDVKIGGGVSTVRQYLQARLIDEMHLAVGPVLLGRGENLFQGLDLSALGYSVTSSEQSDRAMHVIVTKQDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 4 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 5 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 6 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 7 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 8 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 9 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 10 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 11 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 12 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 13 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 14 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 15 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 16 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 17 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 18 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 19 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 20 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 21 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 22 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 23 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 24 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 25 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 26 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 27 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 28 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 29 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 30 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 31 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 36 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 92 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 113 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 185 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 186 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 223 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 224 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 227 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 228 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 229 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 230 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 231 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 232 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 262 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 263 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 266 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 267 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 271 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 272 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 273 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.34 |
| Metatranscriptomes | 0.23 |
| Isolates | 7.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 6.73 |
| Rhizoplane | 2.32 |
| Rhizosphere | 73.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1003883 | 3300001915 | Bacteria | 3446 |
| 2 | JGI24739J22299_10008098 | 3300001989 | Bacteria | 3925 |
| 3 | JGI24739J22299_10010640 | 3300001989 | Bacteria | 3413 |
| 4 | JGI24737J22298_10041013 | 3300001990 | Bacteria | 1420 |
| 5 | JGI24735J21928_10009285 | 3300002067 | Bacteria | 3162 |
| 6 | JGI24735J21928_10031907 | 3300002067 | Bacteria | 1561 |
| 7 | JGI24738J21930_10002588 | 3300002075 | Bacteria | 4685 |
| 8 | JGI25165J46597_1000208 | 3300003214 | Bacteria | 84386 |
| 9 | JGI25153J46596_10019371 | 3300003215 | Bacteria | 2610 |
| 10 | Ga0055537_1006170 | 3300003773 | Bacteria | 3088 |
| 11 | Ga0055534_1015068 | 3300003784 | Bacteria | 1427 |
| 12 | Ga0055528_1024541 | 3300003790 | Bacteria | 1803 |
| 13 | Ga0055540_1012669 | 3300003792 | Bacteria | 2629 |
| 14 | Ga0070658_10000062 | 3300005327 | Bacteria | 107844 |
| 15 | Ga0070658_10000624 | 3300005327 | Bacteria | 30563 |
| 16 | Ga0070658_10098490 | 3300005327 | Bacteria | 2415 |
| 17 | Ga0070658_10294015 | 3300005327 | Bacteria | 1384 |
| 18 | Ga0070676_10005613 | 3300005328 | Bacteria | 6686 |
| 19 | Ga0068869_100000110 | 3300005334 | Bacteria | 39194 |
| 20 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 21 | Ga0070680_100002628 | 3300005336 | Bacteria | 13310 |
| 22 | Ga0068868_100062608 | 3300005338 | Bacteria | 2949 |
| 23 | Ga0070660_100000103 | 3300005339 | Bacteria | 52286 |
| 24 | Ga0070660_100000383 | 3300005339 | Bacteria | 29464 |
| 25 | Ga0070661_100098410 | 3300005344 | Bacteria | 2173 |
| 26 | Ga0070668_100005766 | 3300005347 | Bacteria | 9186 |
| 27 | Ga0070669_100959167 | 3300005353 | Bacteria | 732 |
| 28 | Ga0070671_100021924 | 3300005355 | Bacteria | 5218 |
| 29 | Ga0070671_100024817 | 3300005355 | Bacteria | 4912 |
| 30 | Ga0070673_100000017 | 3300005364 | Bacteria | 112829 |
| 31 | Ga0070659_100002854 | 3300005366 | Bacteria | 12305 |
| 32 | Ga0070659_100109043 | 3300005366 | Bacteria | 2234 |
| 33 | Ga0070659_100229844 | 3300005366 | Bacteria | 1533 |
| 34 | Ga0070667_100017228 | 3300005367 | Bacteria | 5984 |
| 35 | Ga0070667_100025747 | 3300005367 | Bacteria | 4893 |
| 36 | Ga0070713_100330625 | 3300005436 | Bacteria | 1409 |
| 37 | Ga0070711_100168651 | 3300005439 | Bacteria | 1666 |
| 38 | Ga0070663_100002166 | 3300005455 | Bacteria | 10982 |
| 39 | Ga0070662_100362218 | 3300005457 | Bacteria | 1190 |
| 40 | Ga0070662_100641538 | 3300005457 | Bacteria | 895 |
| 41 | Ga0070681_10009897 | 3300005458 | Bacteria | 9393 |
| 42 | Ga0070681_10028685 | 3300005458 | Bacteria | 5595 |
| 43 | Ga0068867_100000013 | 3300005459 | Bacteria | 112835 |
| 44 | Ga0070679_100008682 | 3300005530 | Bacteria | 9579 |
| 45 | Ga0070679_100040529 | 3300005530 | Bacteria | 4633 |
| 46 | Ga0070679_100633025 | 3300005530 | Bacteria | 1013 |
| 47 | Ga0070684_100858224 | 3300005535 | Bacteria | 850 |
| 48 | Ga0068853_100008844 | 3300005539 | Bacteria | 8100 |
| 49 | Ga0068853_100108592 | 3300005539 | Bacteria | 2462 |
| 50 | Ga0068853_100146088 | 3300005539 | Bacteria | 2125 |
| 51 | Ga0068853_100411737 | 3300005539 | Bacteria | 1267 |
| 52 | Ga0070672_100068040 | 3300005543 | Bacteria | 2824 |
| 53 | Ga0070665_100000021 | 3300005548 | Bacteria | 389668 |
| 54 | Ga0070665_100001251 | 3300005548 | Bacteria | 30694 |
| 55 | Ga0070665_100010913 | 3300005548 | Bacteria | 9189 |
| 56 | Ga0070665_100088488 | 3300005548 | Bacteria | 3103 |
| 57 | Ga0070665_100295391 | 3300005548 | Bacteria | 1623 |
| 58 | Ga0068855_100000911 | 3300005563 | Bacteria | 36718 |
| 59 | Ga0068855_100012824 | 3300005563 | Bacteria | 10112 |
| 60 | Ga0068855_100073294 | 3300005563 | Bacteria | 3979 |
| 61 | Ga0068855_100115047 | 3300005563 | Bacteria | 3084 |
| 62 | Ga0068855_100150604 | 3300005563 | Bacteria | 2646 |
| 63 | Ga0068854_100000411 | 3300005578 | Bacteria | 26860 |
| 64 | Ga0068854_100422812 | 3300005578 | Bacteria | 1107 |
| 65 | Ga0068852_100005073 | 3300005616 | Bacteria | 9370 |
| 66 | Ga0068852_100150563 | 3300005616 | Bacteria | 2163 |
| 67 | Ga0068859_100001200 | 3300005617 | Bacteria | 26449 |
| 68 | Ga0068866_10129322 | 3300005718 | Bacteria | 1434 |
| 69 | Ga0068851_10307852 | 3300005834 | Bacteria | 912 |
| 70 | Ga0068863_100834250 | 3300005841 | Bacteria | 920 |
| 71 | Ga0068858_100024513 | 3300005842 | Bacteria | 5620 |
| 72 | Ga0068860_100000070 | 3300005843 | Bacteria | 178676 |
| 73 | Ga0068860_100028252 | 3300005843 | Bacteria | 5399 |
| 74 | Ga0068860_100041052 | 3300005843 | Bacteria | 4420 |
| 75 | Ga0070712_100177940 | 3300006175 | Bacteria | 1655 |
| 76 | Ga0097621_100238978 | 3300006237 | Bacteria | 1587 |
| 77 | Ga0075370_10093206 | 3300006353 | Bacteria | 1739 |
| 78 | Ga0075370_10098001 | 3300006353 | Bacteria | 1695 |
| 79 | Ga0068871_100004770 | 3300006358 | Bacteria | 9480 |
| 80 | Ga0068871_100366630 | 3300006358 | Bacteria | 1277 |
| 81 | Ga0068865_100000007 | 3300006881 | Bacteria | 185316 |
| 82 | Ga0097620_100001200 | 3300006931 | Bacteria | 26449 |
| 83 | Ga0105240_10088584 | 3300009093 | Bacteria | 3787 |
| 84 | Ga0105240_10109058 | 3300009093 | Bacteria | 3353 |
| 85 | Ga0105240_10201113 | 3300009093 | Bacteria | 2335 |
| 86 | Ga0105247_10037412 | 3300009101 | Bacteria | 2962 |
| 87 | Ga0105243_10000118 | 3300009148 | Bacteria | 91438 |
| 88 | Ga0105241_10000062 | 3300009174 | Bacteria | 81327 |
| 89 | Ga0105241_10017184 | 3300009174 | Bacteria | 5314 |
| 90 | Ga0105241_11174717 | 3300009174 | Bacteria | 726 |
| 91 | Ga0105242_10000221 | 3300009176 | Bacteria | 44918 |
| 92 | Ga0105248_10005911 | 3300009177 | Bacteria | 13452 |
| 93 | Ga0105237_10096426 | 3300009545 | Bacteria | 2948 |
| 94 | Ga0105238_10000513 | 3300009551 | Bacteria | 40634 |
| 95 | Ga0105238_10186265 | 3300009551 | Bacteria | 2052 |
| 96 | Ga0105249_11813570 | 3300009553 | Bacteria | 683 |
| 97 | Ga0123341_1000070 | 3300009765 | Bacteria | 43628 |
| 98 | Ga0123342_1009863 | 3300009766 | Bacteria | 11192 |
| 99 | Ga0105239_10014039 | 3300010375 | Bacteria | 8892 |
| 100 | Ga0105246_10000135 | 3300011119 | Bacteria | 34300 |
| 101 | Ga0157373_10005027 | 3300013100 | Bacteria | 9934 |
| 102 | Ga0157373_10029431 | 3300013100 | Bacteria | 3956 |
| 103 | Ga0157370_10003964 | 3300013104 | Bacteria | 17217 |
| 104 | Ga0157370_10253809 | 3300013104 | Bacteria | 1626 |
| 105 | Ga0157369_10005166 | 3300013105 | Bacteria | 15276 |
| 106 | Ga0157369_10060930 | 3300013105 | Bacteria | 4069 |
| 107 | Ga0157374_10000189 | 3300013296 | Bacteria | 57356 |
| 108 | Ga0157378_10003688 | 3300013297 | Bacteria | 13578 |
| 109 | Ga0157378_11136255 | 3300013297 | Bacteria | 819 |
| 110 | Ga0163162_10003424 | 3300013306 | Bacteria | 15149 |
| 111 | Ga0163162_10044333 | 3300013306 | Bacteria | 4455 |
| 112 | Ga0163162_10096310 | 3300013306 | Bacteria | 3047 |
| 113 | Ga0157372_10010820 | 3300013307 | Bacteria | 9712 |
| 114 | Ga0157372_10071177 | 3300013307 | Bacteria | 3916 |
| 115 | Ga0157372_10115937 | 3300013307 | Bacteria | 3071 |
| 116 | Ga0157372_10124262 | 3300013307 | Bacteria | 2966 |
| 117 | Ga0157372_10224618 | 3300013307 | Bacteria | 2177 |
| 118 | Ga0157372_10384063 | 3300013307 | Bacteria | 1636 |
| 119 | Ga0163163_10021342 | 3300014325 | Bacteria | 6110 |
| 120 | Ga0182008_10033645 | 3300014497 | Bacteria | 2571 |
| 121 | Ga0157376_10000081 | 3300014969 | Bacteria | 72584 |
| 122 | Ga0157376_10105111 | 3300014969 | Bacteria | 2475 |
| 123 | Ga0213873_10022314 | 3300021358 | Bacteria | 1498 |
| 124 | Ga0213876_10014521 | 3300021384 | Bacteria | 4173 |
| 125 | Ga0213876_10135595 | 3300021384 | Bacteria | 1309 |
| 126 | Ga0213875_10052140 | 3300021388 | Bacteria | 1916 |
| 127 | Ga0213875_10187605 | 3300021388 | Bacteria | 972 |
| 128 | Ga0224712_10189356 | 3300022467 | Unclassified | 931 |
| 129 | Ga0207427_102877 | 3300025231 | Bacteria | 4102 |
| 130 | Ga0209437_101601 | 3300025233 | Bacteria | 5218 |
| 131 | Ga0207425_1005009 | 3300025245 | Bacteria | 3853 |
| 132 | Ga0209026_1006912 | 3300025250 | Bacteria | 2667 |
| 133 | Ga0209129_1001683 | 3300025258 | Bacteria | 11965 |
| 134 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 135 | Ga0209233_1000186 | 3300025261 | Bacteria | 133572 |
| 136 | Ga0209565_1000234 | 3300025263 | Bacteria | 60830 |
| 137 | Ga0209673_1012514 | 3300025273 | Bacteria | 3412 |
| 138 | Ga0209675_1003603 | 3300025291 | Bacteria | 7273 |
| 139 | Ga0209564_1026918 | 3300025295 | Bacteria | 1884 |
| 140 | Ga0209564_1033422 | 3300025295 | Bacteria | 1529 |
| 141 | Ga0209758_1002662 | 3300025297 | Bacteria | 17667 |
| 142 | Ga0209758_1012312 | 3300025297 | Bacteria | 4801 |
| 143 | Ga0209256_1001055 | 3300025299 | Bacteria | 32004 |
| 144 | Ga0209256_1008262 | 3300025299 | Bacteria | 4870 |
| 145 | Ga0207656_10067971 | 3300025321 | Bacteria | 1578 |
| 146 | Ga0207692_10173795 | 3300025898 | Bacteria | 1250 |
| 147 | Ga0207642_10053944 | 3300025899 | Bacteria | 1831 |
| 148 | Ga0207710_10049662 | 3300025900 | Bacteria | 1880 |
| 149 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 150 | Ga0207680_10087198 | 3300025903 | Bacteria | 1975 |
| 151 | Ga0207647_10000712 | 3300025904 | Bacteria | 26107 |
| 152 | Ga0207647_10003703 | 3300025904 | Bacteria | 11430 |
| 153 | Ga0207647_10024057 | 3300025904 | Bacteria | 4018 |
| 154 | Ga0207647_10133525 | 3300025904 | Bacteria | 1457 |
| 155 | Ga0207645_10002366 | 3300025907 | Bacteria | 14873 |
| 156 | Ga0207705_10000110 | 3300025909 | Bacteria | 92932 |
| 157 | Ga0207705_10000651 | 3300025909 | Bacteria | 28902 |
| 158 | Ga0207705_10001909 | 3300025909 | Bacteria | 16291 |
| 159 | Ga0207705_10001910 | 3300025909 | Bacteria | 16291 |
| 160 | Ga0207705_10003816 | 3300025909 | Bacteria | 11462 |
| 161 | Ga0207705_10012077 | 3300025909 | Bacteria | 6239 |
| 162 | Ga0207654_10000077 | 3300025911 | Bacteria | 64031 |
| 163 | Ga0207654_10012276 | 3300025911 | Bacteria | 4386 |
| 164 | Ga0207707_10081271 | 3300025912 | Bacteria | 2829 |
| 165 | Ga0207707_10351389 | 3300025912 | Bacteria | 1270 |
| 166 | Ga0207695_10510551 | 3300025913 | Bacteria | 1084 |
| 167 | Ga0207695_10642446 | 3300025913 | Bacteria | 942 |
| 168 | Ga0207671_10450686 | 3300025914 | Bacteria | 1025 |
| 169 | Ga0207663_10117324 | 3300025916 | Bacteria | 1816 |
| 170 | Ga0207660_10006797 | 3300025917 | Bacteria | 7409 |
| 171 | Ga0207657_10000243 | 3300025919 | Bacteria | 57852 |
| 172 | Ga0207657_10001089 | 3300025919 | Bacteria | 28773 |
| 173 | Ga0207657_10009569 | 3300025919 | Bacteria | 9728 |
| 174 | Ga0207652_10009469 | 3300025921 | Bacteria | 7830 |
| 175 | Ga0207652_10125068 | 3300025921 | Bacteria | 2290 |
| 176 | Ga0207681_10003923 | 3300025923 | Bacteria | 9227 |
| 177 | Ga0207694_10000151 | 3300025924 | Bacteria | 71870 |
| 178 | Ga0207694_10133091 | 3300025924 | Bacteria | 1994 |
| 179 | Ga0207650_10127022 | 3300025925 | Bacteria | 1992 |
| 180 | Ga0207687_10115730 | 3300025927 | Bacteria | 1998 |
| 181 | Ga0207664_10430127 | 3300025929 | Bacteria | 1177 |
| 182 | Ga0207644_10018470 | 3300025931 | Bacteria | 4718 |
| 183 | Ga0207644_10136614 | 3300025931 | Bacteria | 1883 |
| 184 | Ga0207690_10084464 | 3300025932 | Bacteria | 2225 |
| 185 | Ga0207706_10378752 | 3300025933 | Bacteria | 1228 |
| 186 | Ga0207686_10000752 | 3300025934 | Bacteria | 19971 |
| 187 | Ga0207709_10000306 | 3300025935 | Bacteria | 53253 |
| 188 | Ga0207709_10088599 | 3300025935 | Bacteria | 2015 |
| 189 | Ga0207669_10445939 | 3300025937 | Bacteria | 1024 |
| 190 | Ga0207704_10000017 | 3300025938 | Bacteria | 154190 |
| 191 | Ga0207691_10024245 | 3300025940 | Bacteria | 5706 |
| 192 | Ga0207691_10182874 | 3300025940 | Bacteria | 1831 |
| 193 | Ga0207711_10006158 | 3300025941 | Bacteria | 10141 |
| 194 | Ga0207711_10008323 | 3300025941 | Bacteria | 8683 |
| 195 | Ga0207689_10001243 | 3300025942 | Bacteria | 24569 |
| 196 | Ga0207679_10734349 | 3300025945 | Bacteria | 897 |
| 197 | Ga0207667_10000016 | 3300025949 | Bacteria | 391466 |
| 198 | Ga0207667_10068140 | 3300025949 | Bacteria | 3706 |
| 199 | Ga0207667_10072312 | 3300025949 | Bacteria | 3585 |
| 200 | Ga0207667_10517255 | 3300025949 | Bacteria | 1209 |
| 201 | Ga0207667_10968910 | 3300025949 | Bacteria | 839 |
| 202 | Ga0207651_10000011 | 3300025960 | Bacteria | 191950 |
| 203 | Ga0207712_10120869 | 3300025961 | Bacteria | 1981 |
| 204 | Ga0207712_11034237 | 3300025961 | Bacteria | 730 |
| 205 | Ga0207668_10005371 | 3300025972 | Bacteria | 7538 |
| 206 | Ga0207640_10000131 | 3300025981 | Bacteria | 56277 |
| 207 | Ga0207658_10077347 | 3300025986 | Bacteria | 2538 |
| 208 | Ga0207658_10109003 | 3300025986 | Bacteria | 2185 |
| 209 | Ga0207677_10000191 | 3300026023 | Bacteria | 49459 |
| 210 | Ga0207703_10186873 | 3300026035 | Bacteria | 1832 |
| 211 | Ga0207639_10083839 | 3300026041 | Bacteria | 2531 |
| 212 | Ga0207639_10096409 | 3300026041 | Bacteria | 2379 |
| 213 | Ga0207639_10125671 | 3300026041 | Bacteria | 2115 |
| 214 | Ga0207678_10006173 | 3300026067 | Bacteria | 10656 |
| 215 | Ga0207678_10061807 | 3300026067 | Bacteria | 3222 |
| 216 | Ga0207678_10229504 | 3300026067 | Bacteria | 1589 |
| 217 | Ga0207702_10001090 | 3300026078 | Bacteria | 27792 |
| 218 | Ga0207702_10012331 | 3300026078 | Bacteria | 7114 |
| 219 | Ga0207702_10036410 | 3300026078 | Bacteria | 4116 |
| 220 | Ga0207702_10348656 | 3300026078 | Bacteria | 1416 |
| 221 | Ga0207641_10002251 | 3300026088 | Bacteria | 18000 |
| 222 | Ga0207648_10000045 | 3300026089 | Bacteria | 111963 |
| 223 | Ga0207674_10074675 | 3300026116 | Bacteria | 3401 |
| 224 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 225 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 226 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 227 | Ga0268266_10057676 | 3300028379 | Bacteria | 3342 |
| 228 | Ga0268265_10556744 | 3300028380 | Bacteria | 1089 |
| 229 | Ga0268264_10000029 | 3300028381 | Bacteria | 419246 |
| 230 | Ga0268264_10019594 | 3300028381 | Bacteria | 5526 |
| 231 | Ga0268264_10176178 | 3300028381 | Bacteria | 1938 |
| 232 | Ga0307517_10098949 | 3300028786 | Bacteria | 2317 |
| 233 | Ga0307514_10186246 | 3300031649 | Bacteria | 1330 |
| 234 | Ga0265314_10011824 | 3300031711 | Bacteria | 7171 |
| 235 | Ga0307510_10005815 | 3300033180 | Bacteria | 14706 |
| 236 | Ga0307510_10006432 | 3300033180 | Bacteria | 14013 |
| 237 | Ga0373942_0005470 | 3300035207 | Bacteria | 2947 |
| 238 | Ga0395899_0003884 | 3300037312 | Bacteria | 11775 |
| 239 | Ga0395899_0101440 | 3300037312 | Bacteria | 2077 |
| 240 | Ga0395899_0123619 | 3300037312 | Bacteria | 1852 |
| 241 | Ga0395899_0201467 | 3300037312 | Bacteria | 1387 |
| 242 | Ga0395900_0057951 | 3300037418 | Bacteria | 3987 |
| 243 | Ga0395900_0440737 | 3300037418 | Bacteria | 1260 |
| 244 | Ga0395900_0469484 | 3300037418 | Bacteria | 1212 |
| 245 | Ga0395898_0021949 | 3300037466 | Bacteria | 6466 |
| 246 | Ga0395898_0025388 | 3300037466 | Bacteria | 5971 |
| 247 | Ga0395898_0026020 | 3300037466 | Bacteria | 5892 |
| 248 | Ga0395898_0390883 | 3300037466 | Bacteria | 1326 |
| 249 | Ga0395905_0016649 | 3300037471 | Bacteria | 6988 |
| 250 | Ga0395905_0072835 | 3300037471 | Bacteria | 3221 |
| 251 | Ga0395905_0199501 | 3300037471 | Bacteria | 1876 |
| 252 | Ga0436364_0660992 | 3300037853 | Bacteria | 1214 |
| 253 | Ga0436364_0948570 | 3300037853 | Bacteria | 829 |
| 254 | Ga0395901_0029819 | 3300038443 | Bacteria | 5619 |
| 255 | Ga0395901_0083601 | 3300038443 | Bacteria | 3337 |
| 256 | Ga0395901_0217096 | 3300038443 | Bacteria | 2000 |
| 257 | Ga0395901_0243430 | 3300038443 | Bacteria | 1875 |
| 258 | Ga0395901_0355754 | 3300038443 | Bacteria | 1511 |
| 259 | Ga0436365_0269680 | 3300039437 | Bacteria | 2736 |
| 260 | Ga0436365_1913462 | 3300039437 | Bacteria | 1259 |
| 261 | Ga0436360_0441467 | 3300039438 | Bacteria | 804 |
| 262 | Ga0436363_0677543 | 3300039450 | Bacteria | 949 |
| 263 | Ga0436363_1021666 | 3300039450 | Bacteria | 3871 |
| 264 | Ga0436363_1226048 | 3300039450 | Bacteria | 940 |
| 265 | Ga0436363_1586436 | 3300039450 | Bacteria | 1469 |
| 266 | Ga0436362_0234033 | 3300039453 | Bacteria | 1738 |
| 267 | Ga0451806_769466 | 3300041462 | Bacteria | 1960 |
| 268 | Ga0450906_023836 | 3300042145 | Bacteria | 1089 |
| 269 | Ga0466969_0102483 | 3300044656 | Bacteria | 1346 |
| 270 | Ga0466972_0003234 | 3300044658 | Bacteria | 8078 |
| 271 | Ga0453683_0000801 | 3300044673 | Bacteria | 30773 |
| 272 | Ga0466966_0042394 | 3300044684 | Bacteria | 2921 |
| 273 | Ga0466961_0042870 | 3300044693 | Bacteria | 2899 |
| 274 | Ga0466963_0009071 | 3300044694 | Bacteria | 5979 |
| 275 | Ga0466964_0001445 | 3300044706 | Bacteria | 8117 |
| 276 | Ga0466964_0162068 | 3300044706 | Bacteria | 1046 |
| 277 | Ga0466971_0008648 | 3300044719 | Bacteria | 4443 |
| 278 | Ga0466971_0328296 | 3300044719 | Bacteria | 738 |
| 279 | Ga0466968_0188998 | 3300044735 | Bacteria | 960 |
| 280 | Ga0466970_0075907 | 3300044765 | Bacteria | 1810 |
| 281 | Ga0466957_0026589 | 3300044842 | Bacteria | 3434 |
| 282 | Ga0466960_0005477 | 3300044901 | Bacteria | 5031 |
| 283 | Ga0466959_0032302 | 3300045049 | Bacteria | 3874 |
| 284 | Ga0466959_0545791 | 3300045049 | Bacteria | 782 |
| 285 | Ga0466958_0005624 | 3300045836 | Bacteria | 6763 |
| 286 | Ga0466958_0444421 | 3300045836 | Bacteria | 839 |
| 287 | Ga0466967_0162044 | 3300045976 | Bacteria | 2100 |
| 288 | Ga0466967_0179723 | 3300045976 | Bacteria | 1995 |
| 289 | Ga0466967_0269304 | 3300045976 | Bacteria | 1632 |
| 290 | Ga0495617_036284 | 3300046452 | Bacteria | 1653 |
| 291 | Ga0495590_0088958 | 3300046457 | Bacteria | 1091 |
| 292 | Ga0495650_0000222 | 3300046471 | Bacteria | 118200 |
| 293 | Ga0495594_0039549 | 3300046499 | Bacteria | 2580 |
| 294 | Ga0495583_0130346 | 3300046506 | Bacteria | 1052 |
| 295 | Ga0495606_0101908 | 3300046507 | Bacteria | 1746 |
| 296 | Ga0495606_0143482 | 3300046507 | Bacteria | 1408 |
| 297 | Ga0495632_0196453 | 3300046519 | Bacteria | 920 |
| 298 | Ga0495654_0081268 | 3300046530 | Bacteria | 1519 |
| 299 | Ga0495622_0005502 | 3300046557 | Bacteria | 5875 |
| 300 | Ga0495668_0016110 | 3300046616 | Bacteria | 4349 |
| 301 | Ga0495625_0065584 | 3300046660 | Bacteria | 2559 |
| 302 | Ga0495658_0273837 | 3300046683 | Bacteria | 1064 |
| 303 | Ga0495649_0075930 | 3300046694 | Bacteria | 1799 |
| 304 | Ga0495660_0019291 | 3300046810 | Bacteria | 3916 |
| 305 | Ga0495672_0007483 | 3300047320 | Bacteria | 8209 |
| 306 | Ga0496101_0262594 | 3300048904 | Bacteria | 1347 |
| 307 | Ga0496101_0426134 | 3300048904 | Bacteria | 1046 |
| 308 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 309 | Ga0496102_0228549 | 3300048905 | Bacteria | 1754 |
| 310 | Ga0496103_0000029 | 3300048906 | Bacteria | 213326 |
| 311 | Ga0496103_0456465 | 3300048906 | Bacteria | 819 |
| 312 | Ga0496104_0090730 | 3300048907 | Bacteria | 2920 |
| 313 | Ga0496108_0274286 | 3300048911 | Bacteria | 1468 |
| 314 | Ga0496115_0029447 | 3300048918 | Bacteria | 4312 |
| 315 | Ga0496116_0000362 | 3300048919 | Bacteria | 70379 |
| 316 | Ga0496116_0231113 | 3300048919 | Bacteria | 938 |
| 317 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 318 | Ga0496117_0013834 | 3300048920 | Bacteria | 7001 |
| 319 | Ga0496117_0016487 | 3300048920 | Bacteria | 6235 |
| 320 | Ga0496117_0044251 | 3300048920 | Bacteria | 3227 |
| 321 | Ga0496117_0052653 | 3300048920 | Bacteria | 2865 |
| 322 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 323 | Ga0496118_0000219 | 3300048921 | Bacteria | 99957 |
| 324 | Ga0496119_0005688 | 3300048922 | Bacteria | 11824 |
| 325 | Ga0496119_0043503 | 3300048922 | Bacteria | 2836 |
| 326 | Ga0496120_0041879 | 3300048923 | Bacteria | 2678 |
| 327 | Ga0496121_0000852 | 3300048924 | Bacteria | 55246 |
| 328 | Ga0496121_0015667 | 3300048924 | Bacteria | 7910 |
| 329 | Ga0496121_0017384 | 3300048924 | Bacteria | 7350 |
| 330 | Ga0496121_0037187 | 3300048924 | Bacteria | 4327 |
| 331 | Ga0496122_0009902 | 3300048925 | Bacteria | 9931 |
| 332 | Ga0496123_0009041 | 3300048926 | Bacteria | 9031 |
| 333 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 334 | Ga0496125_0036315 | 3300048928 | Bacteria | 4306 |
| 335 | Ga0496126_0046585 | 3300048929 | Bacteria | 3975 |
| 336 | Ga0501031_0000014 | 3300049568 | Bacteria | 127199 |
| 337 | Ga0501032_0000015 | 3300049569 | Bacteria | 176755 |
| 338 | Ga0501032_0252586 | 3300049569 | Bacteria | 1144 |
| 339 | Ga0501033_0000023 | 3300049570 | Bacteria | 176725 |
| 340 | Ga0501033_0006189 | 3300049570 | Bacteria | 9384 |
| 341 | Ga0501033_0040002 | 3300049570 | Bacteria | 3501 |
| 342 | Ga0501033_0145189 | 3300049570 | Bacteria | 1714 |
| 343 | Ga0501034_0000073 | 3300049571 | Bacteria | 176737 |
| 344 | Ga0501034_0001308 | 3300049571 | Bacteria | 33715 |
| 345 | Ga0501034_0415317 | 3300049571 | Bacteria | 1267 |
| 346 | Ga0501036_0000002 | 3300049572 | Bacteria | 293106 |
| 347 | Ga0501037_0000048 | 3300049573 | Bacteria | 113375 |
| 348 | Ga0501037_0171489 | 3300049573 | Bacteria | 1542 |
| 349 | Ga0501037_0239892 | 3300049573 | Bacteria | 1271 |
| 350 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 351 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 352 | Ga0501040_0006045 | 3300049576 | Bacteria | 7839 |
| 353 | Ga0501043_0000298 | 3300049579 | Bacteria | 44905 |
| 354 | Ga0501043_0112717 | 3300049579 | Bacteria | 2135 |
| 355 | Ga0501046_0053183 | 3300049580 | Bacteria | 3190 |
| 356 | Ga0501047_0000352 | 3300049581 | Bacteria | 52110 |
| 357 | Ga0501047_0000533 | 3300049581 | Bacteria | 41217 |
| 358 | Ga0501047_0101478 | 3300049581 | Bacteria | 2757 |
| 359 | Ga0501047_0141378 | 3300049581 | Bacteria | 2285 |
| 360 | Ga0501048_0350370 | 3300049582 | Bacteria | 1053 |
| 361 | Ga0501048_0386376 | 3300049582 | Bacteria | 1000 |
| 362 | Ga0501067_0000432 | 3300049583 | Bacteria | 22916 |
| 363 | Ga0501068_0013575 | 3300049584 | Bacteria | 4637 |
| 364 | Ga0501069_0006128 | 3300049585 | Bacteria | 6281 |
| 365 | Ga0501070_0064231 | 3300049586 | Bacteria | 3040 |
| 366 | Ga0501070_0532682 | 3300049586 | Bacteria | 942 |
| 367 | Ga0501070_0746401 | 3300049586 | Bacteria | 771 |
| 368 | Ga0501072_0281007 | 3300049588 | Bacteria | 1324 |
| 369 | Ga0501072_0593341 | 3300049588 | Bacteria | 873 |
| 370 | Ga0501073_0052917 | 3300049589 | Bacteria | 2842 |
| 371 | Ga0501073_0417183 | 3300049589 | Bacteria | 927 |
| 372 | Ga0501074_0232160 | 3300049590 | Bacteria | 1313 |
| 373 | Ga0501076_0302777 | 3300049592 | Bacteria | 1311 |
| 374 | Ga0501079_0905944 | 3300049741 | Bacteria | 694 |
| 375 | Ga0501080_0159839 | 3300049742 | Bacteria | 2081 |
| 376 | Ga0501083_0094508 | 3300049744 | Bacteria | 1973 |
| 377 | Ga0501083_0116075 | 3300049744 | Bacteria | 1757 |
| 378 | Ga0501035_0000022 | 3300049822 | Bacteria | 208622 |
| 379 | Ga0501035_0020875 | 3300049822 | Bacteria | 6019 |
| 380 | Ga0501035_0030851 | 3300049822 | Bacteria | 4884 |
| 381 | Ga0501035_0142663 | 3300049822 | Bacteria | 2082 |
| 382 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 383 | Ga0501044_0035172 | 3300049823 | Bacteria | 5247 |
| 384 | Ga0501044_0155864 | 3300049823 | Bacteria | 2263 |
| 385 | Ga0501044_0248750 | 3300049823 | Bacteria | 1720 |
| 386 | nmdc:mga07m45_130335_c1 | 3300050496 | Unclassified | 1455 |
| 387 | Ga0500643_007300 | 3300053087 | Bacteria | 4484 |
| 388 | Ga0500643_016935 | 3300053087 | Bacteria | 2454 |
| 389 | Ga0500562_034959 | 3300053108 | Bacteria | 1330 |
| 390 | Ga0500593_195791 | 3300053117 | Bacteria | 735 |
| 391 | Ga0500559_0126312 | 3300053136 | Bacteria | 1192 |
| 392 | Ga0500622_0002639 | 3300053156 | Bacteria | 12737 |
| 393 | Ga0500637_0207162 | 3300053178 | Bacteria | 1114 |
| 394 | Ga0500645_062834 | 3300053730 | Bacteria | 1072 |
| 395 | Ga0501084_0491759 | 3300054114 | Bacteria | 1037 |
| 396 | Ga0501082_0129490 | 3300060353 | Bacteria | 2189 |
| 397 | Ga0501082_0507578 | 3300060353 | Bacteria | 1054 |
| 398 | Ga0466962_0000734 | 3300061719 | Bacteria | 14701 |
| 399 | Ga0530510_0404654 | 3300061734 | Bacteria | 1029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10098490 | Ga0070658_100984903 | 203 |
| 2 | 3300005353 | Ga0070669_100959167 | Ga0070669_1009591671 | 205 |
| 3 | iso_pu_bacteria | 2509276033 | 2509446693 | 209 |
| 4 | iso_pu_bacteria | 2511231027 | 2511390955 | 209 |
| 5 | iso_pu_bacteria | 2513237138 | 2513866229 | 209 |
| 6 | iso_pu_bacteria | 2597489875 | 2597814400 | 209 |
| 7 | iso_pu_bacteria | 2617270742 | 2617385559 | 209 |
| 8 | iso_pu_bacteria | 2718217927 | 2719386041 | 209 |
| 9 | iso_pu_bacteria | 2718218423 | 2721399821 | 209 |
| 10 | iso_pu_bacteria | 2721755809 | 2724038634 | 209 |
| 11 | iso_pu_bacteria | 2791355259 | 2793312518 | 209 |
| 12 | iso_pu_bacteria | 2802429606 | 2805935882 | 209 |
| 13 | iso_pu_bacteria | 2838668709 | 2838673601 | 209 |
| 14 | iso_pu_bacteria | 2838701080 | 2838705997 | 209 |
| 15 | iso_pu_bacteria | 2842146304 | 2842150849 | 209 |
| 16 | iso_pu_bacteria | 2842192696 | 2842194252 | 209 |
| 17 | iso_pu_bacteria | 2842250916 | 2842255811 | 209 |
| 18 | iso_pu_bacteria | 2842317721 | 2842322925 | 209 |
| 19 | iso_pu_bacteria | 2842489311 | 2842490284 | 209 |
| 20 | iso_pu_bacteria | 2842495871 | 2842495920 | 209 |
| 21 | iso_pu_bacteria | 2842871566 | 2842874321 | 209 |
| 22 | iso_pu_bacteria | 2856342000 | 2856342290 | 209 |
| 23 | iso_pu_bacteria | 2876392853 | 2876395427 | 209 |
| 24 | iso_pu_bacteria | 2881161766 | 2881161964 | 209 |
| 25 | iso_pu_bacteria | 2885312484 | 2885316686 | 209 |
| 26 | iso_pu_bacteria | 2904659560 | 2904662057 | 209 |
| 27 | iso_pu_bacteria | 2961114664 | 2961117211 | 209 |
| 28 | iso_pu_bacteria | 2968110612 | 2968113119 | 209 |
| 29 | iso_pu_bacteria | 2970524798 | 2970531430 | 209 |
| 30 | iso_pu_bacteria | 2970540015 | 2970545472 | 209 |
| 31 | iso_pu_bacteria | 3002141150 | 3002144213 | 209 |
| 32 | iso_pu_bacteria | 3005445848 | 3005448184 | 209 |
| 33 | iso_pu_bacteria | 8005275841 | 8005280826 | 209 |
| 34 | iso_pu_bacteria | 8018176218 | 8018178785 | 209 |
| 35 | 3300049569 | Ga0501032_0252586 | Ga0501032_0252586_473_1120 | 212 |
| 36 | 3300049571 | Ga0501034_0001308 | Ga0501034_0001308_31496_32143 | 212 |
| 37 | 3300049573 | Ga0501037_0171489 | Ga0501037_0171489_539_1186 | 212 |
| 38 | 3300049581 | Ga0501047_0000533 | Ga0501047_0000533_15919_16566 | 212 |
| 39 | 3300049583 | Ga0501067_0000432 | Ga0501067_0000432_218_865 | 212 |
| 40 | 3300049584 | Ga0501068_0013575 | Ga0501068_0013575_192_839 | 212 |
| 41 | 3300049585 | Ga0501069_0006128 | Ga0501069_0006128_338_985 | 212 |
| 42 | 3300049588 | Ga0501072_0593341 | Ga0501072_0593341_47_694 | 212 |
| 43 | 3300049589 | Ga0501073_0052917 | Ga0501073_0052917_506_1153 | 212 |
| 44 | 3300049590 | Ga0501074_0232160 | Ga0501074_0232160_115_762 | 212 |
| 45 | 3300049741 | Ga0501079_0905944 | Ga0501079_0905944_31_678 | 212 |
| 46 | 3300049744 | Ga0501083_0116075 | Ga0501083_0116075_1075_1722 | 212 |
| 47 | 3300049823 | Ga0501044_0035172 | Ga0501044_0035172_45_692 | 212 |
| 48 | 3300060353 | Ga0501082_0129490 | Ga0501082_0129490_245_892 | 212 |
| 49 | 3300001915 | JGI24741J21665_1003883 | JGI24741J21665_10038832 | 213 |
| 50 | 3300001989 | JGI24739J22299_10008098 | JGI24739J22299_100080985 | 213 |
| 51 | 3300001989 | JGI24739J22299_10010640 | JGI24739J22299_100106404 | 213 |
| 52 | 3300001990 | JGI24737J22298_10041013 | JGI24737J22298_100410132 | 213 |
| 53 | 3300002067 | JGI24735J21928_10009285 | JGI24735J21928_100092852 | 213 |
| 54 | 3300002067 | JGI24735J21928_10031907 | JGI24735J21928_100319072 | 213 |
| 55 | 3300002075 | JGI24738J21930_10002588 | JGI24738J21930_100025882 | 213 |
| 56 | 3300003214 | JGI25165J46597_1000208 | JGI25165J46597_100020834 | 213 |
| 57 | 3300003215 | JGI25153J46596_10019371 | JGI25153J46596_100193712 | 213 |
| 58 | 3300003773 | Ga0055537_1006170 | Ga0055537_10061705 | 213 |
| 59 | 3300003784 | Ga0055534_1015068 | Ga0055534_10150682 | 213 |
| 60 | 3300003790 | Ga0055528_1024541 | Ga0055528_10245412 | 213 |
| 61 | 3300003792 | Ga0055540_1012669 | Ga0055540_10126691 | 213 |
| 62 | 3300005327 | Ga0070658_10000062 | Ga0070658_100000623 | 213 |
| 63 | 3300005327 | Ga0070658_10000624 | Ga0070658_1000062414 | 213 |
| 64 | 3300005327 | Ga0070658_10294015 | Ga0070658_102940151 | 213 |
| 65 | 3300005328 | Ga0070676_10005613 | Ga0070676_100056136 | 213 |
| 66 | 3300005334 | Ga0068869_100000110 | Ga0068869_10000011026 | 213 |
| 67 | 3300005335 | Ga0070666_10000001 | Ga0070666_10000001215 | 213 |
| 68 | 3300005336 | Ga0070680_100002628 | Ga0070680_1000026281 | 213 |
| 69 | 3300005338 | Ga0068868_100062608 | Ga0068868_1000626083 | 213 |
| 70 | 3300005339 | Ga0070660_100000103 | Ga0070660_10000010312 | 213 |
| 71 | 3300005339 | Ga0070660_100000383 | Ga0070660_10000038319 | 213 |
| 72 | 3300005344 | Ga0070661_100098410 | Ga0070661_1000984102 | 213 |
| 73 | 3300005347 | Ga0070668_100005766 | Ga0070668_1000057664 | 213 |
| 74 | 3300005355 | Ga0070671_100021924 | Ga0070671_1000219247 | 213 |
| 75 | 3300005355 | Ga0070671_100024817 | Ga0070671_1000248173 | 213 |
| 76 | 3300005364 | Ga0070673_100000017 | Ga0070673_10000001752 | 213 |
| 77 | 3300005366 | Ga0070659_100002854 | Ga0070659_1000028546 | 213 |
| 78 | 3300005366 | Ga0070659_100109043 | Ga0070659_1001090432 | 213 |
| 79 | 3300005366 | Ga0070659_100229844 | Ga0070659_1002298442 | 213 |
| 80 | 3300005367 | Ga0070667_100017228 | Ga0070667_1000172288 | 213 |
| 81 | 3300005367 | Ga0070667_100025747 | Ga0070667_1000257472 | 213 |
| 82 | 3300005436 | Ga0070713_100330625 | Ga0070713_1003306252 | 213 |
| 83 | 3300005439 | Ga0070711_100168651 | Ga0070711_1001686512 | 213 |
| 84 | 3300005455 | Ga0070663_100002166 | Ga0070663_1000021668 | 213 |
| 85 | 3300005457 | Ga0070662_100362218 | Ga0070662_1003622182 | 213 |
| 86 | 3300005457 | Ga0070662_100641538 | Ga0070662_1006415382 | 213 |
| 87 | 3300005458 | Ga0070681_10009897 | Ga0070681_100098978 | 213 |
| 88 | 3300005458 | Ga0070681_10028685 | Ga0070681_100286853 | 213 |
| 89 | 3300005459 | Ga0068867_100000013 | Ga0068867_10000001352 | 213 |
| 90 | 3300005530 | Ga0070679_100008682 | Ga0070679_1000086822 | 213 |
| 91 | 3300005530 | Ga0070679_100040529 | Ga0070679_1000405294 | 213 |
| 92 | 3300005530 | Ga0070679_100633025 | Ga0070679_1006330251 | 213 |
| 93 | 3300005535 | Ga0070684_100858224 | Ga0070684_1008582241 | 213 |
| 94 | 3300005539 | Ga0068853_100008844 | Ga0068853_1000088448 | 213 |
| 95 | 3300005539 | Ga0068853_100108592 | Ga0068853_1001085922 | 213 |
| 96 | 3300005539 | Ga0068853_100146088 | Ga0068853_1001460883 | 213 |
| 97 | 3300005539 | Ga0068853_100411737 | Ga0068853_1004117373 | 213 |
| 98 | 3300005543 | Ga0070672_100068040 | Ga0070672_1000680403 | 213 |
| 99 | 3300005548 | Ga0070665_100000021 | Ga0070665_10000002141 | 213 |
| 100 | 3300005548 | Ga0070665_100001251 | Ga0070665_10000125130 | 213 |
| 101 | 3300005548 | Ga0070665_100010913 | Ga0070665_1000109139 | 213 |
| 102 | 3300005548 | Ga0070665_100088488 | Ga0070665_1000884882 | 213 |
| 103 | 3300005548 | Ga0070665_100295391 | Ga0070665_1002953912 | 213 |
| 104 | 3300005563 | Ga0068855_100000911 | Ga0068855_1000009117 | 213 |
| 105 | 3300005563 | Ga0068855_100012824 | Ga0068855_1000128244 | 213 |
| 106 | 3300005563 | Ga0068855_100073294 | Ga0068855_1000732942 | 213 |
| 107 | 3300005563 | Ga0068855_100115047 | Ga0068855_1001150474 | 213 |
| 108 | 3300005563 | Ga0068855_100150604 | Ga0068855_1001506042 | 213 |
| 109 | 3300005578 | Ga0068854_100000411 | Ga0068854_10000041111 | 213 |
| 110 | 3300005578 | Ga0068854_100422812 | Ga0068854_1004228122 | 213 |
| 111 | 3300005616 | Ga0068852_100005073 | Ga0068852_1000050739 | 213 |
| 112 | 3300005616 | Ga0068852_100150563 | Ga0068852_1001505632 | 213 |
| 113 | 3300005617 | Ga0068859_100001200 | Ga0068859_10000120025 | 213 |
| 114 | 3300005718 | Ga0068866_10129322 | Ga0068866_101293222 | 213 |
| 115 | 3300005834 | Ga0068851_10307852 | Ga0068851_103078521 | 213 |
| 116 | 3300005841 | Ga0068863_100834250 | Ga0068863_1008342501 | 213 |
| 117 | 3300005842 | Ga0068858_100024513 | Ga0068858_1000245135 | 213 |
| 118 | 3300005843 | Ga0068860_100000070 | Ga0068860_10000007039 | 213 |
| 119 | 3300005843 | Ga0068860_100028252 | Ga0068860_1000282523 | 213 |
| 120 | 3300005843 | Ga0068860_100041052 | Ga0068860_1000410523 | 213 |
| 121 | 3300006175 | Ga0070712_100177940 | Ga0070712_1001779402 | 213 |
| 122 | 3300006237 | Ga0097621_100238978 | Ga0097621_1002389782 | 213 |
| 123 | 3300006353 | Ga0075370_10093206 | Ga0075370_100932062 | 213 |
| 124 | 3300006353 | Ga0075370_10098001 | Ga0075370_100980012 | 213 |
| 125 | 3300006358 | Ga0068871_100004770 | Ga0068871_1000047704 | 213 |
| 126 | 3300006358 | Ga0068871_100366630 | Ga0068871_1003666302 | 213 |
| 127 | 3300006881 | Ga0068865_100000007 | Ga0068865_100000007169 | 213 |
| 128 | 3300006931 | Ga0097620_100001200 | Ga0097620_10000120025 | 213 |
| 129 | 3300009093 | Ga0105240_10088584 | Ga0105240_100885842 | 213 |
| 130 | 3300009093 | Ga0105240_10109058 | Ga0105240_101090583 | 213 |
| 131 | 3300009093 | Ga0105240_10201113 | Ga0105240_102011133 | 213 |
| 132 | 3300009101 | Ga0105247_10037412 | Ga0105247_100374124 | 213 |
| 133 | 3300009148 | Ga0105243_10000118 | Ga0105243_1000011853 | 213 |
| 134 | 3300009174 | Ga0105241_10000062 | Ga0105241_1000006257 | 213 |
| 135 | 3300009174 | Ga0105241_10017184 | Ga0105241_100171846 | 213 |
| 136 | 3300009174 | Ga0105241_11174717 | Ga0105241_111747171 | 213 |
| 137 | 3300009176 | Ga0105242_10000221 | Ga0105242_1000022113 | 213 |
| 138 | 3300009177 | Ga0105248_10005911 | Ga0105248_100059114 | 213 |
| 139 | 3300009545 | Ga0105237_10096426 | Ga0105237_100964263 | 213 |
| 140 | 3300009551 | Ga0105238_10000513 | Ga0105238_100005139 | 213 |
| 141 | 3300009551 | Ga0105238_10186265 | Ga0105238_101862653 | 213 |
| 142 | 3300009553 | Ga0105249_11813570 | Ga0105249_118135701 | 213 |
| 143 | 3300009765 | Ga0123341_1000070 | Ga0123341_100007046 | 213 |
| 144 | 3300009766 | Ga0123342_1009863 | Ga0123342_10098639 | 213 |
| 145 | 3300010375 | Ga0105239_10014039 | Ga0105239_100140392 | 213 |
| 146 | 3300011119 | Ga0105246_10000135 | Ga0105246_1000013516 | 213 |
| 147 | 3300013100 | Ga0157373_10005027 | Ga0157373_100050274 | 213 |
| 148 | 3300013100 | Ga0157373_10029431 | Ga0157373_100294316 | 213 |
| 149 | 3300013104 | Ga0157370_10003964 | Ga0157370_100039644 | 213 |
| 150 | 3300013104 | Ga0157370_10253809 | Ga0157370_102538091 | 213 |
| 151 | 3300013105 | Ga0157369_10005166 | Ga0157369_100051663 | 213 |
| 152 | 3300013105 | Ga0157369_10060930 | Ga0157369_100609305 | 213 |
| 153 | 3300013296 | Ga0157374_10000189 | Ga0157374_1000018912 | 213 |
| 154 | 3300013297 | Ga0157378_10003688 | Ga0157378_1000368813 | 213 |
| 155 | 3300013297 | Ga0157378_11136255 | Ga0157378_111362551 | 213 |
| 156 | 3300013306 | Ga0163162_10003424 | Ga0163162_1000342416 | 213 |
| 157 | 3300013306 | Ga0163162_10044333 | Ga0163162_100443335 | 213 |
| 158 | 3300013306 | Ga0163162_10096310 | Ga0163162_100963103 | 213 |
| 159 | 3300013307 | Ga0157372_10010820 | Ga0157372_100108208 | 213 |
| 160 | 3300013307 | Ga0157372_10071177 | Ga0157372_100711773 | 213 |
| 161 | 3300013307 | Ga0157372_10115937 | Ga0157372_101159371 | 213 |
| 162 | 3300013307 | Ga0157372_10124262 | Ga0157372_101242621 | 213 |
| 163 | 3300013307 | Ga0157372_10224618 | Ga0157372_102246182 | 213 |
| 164 | 3300013307 | Ga0157372_10384063 | Ga0157372_103840632 | 213 |
| 165 | 3300014325 | Ga0163163_10021342 | Ga0163163_100213424 | 213 |
| 166 | 3300014497 | Ga0182008_10033645 | Ga0182008_100336453 | 213 |
| 167 | 3300014969 | Ga0157376_10000081 | Ga0157376_1000008171 | 213 |
| 168 | 3300014969 | Ga0157376_10105111 | Ga0157376_101051114 | 213 |
| 169 | 3300021358 | Ga0213873_10022314 | Ga0213873_100223142 | 213 |
| 170 | 3300021384 | Ga0213876_10014521 | Ga0213876_100145215 | 213 |
| 171 | 3300021384 | Ga0213876_10135595 | Ga0213876_101355951 | 213 |
| 172 | 3300021388 | Ga0213875_10052140 | Ga0213875_100521401 | 213 |
| 173 | 3300021388 | Ga0213875_10187605 | Ga0213875_101876052 | 213 |
| 174 | 3300022467 | Ga0224712_10189356 | Ga0224712_101893561 | 213 |
| 175 | 3300025231 | Ga0207427_102877 | Ga0207427_1028774 | 213 |
| 176 | 3300025233 | Ga0209437_101601 | Ga0209437_1016014 | 213 |
| 177 | 3300025245 | Ga0207425_1005009 | Ga0207425_10050092 | 213 |
| 178 | 3300025250 | Ga0209026_1006912 | Ga0209026_10069123 | 213 |
| 179 | 3300025258 | Ga0209129_1001683 | Ga0209129_10016833 | 213 |
| 180 | 3300025261 | Ga0209233_1000003 | Ga0209233_10000031465 | 213 |
| 181 | 3300025261 | Ga0209233_1000186 | Ga0209233_1000186103 | 213 |
| 182 | 3300025263 | Ga0209565_1000234 | Ga0209565_10002349 | 213 |
| 183 | 3300025273 | Ga0209673_1012514 | Ga0209673_10125143 | 213 |
| 184 | 3300025291 | Ga0209675_1003603 | Ga0209675_10036034 | 213 |
| 185 | 3300025295 | Ga0209564_1026918 | Ga0209564_10269182 | 213 |
| 186 | 3300025295 | Ga0209564_1033422 | Ga0209564_10334222 | 213 |
| 187 | 3300025297 | Ga0209758_1002662 | Ga0209758_100266215 | 213 |
| 188 | 3300025297 | Ga0209758_1012312 | Ga0209758_10123126 | 213 |
| 189 | 3300025299 | Ga0209256_1001055 | Ga0209256_100105517 | 213 |
| 190 | 3300025299 | Ga0209256_1008262 | Ga0209256_10082624 | 213 |
| 191 | 3300025321 | Ga0207656_10067971 | Ga0207656_100679711 | 213 |
| 192 | 3300025898 | Ga0207692_10173795 | Ga0207692_101737952 | 213 |
| 193 | 3300025899 | Ga0207642_10053944 | Ga0207642_100539443 | 213 |
| 194 | 3300025900 | Ga0207710_10049662 | Ga0207710_100496622 | 213 |
| 195 | 3300025903 | Ga0207680_10000003 | Ga0207680_10000003263 | 213 |
| 196 | 3300025903 | Ga0207680_10087198 | Ga0207680_100871982 | 213 |
| 197 | 3300025904 | Ga0207647_10000712 | Ga0207647_1000071212 | 213 |
| 198 | 3300025904 | Ga0207647_10003703 | Ga0207647_100037039 | 213 |
| 199 | 3300025904 | Ga0207647_10024057 | Ga0207647_100240573 | 213 |
| 200 | 3300025904 | Ga0207647_10133525 | Ga0207647_101335252 | 213 |
| 201 | 3300025907 | Ga0207645_10002366 | Ga0207645_1000236613 | 213 |
| 202 | 3300025909 | Ga0207705_10000110 | Ga0207705_1000011049 | 213 |
| 203 | 3300025909 | Ga0207705_10000651 | Ga0207705_100006514 | 213 |
| 204 | 3300025909 | Ga0207705_10001909 | Ga0207705_100019092 | 213 |
| 205 | 3300025909 | Ga0207705_10001910 | Ga0207705_100019102 | 213 |
| 206 | 3300025909 | Ga0207705_10003816 | Ga0207705_100038165 | 213 |
| 207 | 3300025909 | Ga0207705_10012077 | Ga0207705_100120776 | 213 |
| 208 | 3300025911 | Ga0207654_10000077 | Ga0207654_100000778 | 213 |
| 209 | 3300025911 | Ga0207654_10012276 | Ga0207654_100122766 | 213 |
| 210 | 3300025912 | Ga0207707_10081271 | Ga0207707_100812713 | 213 |
| 211 | 3300025912 | Ga0207707_10351389 | Ga0207707_103513892 | 213 |
| 212 | 3300025913 | Ga0207695_10510551 | Ga0207695_105105512 | 213 |
| 213 | 3300025913 | Ga0207695_10642446 | Ga0207695_106424461 | 213 |
| 214 | 3300025914 | Ga0207671_10450686 | Ga0207671_104506862 | 213 |
| 215 | 3300025916 | Ga0207663_10117324 | Ga0207663_101173241 | 213 |
| 216 | 3300025917 | Ga0207660_10006797 | Ga0207660_100067973 | 213 |
| 217 | 3300025919 | Ga0207657_10000243 | Ga0207657_1000024317 | 213 |
| 218 | 3300025919 | Ga0207657_10001089 | Ga0207657_100010895 | 213 |
| 219 | 3300025919 | Ga0207657_10009569 | Ga0207657_100095693 | 213 |
| 220 | 3300025921 | Ga0207652_10009469 | Ga0207652_100094696 | 213 |
| 221 | 3300025921 | Ga0207652_10125068 | Ga0207652_101250683 | 213 |
| 222 | 3300025923 | Ga0207681_10003923 | Ga0207681_100039234 | 213 |
| 223 | 3300025924 | Ga0207694_10000151 | Ga0207694_1000015137 | 213 |
| 224 | 3300025924 | Ga0207694_10133091 | Ga0207694_101330912 | 213 |
| 225 | 3300025925 | Ga0207650_10127022 | Ga0207650_101270222 | 213 |
| 226 | 3300025927 | Ga0207687_10115730 | Ga0207687_101157302 | 213 |
| 227 | 3300025929 | Ga0207664_10430127 | Ga0207664_104301271 | 213 |
| 228 | 3300025931 | Ga0207644_10018470 | Ga0207644_100184706 | 213 |
| 229 | 3300025931 | Ga0207644_10136614 | Ga0207644_101366142 | 213 |
| 230 | 3300025932 | Ga0207690_10084464 | Ga0207690_100844642 | 213 |
| 231 | 3300025933 | Ga0207706_10378752 | Ga0207706_103787522 | 213 |
| 232 | 3300025934 | Ga0207686_10000752 | Ga0207686_1000075218 | 213 |
| 233 | 3300025935 | Ga0207709_10000306 | Ga0207709_1000030610 | 213 |
| 234 | 3300025935 | Ga0207709_10088599 | Ga0207709_100885993 | 213 |
| 235 | 3300025937 | Ga0207669_10445939 | Ga0207669_104459392 | 213 |
| 236 | 3300025938 | Ga0207704_10000017 | Ga0207704_1000001721 | 213 |
| 237 | 3300025940 | Ga0207691_10024245 | Ga0207691_100242456 | 213 |
| 238 | 3300025940 | Ga0207691_10182874 | Ga0207691_101828744 | 213 |
| 239 | 3300025941 | Ga0207711_10006158 | Ga0207711_100061587 | 213 |
| 240 | 3300025941 | Ga0207711_10008323 | Ga0207711_100083234 | 213 |
| 241 | 3300025942 | Ga0207689_10001243 | Ga0207689_1000124318 | 213 |
| 242 | 3300025945 | Ga0207679_10734349 | Ga0207679_107343491 | 213 |
| 243 | 3300025949 | Ga0207667_10000016 | Ga0207667_10000016373 | 213 |
| 244 | 3300025949 | Ga0207667_10068140 | Ga0207667_100681403 | 213 |
| 245 | 3300025949 | Ga0207667_10072312 | Ga0207667_100723125 | 213 |
| 246 | 3300025949 | Ga0207667_10517255 | Ga0207667_105172552 | 213 |
| 247 | 3300025949 | Ga0207667_10968910 | Ga0207667_109689101 | 213 |
| 248 | 3300025960 | Ga0207651_10000011 | Ga0207651_1000001123 | 213 |
| 249 | 3300025961 | Ga0207712_10120869 | Ga0207712_101208693 | 213 |
| 250 | 3300025961 | Ga0207712_11034237 | Ga0207712_110342371 | 213 |
| 251 | 3300025972 | Ga0207668_10005371 | Ga0207668_100053714 | 213 |
| 252 | 3300025981 | Ga0207640_10000131 | Ga0207640_1000013145 | 213 |
| 253 | 3300025986 | Ga0207658_10077347 | Ga0207658_100773473 | 213 |
| 254 | 3300025986 | Ga0207658_10109003 | Ga0207658_101090032 | 213 |
| 255 | 3300026023 | Ga0207677_10000191 | Ga0207677_1000019112 | 213 |
| 256 | 3300026035 | Ga0207703_10186873 | Ga0207703_101868732 | 213 |
| 257 | 3300026041 | Ga0207639_10083839 | Ga0207639_100838394 | 213 |
| 258 | 3300026041 | Ga0207639_10096409 | Ga0207639_100964093 | 213 |
| 259 | 3300026041 | Ga0207639_10125671 | Ga0207639_101256713 | 213 |
| 260 | 3300026067 | Ga0207678_10006173 | Ga0207678_100061739 | 213 |
| 261 | 3300026067 | Ga0207678_10061807 | Ga0207678_100618073 | 213 |
| 262 | 3300026067 | Ga0207678_10229504 | Ga0207678_102295042 | 213 |
| 263 | 3300026078 | Ga0207702_10001090 | Ga0207702_1000109017 | 213 |
| 264 | 3300026078 | Ga0207702_10012331 | Ga0207702_100123317 | 213 |
| 265 | 3300026078 | Ga0207702_10036410 | Ga0207702_100364103 | 213 |
| 266 | 3300026078 | Ga0207702_10348656 | Ga0207702_103486561 | 213 |
| 267 | 3300026088 | Ga0207641_10002251 | Ga0207641_1000225110 | 213 |
| 268 | 3300026089 | Ga0207648_10000045 | Ga0207648_1000004571 | 213 |
| 269 | 3300026116 | Ga0207674_10074675 | Ga0207674_100746753 | 213 |
| 270 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005624 | 213 |
| 271 | 3300028379 | Ga0268266_10000011 | Ga0268266_10000011208 | 213 |
| 272 | 3300028379 | Ga0268266_10000015 | Ga0268266_10000015410 | 213 |
| 273 | 3300028379 | Ga0268266_10057676 | Ga0268266_100576762 | 213 |
| 274 | 3300028380 | Ga0268265_10556744 | Ga0268265_105567443 | 213 |
| 275 | 3300028381 | Ga0268264_10000029 | Ga0268264_1000002966 | 213 |
| 276 | 3300028381 | Ga0268264_10019594 | Ga0268264_100195943 | 213 |
| 277 | 3300028381 | Ga0268264_10176178 | Ga0268264_101761783 | 213 |
| 278 | 3300028786 | Ga0307517_10098949 | Ga0307517_100989493 | 213 |
| 279 | 3300031649 | Ga0307514_10186246 | Ga0307514_101862462 | 213 |
| 280 | 3300031711 | Ga0265314_10011824 | Ga0265314_100118245 | 213 |
| 281 | 3300033180 | Ga0307510_10005815 | Ga0307510_100058158 | 213 |
| 282 | 3300033180 | Ga0307510_10006432 | Ga0307510_100064326 | 213 |
| 283 | 3300035207 | Ga0373942_0005470 | Ga0373942_0005470_70_711 | 213 |
| 284 | 3300037312 | Ga0395899_0003884 | Ga0395899_0003884_9173_9814 | 213 |
| 285 | 3300037312 | Ga0395899_0101440 | Ga0395899_0101440_147_788 | 213 |
| 286 | 3300037312 | Ga0395899_0123619 | Ga0395899_0123619_842_1486 | 213 |
| 287 | 3300037312 | Ga0395899_0201467 | Ga0395899_0201467_486_1127 | 213 |
| 288 | 3300037418 | Ga0395900_0057951 | Ga0395900_0057951_2040_2681 | 213 |
| 289 | 3300037418 | Ga0395900_0440737 | Ga0395900_0440737_188_829 | 213 |
| 290 | 3300037418 | Ga0395900_0469484 | Ga0395900_0469484_502_1143 | 213 |
| 291 | 3300037466 | Ga0395898_0021949 | Ga0395898_0021949_5809_6450 | 213 |
| 292 | 3300037466 | Ga0395898_0025388 | Ga0395898_0025388_1254_1895 | 213 |
| 293 | 3300037466 | Ga0395898_0026020 | Ga0395898_0026020_3066_3707 | 213 |
| 294 | 3300037466 | Ga0395898_0390883 | Ga0395898_0390883_492_1133 | 213 |
| 295 | 3300037471 | Ga0395905_0016649 | Ga0395905_0016649_3989_4648 | 213 |
| 296 | 3300037471 | Ga0395905_0072835 | Ga0395905_0072835_2408_3049 | 213 |
| 297 | 3300037471 | Ga0395905_0199501 | Ga0395905_0199501_737_1378 | 213 |
| 298 | 3300037853 | Ga0436364_0660992 | Ga0436364_0660992_324_965 | 213 |
| 299 | 3300037853 | Ga0436364_0948570 | Ga0436364_0948570_18_659 | 213 |
| 300 | 3300038443 | Ga0395901_0029819 | Ga0395901_0029819_4516_5157 | 213 |
| 301 | 3300038443 | Ga0395901_0083601 | Ga0395901_0083601_279_935 | 213 |
| 302 | 3300038443 | Ga0395901_0217096 | Ga0395901_0217096_1039_1680 | 213 |
| 303 | 3300038443 | Ga0395901_0243430 | Ga0395901_0243430_335_994 | 213 |
| 304 | 3300038443 | Ga0395901_0355754 | Ga0395901_0355754_284_928 | 213 |
| 305 | 3300039437 | Ga0436365_0269680 | Ga0436365_0269680_1310_1951 | 213 |
| 306 | 3300039437 | Ga0436365_1913462 | Ga0436365_1913462_26_667 | 213 |
| 307 | 3300039438 | Ga0436360_0441467 | Ga0436360_0441467_10_651 | 213 |
| 308 | 3300039450 | Ga0436363_0677543 | Ga0436363_0677543_91_732 | 213 |
| 309 | 3300039450 | Ga0436363_1021666 | Ga0436363_1021666_2824_3465 | 213 |
| 310 | 3300039450 | Ga0436363_1226048 | Ga0436363_1226048_143_784 | 213 |
| 311 | 3300039450 | Ga0436363_1586436 | Ga0436363_1586436_265_906 | 213 |
| 312 | 3300039453 | Ga0436362_0234033 | Ga0436362_0234033_390_1031 | 213 |
| 313 | 3300041462 | Ga0451806_769466 | Ga0451806_769466_922_1587 | 213 |
| 314 | 3300042145 | Ga0450906_023836 | Ga0450906_023836_70_723 | 213 |
| 315 | 3300044656 | Ga0466969_0102483 | Ga0466969_0102483_160_801 | 213 |
| 316 | 3300044658 | Ga0466972_0003234 | Ga0466972_0003234_3877_4518 | 213 |
| 317 | 3300044673 | Ga0453683_0000801 | Ga0453683_0000801_20660_21304 | 213 |
| 318 | 3300044684 | Ga0466966_0042394 | Ga0466966_0042394_386_1027 | 213 |
| 319 | 3300044693 | Ga0466961_0042870 | Ga0466961_0042870_94_735 | 213 |
| 320 | 3300044694 | Ga0466963_0009071 | Ga0466963_0009071_4681_5334 | 213 |
| 321 | 3300044706 | Ga0466964_0001445 | Ga0466964_0001445_6060_6701 | 213 |
| 322 | 3300044706 | Ga0466964_0162068 | Ga0466964_0162068_126_779 | 213 |
| 323 | 3300044719 | Ga0466971_0008648 | Ga0466971_0008648_769_1422 | 213 |
| 324 | 3300044719 | Ga0466971_0328296 | Ga0466971_0328296_43_684 | 213 |
| 325 | 3300044735 | Ga0466968_0188998 | Ga0466968_0188998_266_907 | 213 |
| 326 | 3300044765 | Ga0466970_0075907 | Ga0466970_0075907_517_1158 | 213 |
| 327 | 3300044842 | Ga0466957_0026589 | Ga0466957_0026589_1463_2104 | 213 |
| 328 | 3300044901 | Ga0466960_0005477 | Ga0466960_0005477_3831_4472 | 213 |
| 329 | 3300045049 | Ga0466959_0032302 | Ga0466959_0032302_707_1348 | 213 |
| 330 | 3300045049 | Ga0466959_0545791 | Ga0466959_0545791_11_652 | 213 |
| 331 | 3300045836 | Ga0466958_0005624 | Ga0466958_0005624_1076_1729 | 213 |
| 332 | 3300045836 | Ga0466958_0444421 | Ga0466958_0444421_42_683 | 213 |
| 333 | 3300045976 | Ga0466967_0162044 | Ga0466967_0162044_874_1515 | 213 |
| 334 | 3300045976 | Ga0466967_0179723 | Ga0466967_0179723_1212_1865 | 213 |
| 335 | 3300045976 | Ga0466967_0269304 | Ga0466967_0269304_98_739 | 213 |
| 336 | 3300046452 | Ga0495617_036284 | Ga0495617_036284_174_830 | 213 |
| 337 | 3300046457 | Ga0495590_0088958 | Ga0495590_0088958_210_851 | 213 |
| 338 | 3300046471 | Ga0495650_0000222 | Ga0495650_0000222_65385_66026 | 213 |
| 339 | 3300046499 | Ga0495594_0039549 | Ga0495594_0039549_168_809 | 213 |
| 340 | 3300046506 | Ga0495583_0130346 | Ga0495583_0130346_266_907 | 213 |
| 341 | 3300046507 | Ga0495606_0101908 | Ga0495606_0101908_179_820 | 213 |
| 342 | 3300046507 | Ga0495606_0143482 | Ga0495606_0143482_637_1278 | 213 |
| 343 | 3300046519 | Ga0495632_0196453 | Ga0495632_0196453_115_768 | 213 |
| 344 | 3300046530 | Ga0495654_0081268 | Ga0495654_0081268_537_1178 | 213 |
| 345 | 3300046557 | Ga0495622_0005502 | Ga0495622_0005502_3356_3997 | 213 |
| 346 | 3300046616 | Ga0495668_0016110 | Ga0495668_0016110_3196_3843 | 213 |
| 347 | 3300046660 | Ga0495625_0065584 | Ga0495625_0065584_1499_2143 | 213 |
| 348 | 3300046683 | Ga0495658_0273837 | Ga0495658_0273837_49_690 | 213 |
| 349 | 3300046694 | Ga0495649_0075930 | Ga0495649_0075930_888_1529 | 213 |
| 350 | 3300046810 | Ga0495660_0019291 | Ga0495660_0019291_2990_3637 | 213 |
| 351 | 3300047320 | Ga0495672_0007483 | Ga0495672_0007483_3144_3785 | 213 |
| 352 | 3300048904 | Ga0496101_0262594 | Ga0496101_0262594_508_1149 | 213 |
| 353 | 3300048904 | Ga0496101_0426134 | Ga0496101_0426134_394_1035 | 213 |
| 354 | 3300048905 | Ga0496102_0000010 | Ga0496102_0000010_145633_146274 | 213 |
| 355 | 3300048905 | Ga0496102_0228549 | Ga0496102_0228549_264_905 | 213 |
| 356 | 3300048906 | Ga0496103_0000029 | Ga0496103_0000029_34342_34983 | 213 |
| 357 | 3300048906 | Ga0496103_0456465 | Ga0496103_0456465_134_775 | 213 |
| 358 | 3300048907 | Ga0496104_0090730 | Ga0496104_0090730_182_823 | 213 |
| 359 | 3300048911 | Ga0496108_0274286 | Ga0496108_0274286_598_1239 | 213 |
| 360 | 3300048918 | Ga0496115_0029447 | Ga0496115_0029447_2192_2833 | 213 |
| 361 | 3300048919 | Ga0496116_0000362 | Ga0496116_0000362_57376_58017 | 213 |
| 362 | 3300048919 | Ga0496116_0231113 | Ga0496116_0231113_54_695 | 213 |
| 363 | 3300048920 | Ga0496117_0000037 | Ga0496117_0000037_146235_146876 | 213 |
| 364 | 3300048920 | Ga0496117_0013834 | Ga0496117_0013834_268_909 | 213 |
| 365 | 3300048920 | Ga0496117_0016487 | Ga0496117_0016487_1401_2297 | 213 |
| 366 | 3300048920 | Ga0496117_0044251 | Ga0496117_0044251_1648_2289 | 213 |
| 367 | 3300048920 | Ga0496117_0052653 | Ga0496117_0052653_947_1588 | 213 |
| 368 | 3300048921 | Ga0496118_0000034 | Ga0496118_0000034_144039_144680 | 213 |
| 369 | 3300048921 | Ga0496118_0000219 | Ga0496118_0000219_64513_65154 | 213 |
| 370 | 3300048922 | Ga0496119_0005688 | Ga0496119_0005688_9522_10163 | 213 |
| 371 | 3300048922 | Ga0496119_0043503 | Ga0496119_0043503_1304_1957 | 213 |
| 372 | 3300048923 | Ga0496120_0041879 | Ga0496120_0041879_1097_1738 | 213 |
| 373 | 3300048924 | Ga0496121_0000852 | Ga0496121_0000852_11490_12131 | 213 |
| 374 | 3300048924 | Ga0496121_0015667 | Ga0496121_0015667_4948_5589 | 213 |
| 375 | 3300048924 | Ga0496121_0017384 | Ga0496121_0017384_2189_2830 | 213 |
| 376 | 3300048924 | Ga0496121_0037187 | Ga0496121_0037187_784_1425 | 213 |
| 377 | 3300048925 | Ga0496122_0009902 | Ga0496122_0009902_3016_3660 | 213 |
| 378 | 3300048926 | Ga0496123_0009041 | Ga0496123_0009041_84_728 | 213 |
| 379 | 3300048927 | Ga0496124_0000033 | Ga0496124_0000033_144039_144680 | 213 |
| 380 | 3300048928 | Ga0496125_0036315 | Ga0496125_0036315_2274_2975 | 213 |
| 381 | 3300048929 | Ga0496126_0046585 | Ga0496126_0046585_504_1205 | 213 |
| 382 | 3300049568 | Ga0501031_0000014 | Ga0501031_0000014_99852_100496 | 213 |
| 383 | 3300049569 | Ga0501032_0000015 | Ga0501032_0000015_99852_100496 | 213 |
| 384 | 3300049570 | Ga0501033_0000023 | Ga0501033_0000023_99852_100496 | 213 |
| 385 | 3300049570 | Ga0501033_0006189 | Ga0501033_0006189_1019_1672 | 213 |
| 386 | 3300049570 | Ga0501033_0040002 | Ga0501033_0040002_2216_2956 | 213 |
| 387 | 3300049570 | Ga0501033_0145189 | Ga0501033_0145189_944_1588 | 213 |
| 388 | 3300049571 | Ga0501034_0000073 | Ga0501034_0000073_76242_76886 | 213 |
| 389 | 3300049571 | Ga0501034_0415317 | Ga0501034_0415317_228_869 | 213 |
| 390 | 3300049572 | Ga0501036_0000002 | Ga0501036_0000002_99852_100496 | 213 |
| 391 | 3300049573 | Ga0501037_0000048 | Ga0501037_0000048_76260_76904 | 213 |
| 392 | 3300049573 | Ga0501037_0239892 | Ga0501037_0239892_61_708 | 213 |
| 393 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_165973_166617 | 213 |
| 394 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_181896_182540 | 213 |
| 395 | 3300049576 | Ga0501040_0006045 | Ga0501040_0006045_276_920 | 213 |
| 396 | 3300049579 | Ga0501043_0000298 | Ga0501043_0000298_17694_18338 | 213 |
| 397 | 3300049579 | Ga0501043_0112717 | Ga0501043_0112717_1408_2064 | 213 |
| 398 | 3300049580 | Ga0501046_0053183 | Ga0501046_0053183_2314_2958 | 213 |
| 399 | 3300049581 | Ga0501047_0000352 | Ga0501047_0000352_7063_7707 | 213 |
| 400 | 3300049581 | Ga0501047_0101478 | Ga0501047_0101478_1792_2433 | 213 |
| 401 | 3300049581 | Ga0501047_0141378 | Ga0501047_0141378_811_1458 | 213 |
| 402 | 3300049582 | Ga0501048_0350370 | Ga0501048_0350370_332_976 | 213 |
| 403 | 3300049582 | Ga0501048_0386376 | Ga0501048_0386376_224_868 | 213 |
| 404 | 3300049586 | Ga0501070_0064231 | Ga0501070_0064231_481_1125 | 213 |
| 405 | 3300049586 | Ga0501070_0532682 | Ga0501070_0532682_167_829 | 213 |
| 406 | 3300049586 | Ga0501070_0746401 | Ga0501070_0746401_30_677 | 213 |
| 407 | 3300049588 | Ga0501072_0281007 | Ga0501072_0281007_460_1104 | 213 |
| 408 | 3300049589 | Ga0501073_0417183 | Ga0501073_0417183_70_732 | 213 |
| 409 | 3300049592 | Ga0501076_0302777 | Ga0501076_0302777_253_900 | 213 |
| 410 | 3300049742 | Ga0501080_0159839 | Ga0501080_0159839_1221_1883 | 213 |
| 411 | 3300049744 | Ga0501083_0094508 | Ga0501083_0094508_432_1094 | 213 |
| 412 | 3300049822 | Ga0501035_0000022 | Ga0501035_0000022_85365_86009 | 213 |
| 413 | 3300049822 | Ga0501035_0020875 | Ga0501035_0020875_1165_1818 | 213 |
| 414 | 3300049822 | Ga0501035_0030851 | Ga0501035_0030851_3220_3867 | 213 |
| 415 | 3300049822 | Ga0501035_0142663 | Ga0501035_0142663_1383_2027 | 213 |
| 416 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_192613_193257 | 213 |
| 417 | 3300049823 | Ga0501044_0155864 | Ga0501044_0155864_832_1479 | 213 |
| 418 | 3300049823 | Ga0501044_0248750 | Ga0501044_0248750_826_1488 | 213 |
| 419 | 3300050496 | nmdc:mga07m45_130335_c1 | nmdc:mga07m45_130335_c1_440_1102 | 213 |
| 420 | 3300053087 | Ga0500643_007300 | Ga0500643_007300_1678_2319 | 213 |
| 421 | 3300053087 | Ga0500643_016935 | Ga0500643_016935_197_850 | 213 |
| 422 | 3300053108 | Ga0500562_034959 | Ga0500562_034959_383_1024 | 213 |
| 423 | 3300053117 | Ga0500593_195791 | Ga0500593_195791_28_669 | 213 |
| 424 | 3300053136 | Ga0500559_0126312 | Ga0500559_0126312_18_668 | 213 |
| 425 | 3300053156 | Ga0500622_0002639 | Ga0500622_0002639_9232_9873 | 213 |
| 426 | 3300053178 | Ga0500637_0207162 | Ga0500637_0207162_72_713 | 213 |
| 427 | 3300053730 | Ga0500645_062834 | Ga0500645_062834_415_1062 | 213 |
| 428 | 3300054114 | Ga0501084_0491759 | Ga0501084_0491759_205_849 | 213 |
| 429 | 3300060353 | Ga0501082_0507578 | Ga0501082_0507578_323_985 | 213 |
| 430 | 3300061719 | Ga0466962_0000734 | Ga0466962_0000734_2184_2837 | 213 |
| 431 | 3300061734 | Ga0530510_0404654 | Ga0530510_0404654_101_745 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8659 | 1 | 213 |
| 3kgy-assembly1.cif.gz_B | crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution | 0.8543 | 1 | 213 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.814 | 1 | 213 |
| 2xw7-assembly1.cif.gz_B | structure of mycobacterium smegmatis putative reductase ms0308 | 0.7991 | 1 | 213 |
| 3tqb-assembly1.cif.gz_A | structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate | 0.7389 | 1 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8758 | 2 | 213 | 3.40.430.10 |
| 3kgyB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.844 | 2 | 213 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.814 | 1 | 213 | 3.40.430.10 |
| 2xw7B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7991 | 1 | 213 | 3.40.430.10 |
| af_O59697_47_319_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7885 | 195 | 213 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B9YSD1-F1-model_v4 | Dihydrofolate reductase | 0.9919 | 1 | 213 |
GO:0008703
GO:0009231 |
| AF-A0A154IKA4-F1-model_v4 | Deaminase | 0.9914 | 1 | 213 |
GO:0008703
GO:0009231 |
| AF-A0A158CQV0-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9913 | 1 | 213 |
GO:0008703
GO:0009231 |
| AF-A0A2A6JSK4-F1-model_v4 | Deaminase | 0.9906 | 1 | 213 |
GO:0008703
GO:0009231 |
| AF-A0A239M7J6-F1-model_v4 | RibD C-terminal domain-containing protein | 0.9901 | 1 | 213 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar