F442544

General Info

Members Datasets Scaffolds Average Seq Length
432 167 432 123

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_101383246|Ga0070694_1013832461
Length 140
Sequence LSASTRHRRRRPVRLRSVPKVVAVIGASNNRSKFGNRAVRAFRQQGYTVVPINPHEAEVEGLKAYASVLDVPGTVDMASLYVPPEIGVRVIEEIARKGIAEVWLNPGAESDALIARARALTIQPIVACSIVAIGENPYAF

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.15
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10260629 3300005290 Bacteria 938
2 Ga0065715_10004099 3300005293 Bacteria 4789
3 Ga0065715_10956052 3300005293 Unclassified 558
4 Ga0065715_10966283 3300005293 Bacteria 555
5 Ga0065707_10373685 3300005295 Bacteria 886
6 Ga0065707_10584570 3300005295 Bacteria 700
7 Ga0065707_10597712 3300005295 Bacteria 692
8 Ga0065707_10951226 3300005295 Unclassified 552
9 Ga0070676_10000772 3300005328 Bacteria 15769
10 Ga0070676_10063587 3300005328 Bacteria 2199
11 Ga0070676_10544442 3300005328 Unclassified 830
12 Ga0070676_10608862 3300005328 Bacteria 789
13 Ga0070676_10946558 3300005328 Unclassified 644
14 Ga0070676_11463921 3300005328 Bacteria 525
15 Ga0070690_100015319 3300005330 Bacteria 4571
16 Ga0070670_100011102 3300005331 Bacteria 7695
17 Ga0070670_100320075 3300005331 Unclassified 1359
18 Ga0070670_100540853 3300005331 Bacteria 1039
19 Ga0068869_100028433 3300005334 Bacteria 3906
20 Ga0068869_100407358 3300005334 Unclassified 1120
21 Ga0070680_100175531 3300005336 Bacteria 1804
22 Ga0070680_100735323 3300005336 Unclassified 849
23 Ga0068868_100203321 3300005338 Bacteria 1652
24 Ga0068868_100805350 3300005338 Unclassified 848
25 Ga0070689_100132414 3300005340 Bacteria 2000
26 Ga0070691_10003323 3300005341 Bacteria 7216
27 Ga0070687_100039922 3300005343 Bacteria 2362
28 Ga0070687_100082971 3300005343 Bacteria 1754
29 Ga0070687_100706132 3300005343 Unclassified 705
30 Ga0070661_100305106 3300005344 Bacteria 1240
31 Ga0070692_10611016 3300005345 Bacteria 723
32 Ga0070692_11096855 3300005345 Bacteria 562
33 Ga0070668_100093197 3300005347 Bacteria 2376
34 Ga0070668_100827339 3300005347 Unclassified 824
35 Ga0070669_100011922 3300005353 Bacteria 6167
36 Ga0070669_100239955 3300005353 Bacteria 1440
37 Ga0070669_100314854 3300005353 Bacteria 1262
38 Ga0070669_101022610 3300005353 Bacteria 710
39 Ga0070675_100000134 3300005354 Bacteria 44325
40 Ga0070675_100002703 3300005354 Bacteria 13321
41 Ga0070675_100004521 3300005354 Bacteria 10620
42 Ga0070675_100010078 3300005354 Bacteria 7367
43 Ga0070675_100013460 3300005354 Bacteria 6429
44 Ga0070675_100093147 3300005354 Bacteria 2526
45 Ga0070675_101769947 3300005354 Unclassified 570
46 Ga0070671_100395081 3300005355 Bacteria 1182
47 Ga0070671_101691815 3300005355 Unclassified 561
48 Ga0070674_100115119 3300005356 Unclassified 1982
49 Ga0070674_100271409 3300005356 Bacteria 1341
50 Ga0070674_100702120 3300005356 Bacteria 865
51 Ga0070673_100038290 3300005364 Bacteria 3661
52 Ga0070673_100451104 3300005364 Bacteria 1157
53 Ga0070673_100579407 3300005364 Bacteria 1022
54 Ga0070673_100790386 3300005364 Unclassified 876
55 Ga0070688_100152885 3300005365 Bacteria 1579
56 Ga0070688_100215101 3300005365 Bacteria 1352
57 Ga0070667_101430512 3300005367 Bacteria 649
58 Ga0070667_101701867 3300005367 Unclassified 593
59 Ga0070714_100071785 3300005435 Bacteria 2995
60 Ga0070701_10029606 3300005438 Bacteria 2702
61 Ga0070701_10159400 3300005438 Bacteria 1306
62 Ga0070701_11033050 3300005438 Unclassified 575
63 Ga0070705_100161315 3300005440 Bacteria 1499
64 Ga0070705_100613172 3300005440 Unclassified 843
65 Ga0070705_100702104 3300005440 Unclassified 795
66 Ga0070700_100115552 3300005441 Bacteria 1791
67 Ga0070700_100287487 3300005441 Bacteria 1195
68 Ga0070700_100348072 3300005441 Bacteria 1098
69 Ga0070700_100351532 3300005441 Bacteria 1093
70 Ga0070694_100108561 3300005444 Bacteria 1974
71 Ga0070694_100198605 3300005444 Bacteria 1493
72 Ga0070694_100214432 3300005444 Bacteria 1441
73 Ga0070694_101063715 3300005444 Bacteria 674
74 Ga0070694_101383246 3300005444 Unclassified 593
75 Ga0070708_101786835 3300005445 Unclassified 571
76 Ga0070708_102201704 3300005445 Unclassified 509
77 Ga0070678_100316312 3300005456 Bacteria 1332
78 Ga0070662_100375089 3300005457 Bacteria 1170
79 Ga0070662_100475477 3300005457 Bacteria 1040
80 Ga0070662_100625686 3300005457 Bacteria 907
81 Ga0068867_100002471 3300005459 Bacteria 12999
82 Ga0068867_100077859 3300005459 Bacteria 2493
83 Ga0068867_101680600 3300005459 Bacteria 595
84 Ga0070706_100271019 3300005467 Bacteria 1584
85 Ga0070706_100675143 3300005467 Bacteria 959
86 Ga0070706_100806930 3300005467 Bacteria 869
87 Ga0070707_100225396 3300005468 Bacteria 1825
88 Ga0070698_100237049 3300005471 Bacteria 1757
89 Ga0070698_100245859 3300005471 Bacteria 1722
90 Ga0070698_100433514 3300005471 Bacteria 1249
91 Ga0070698_100584547 3300005471 Bacteria 1057
92 Ga0070699_100995075 3300005518 Bacteria 769
93 Ga0070699_101207953 3300005518 Bacteria 694
94 Ga0070699_101271942 3300005518 Unclassified 675
95 Ga0070697_100010261 3300005536 Bacteria 7299
96 Ga0070697_100525901 3300005536 Viruses 1036
97 Ga0070697_101066377 3300005536 Bacteria 719
98 Ga0070697_102089153 3300005536 Unclassified 507
99 Ga0070672_100103909 3300005543 Unclassified 2308
100 Ga0070672_100125883 3300005543 Bacteria 2102
101 Ga0070672_101064989 3300005543 Unclassified 718
102 Ga0070686_100778376 3300005544 Bacteria 769
103 Ga0070695_100016394 3300005545 Bacteria 4483
104 Ga0070695_100045021 3300005545 Bacteria 2811
105 Ga0070695_100071548 3300005545 Bacteria 2272
106 Ga0070696_100205875 3300005546 Bacteria 1471
107 Ga0070696_100433920 3300005546 Bacteria 1034
108 Ga0070696_100662132 3300005546 Unclassified 847
109 Ga0070696_100970282 3300005546 Unclassified 708
110 Ga0070693_100487929 3300005547 Bacteria 872
111 Ga0070665_100003241 3300005548 Bacteria 17488
112 Ga0070704_100006526 3300005549 Bacteria 6880
113 Ga0070704_100028176 3300005549 Bacteria 3733
114 Ga0070704_100043538 3300005549 Bacteria 3113
115 Ga0070704_100195300 3300005549 Bacteria 1630
116 Ga0070704_100571885 3300005549 Bacteria 990
117 Ga0070704_100719464 3300005549 Viruses 887
118 Ga0070664_100004179 3300005564 Bacteria 11604
119 Ga0070664_100576940 3300005564 Bacteria 1042
120 Ga0068857_101222967 3300005577 Bacteria 728
121 Ga0068854_100027196 3300005578 Bacteria 3940
122 Ga0070702_100012752 3300005615 Bacteria 4226
123 Ga0070702_101249667 3300005615 Unclassified 601
124 Ga0068852_101385923 3300005616 Bacteria 725
125 Ga0068859_100118683 3300005617 Bacteria 2711
126 Ga0068859_100162151 3300005617 Bacteria 2315
127 Ga0068859_100707802 3300005617 Bacteria 1098
128 Ga0068859_100896007 3300005617 Bacteria 972
129 Ga0068859_101166858 3300005617 Bacteria 848
130 Ga0068864_100206721 3300005618 Bacteria 1806
131 Ga0068864_100506087 3300005618 Bacteria 1163
132 Ga0068866_10031285 3300005718 Bacteria 2562
133 Ga0068866_10768834 3300005718 Unclassified 667
134 Ga0068861_100084604 3300005719 Bacteria 2490
135 Ga0068861_100161943 3300005719 Bacteria 1846
136 Ga0068861_100450249 3300005719 Unclassified 1153
137 Ga0068861_100547816 3300005719 Bacteria 1054
138 Ga0068861_100709909 3300005719 Unclassified 935
139 Ga0068861_101494574 3300005719 Bacteria 663
140 Ga0068870_10182186 3300005840 Unclassified 1262
141 Ga0068863_100841998 3300005841 Bacteria 916
142 Ga0068858_100053011 3300005842 Bacteria 3754
143 Ga0068858_100121838 3300005842 Bacteria 2439
144 Ga0068858_100135937 3300005842 Bacteria 2307
145 Ga0068858_100270268 3300005842 Bacteria 1618
146 Ga0068858_100781899 3300005842 Bacteria 931
147 Ga0068858_101571539 3300005842 Bacteria 649
148 Ga0068860_100031680 3300005843 Bacteria 5083
149 Ga0068860_100181362 3300005843 Bacteria 2035
150 Ga0068860_100308750 3300005843 Bacteria 1551
151 Ga0068862_100091363 3300005844 Bacteria 2651
152 Ga0068862_100112959 3300005844 Bacteria 2386
153 Ga0068862_100338178 3300005844 Bacteria 1394
154 Ga0068862_100393159 3300005844 Bacteria 1296
155 Ga0068862_100533218 3300005844 Bacteria 1119
156 Ga0068862_101120995 3300005844 Bacteria 783
157 Ga0068862_102065677 3300005844 Unclassified 581
158 Ga0068862_102660205 3300005844 Unclassified 512
159 Ga0097621_100103884 3300006237 Bacteria 2394
160 Ga0097621_100349306 3300006237 Unclassified 1315
161 Ga0097621_100608972 3300006237 Bacteria 999
162 Ga0068871_100480960 3300006358 Bacteria 1117
163 Ga0068871_100509066 3300006358 Unclassified 1086
164 Ga0068871_100898158 3300006358 Bacteria 821
165 Ga0075431_100027642 3300006847 Bacteria 5822
166 Ga0075433_10094811 3300006852 Bacteria 2641
167 Ga0075433_10180539 3300006852 Bacteria 1878
168 Ga0075433_10221383 3300006852 Bacteria 1681
169 Ga0075433_10484241 3300006852 Unclassified 1090
170 Ga0075433_10551277 3300006852 Bacteria 1013
171 Ga0075434_100006512 3300006871 Bacteria 10709
172 Ga0075434_100453016 3300006871 Bacteria 1304
173 Ga0075434_100456080 3300006871 Bacteria 1299
174 Ga0075434_100550042 3300006871 Bacteria 1174
175 Ga0075434_100570862 3300006871 Bacteria 1151
176 Ga0075434_100860805 3300006871 Bacteria 922
177 Ga0075434_101310961 3300006871 Bacteria 735
178 Ga0068865_100116681 3300006881 Bacteria 1978
179 Ga0068865_100146897 3300006881 Bacteria 1784
180 Ga0068865_100371654 3300006881 Bacteria 1164
181 Ga0068865_100715980 3300006881 Bacteria 857
182 Ga0068865_102176477 3300006881 Bacteria 505
183 Ga0075436_100201556 3300006914 Bacteria 1409
184 Ga0075436_100347949 3300006914 Bacteria 1068
185 Ga0075436_100733439 3300006914 Unclassified 733
186 Ga0097620_100118692 3300006931 Bacteria 2711
187 Ga0097620_100162151 3300006931 Bacteria 2315
188 Ga0097620_100707769 3300006931 Bacteria 1098
189 Ga0097620_100895998 3300006931 Bacteria 972
190 Ga0097620_101166924 3300006931 Bacteria 848
191 Ga0075435_100001872 3300007076 Bacteria 13688
192 Ga0075435_100002472 3300007076 Bacteria 12288
193 Ga0111539_10006183 3300009094 Bacteria 15445
194 Ga0111539_10180224 3300009094 Bacteria 2468
195 Ga0111539_10325037 3300009094 Bacteria 1790
196 Ga0111539_11855493 3300009094 Bacteria 699
197 Ga0105245_11180841 3300009098 Unclassified 813
198 Ga0105247_10016032 3300009101 Bacteria 4489
199 Ga0105247_10954489 3300009101 Bacteria 666
200 Ga0114129_10002338 3300009147 Bacteria 26309
201 Ga0114129_10003015 3300009147 Bacteria 23608
202 Ga0114129_10008349 3300009147 Bacteria 14765
203 Ga0114129_10011933 3300009147 Bacteria 12357
204 Ga0114129_10267176 3300009147 Bacteria 2290
205 Ga0114129_10332135 3300009147 Bacteria 2018
206 Ga0114129_10521056 3300009147 Bacteria 1550
207 Ga0114129_10720094 3300009147 Bacteria 1280
208 Ga0114129_12343899 3300009147 Bacteria 640
209 Ga0105243_10018413 3300009148 Bacteria 5290
210 Ga0105243_10040910 3300009148 Bacteria 3623
211 Ga0105243_11110617 3300009148 Unclassified 799
212 Ga0105243_11319373 3300009148 Bacteria 739
213 Ga0105243_11321441 3300009148 Bacteria 739
214 Ga0105242_10003811 3300009176 Bacteria 11728
215 Ga0105242_10275423 3300009176 Bacteria 1526
216 Ga0105242_10372413 3300009176 Bacteria 1325
217 Ga0105242_10579698 3300009176 Bacteria 1080
218 Ga0105248_10475992 3300009177 Bacteria 1408
219 Ga0105248_10497640 3300009177 Bacteria 1374
220 Ga0105248_10530983 3300009177 Unclassified 1327
221 Ga0105248_10643888 3300009177 Bacteria 1196
222 Ga0105248_10836842 3300009177 Bacteria 1039
223 Ga0105248_12188994 3300009177 Bacteria 629
224 Ga0105248_12318309 3300009177 Unclassified 611
225 Ga0105238_10009232 3300009551 Bacteria 9869
226 Ga0105249_10076304 3300009553 Bacteria 3106
227 Ga0105249_10136146 3300009553 Bacteria 2350
228 Ga0105249_10392426 3300009553 Bacteria 1416
229 Ga0105249_11001182 3300009553 Bacteria 904
230 Ga0105249_11319282 3300009553 Unclassified 793
231 Ga0105249_12374363 3300009553 Bacteria 603
232 Ga0105246_10095252 3300011119 Bacteria 2155
233 Ga0105246_10468986 3300011119 Bacteria 1062
234 Ga0157374_10775031 3300013296 Bacteria 974
235 Ga0157378_10355253 3300013297 Archaea 1433
236 Ga0163162_11186418 3300013306 Unclassified 866
237 Ga0163162_11605626 3300013306 Unclassified 742
238 Ga0157375_11716411 3300013308 Bacteria 744
239 Ga0157375_12437788 3300013308 Unclassified 624
240 Ga0157375_13280316 3300013308 Bacteria 539
241 Ga0163163_10013225 3300014325 Bacteria 7546
242 Ga0163163_10031372 3300014325 Bacteria 5128
243 Ga0157380_10007495 3300014326 Bacteria 7748
244 Ga0157380_10063926 3300014326 Bacteria 2952
245 Ga0157380_10205100 3300014326 Bacteria 1752
246 Ga0157380_10246992 3300014326 Bacteria 1613
247 Ga0157380_10268796 3300014326 Bacteria 1553
248 Ga0157380_10309954 3300014326 Bacteria 1458
249 Ga0157380_10951018 3300014326 Unclassified 889
250 Ga0157380_11489910 3300014326 Bacteria 729
251 Ga0157377_10092174 3300014745 Bacteria 1791
252 Ga0157379_10017769 3300014968 Bacteria 6265
253 Ga0157379_11206798 3300014968 Bacteria 728
254 Ga0163161_10563171 3300017792 Bacteria 935
255 Ga0163161_10719320 3300017792 Bacteria 833
256 Ga0207656_10019414 3300025321 Bacteria 2689
257 Ga0207682_10051023 3300025893 Bacteria 1712
258 Ga0207642_10036146 3300025899 Bacteria 2117
259 Ga0207642_10211369 3300025899 Bacteria 1078
260 Ga0207680_10790538 3300025903 Unclassified 680
261 Ga0207699_10003219 3300025906 Bacteria 7777
262 Ga0207645_10006143 3300025907 Bacteria 8627
263 Ga0207645_10009358 3300025907 Bacteria 6782
264 Ga0207645_10026243 3300025907 Unclassified 3765
265 Ga0207645_10550974 3300025907 Bacteria 782
266 Ga0207645_10582533 3300025907 Bacteria 759
267 Ga0207645_10776749 3300025907 Unclassified 651
268 Ga0207643_10175007 3300025908 Bacteria 1297
269 Ga0207643_10227997 3300025908 Unclassified 1142
270 Ga0207643_10383590 3300025908 Bacteria 886
271 Ga0207684_10217424 3300025910 Unclassified 1649
272 Ga0207684_10478228 3300025910 Bacteria 1068
273 Ga0207684_10928632 3300025910 Unclassified 730
274 Ga0207693_10926389 3300025915 Bacteria 668
275 Ga0207660_10662149 3300025917 Unclassified 851
276 Ga0207662_10128175 3300025918 Bacteria 1597
277 Ga0207662_10650109 3300025918 Unclassified 736
278 Ga0207646_10151441 3300025922 Bacteria 2092
279 Ga0207646_10591322 3300025922 Unclassified 996
280 Ga0207681_10045885 3300025923 Bacteria 2937
281 Ga0207681_10082634 3300025923 Bacteria 2271
282 Ga0207681_10489670 3300025923 Bacteria 1005
283 Ga0207681_10581934 3300025923 Bacteria 923
284 Ga0207694_10105278 3300025924 Bacteria 2239
285 Ga0207650_10023087 3300025925 Bacteria 4410
286 Ga0207650_11141134 3300025925 Unclassified 663
287 Ga0207659_10003405 3300025926 Bacteria 9533
288 Ga0207659_10005870 3300025926 Bacteria 7492
289 Ga0207659_10011934 3300025926 Bacteria 5503
290 Ga0207659_10021247 3300025926 Bacteria 4305
291 Ga0207664_10226592 3300025929 Bacteria 1623
292 Ga0207644_10465135 3300025931 Bacteria 1040
293 Ga0207706_10299928 3300025933 Bacteria 1400
294 Ga0207706_10381794 3300025933 Bacteria 1222
295 Ga0207686_10049431 3300025934 Bacteria 2610
296 Ga0207686_10206304 3300025934 Bacteria 1410
297 Ga0207709_10018269 3300025935 Bacteria 3925
298 Ga0207669_10078930 3300025937 Bacteria 2099
299 Ga0207669_10251089 3300025937 Bacteria 1317
300 Ga0207669_10542144 3300025937 Unclassified 937
301 Ga0207704_10182611 3300025938 Unclassified 1517
302 Ga0207704_10327150 3300025938 Bacteria 1185
303 Ga0207691_10041792 3300025940 Bacteria 4230
304 Ga0207691_10061776 3300025940 Bacteria 3403
305 Ga0207691_10062653 3300025940 Bacteria 3374
306 Ga0207691_10117284 3300025940 Bacteria 2362
307 Ga0207691_10173697 3300025940 Bacteria 1886
308 Ga0207691_10963228 3300025940 Bacteria 713
309 Ga0207711_10134013 3300025941 Bacteria 2223
310 Ga0207711_10473934 3300025941 Unclassified 1166
311 Ga0207689_10004999 3300025942 Bacteria 11942
312 Ga0207679_10037705 3300025945 Bacteria 3438
313 Ga0207679_10456875 3300025945 Bacteria 1133
314 Ga0207651_10346533 3300025960 Bacteria 1249
315 Ga0207651_10391409 3300025960 Bacteria 1180
316 Ga0207712_10075642 3300025961 Bacteria 2435
317 Ga0207668_10081944 3300025972 Bacteria 2342
318 Ga0207668_10163891 3300025972 Bacteria 1735
319 Ga0207668_10827281 3300025972 Unclassified 821
320 Ga0207640_10075431 3300025981 Bacteria 2286
321 Ga0207640_10127977 3300025981 Bacteria 1831
322 Ga0207658_10657834 3300025986 Bacteria 945
323 Ga0207677_10407515 3300026023 Bacteria 1154
324 Ga0207677_10796073 3300026023 Bacteria 846
325 Ga0207677_11416726 3300026023 Unclassified 640
326 Ga0207703_10035293 3300026035 Bacteria 3974
327 Ga0207703_10167725 3300026035 Bacteria 1928
328 Ga0207703_10419437 3300026035 Bacteria 1245
329 Ga0207703_11515332 3300026035 Bacteria 645
330 Ga0207708_10004832 3300026075 Bacteria 9928
331 Ga0207708_10056354 3300026075 Bacteria 2998
332 Ga0207708_10157195 3300026075 Bacteria 1793
333 Ga0207708_11000505 3300026075 Bacteria 726
334 Ga0207641_10806270 3300026088 Bacteria 929
335 Ga0207641_11302814 3300026088 Bacteria 727
336 Ga0207648_10000427 3300026089 Bacteria 46398
337 Ga0207648_10029767 3300026089 Bacteria 4842
338 Ga0207648_10411048 3300026089 Bacteria 1227
339 Ga0207676_10065565 3300026095 Bacteria 2892
340 Ga0207676_10468962 3300026095 Bacteria 1190
341 Ga0207676_10595011 3300026095 Bacteria 1062
342 Ga0207674_10400941 3300026116 Bacteria 1326
343 Ga0207674_11840701 3300026116 Bacteria 572
344 Ga0207675_100029356 3300026118 Bacteria 5125
345 Ga0207675_100105870 3300026118 Bacteria 2651
346 Ga0207675_100173276 3300026118 Unclassified 2063
347 Ga0207675_100239376 3300026118 Bacteria 1753
348 Ga0207675_100344818 3300026118 Bacteria 1459
349 Ga0207675_100490314 3300026118 Bacteria 1222
350 Ga0207683_10135105 3300026121 Bacteria 2220
351 Ga0207683_11502745 3300026121 Bacteria 622
352 Ga0207428_10238569 3300027907 Bacteria 1359
353 Ga0268266_10014977 3300028379 Bacteria 6656
354 Ga0268265_10050623 3300028380 Bacteria 3130
355 Ga0268265_10169218 3300028380 Bacteria 1865
356 Ga0268265_10439933 3300028380 Bacteria 1215
357 Ga0268265_11075306 3300028380 Unclassified 798
358 Ga0268264_10040918 3300028381 Bacteria 3830
359 Ga0268264_10105102 3300028381 Bacteria 2462
360 Ga0268264_10112417 3300028381 Bacteria 2388
361 Ga0268264_10290521 3300028381 Unclassified 1535
362 Ga0268264_10399415 3300028381 Unclassified 1320
363 Ga0307517_10466016 3300028786 Bacteria 651
364 Ga0265314_10022431 3300031711 Bacteria 4836
365 Ga0307416_102302584 3300032002 Bacteria 639
366 Ga0373958_0086853 3300034819 Bacteria 716
367 Ga0373947_0548401 3300035725 Unclassified 787
368 Ga0373925_0744545 3300037068 Bacteria 808
369 Ga0373925_0928399 3300037068 Bacteria 717
370 Ga0373925_1413131 3300037068 Bacteria 570
371 Ga0451577_0043391 3300042876 Bacteria 4028
372 Ga0466963_0053935 3300044694 Bacteria 2671
373 Ga0453684_0028794 3300044712 Bacteria 7910
374 Ga0453684_2072960 3300044712 Unclassified 571
375 Ga0466967_0171270 3300045976 Bacteria 2043
376 Ga0495603_0220265 3300046455 Bacteria 1095
377 Ga0495639_0263159 3300046475 Bacteria 855
378 Ga0495608_0310200 3300046511 Bacteria 976
379 Ga0495622_0295680 3300046557 Unclassified 706
380 Ga0495657_0820585 3300046675 Unclassified 531
381 Ga0495658_0052328 3300046683 Bacteria 2316
382 Ga0495658_0105500 3300046683 Bacteria 1688
383 Ga0495613_0211846 3300046689 Bacteria 1363
384 Ga0495581_0587888 3300047315 Bacteria 645
385 Ga0495674_0939579 3300047319 Bacteria 666
386 Ga0495676_0564828 3300047321 Unclassified 743
387 Ga0496104_0364244 3300048907 Bacteria 1358
388 Ga0496104_0469228 3300048907 Bacteria 1170
389 Ga0496106_1428186 3300048909 Unclassified 534
390 Ga0496112_0633083 3300048915 Bacteria 1000
391 Ga0496113_0113361 3300048916 Bacteria 2113
392 Ga0496114_0158937 3300048917 Bacteria 1964
393 Ga0496114_1142127 3300048917 Unclassified 664
394 Ga0501047_0582822 3300049581 Bacteria 941
395 Ga0501072_0759900 3300049588 Bacteria 760
396 nmdc:mga05p37_142887_c1 3300050507 Bacteria 2931
397 nmdc:mga05p37_1519075_c1 3300050507 Bacteria 665
398 nmdc:mga05p37_188067_c1 3300050507 Bacteria 2509
399 nmdc:mga05p37_28045_c1 3300050507 Bacteria 6861
400 nmdc:mga05p37_302449_c1 3300050507 Bacteria 1900
401 nmdc:mga05p37_45445_c1 3300050507 Bacteria 5401
402 nmdc:mga05p37_58555_c1 3300050507 Bacteria 4745
403 nmdc:mga05p37_59260_c1 3300050507 Bacteria 4715
404 nmdc:mga05p37_733170_c1 3300050507 Bacteria 1092
405 nmdc:mga06r32_31673_c1 3300050510 Bacteria 4968
406 nmdc:mga08y16_116221_c1 3300050511 Bacteria 2785
407 nmdc:mga08y16_1325237_c1 3300050511 Bacteria 686
408 nmdc:mga08y16_1518367_c1 3300050511 Unclassified 630
409 nmdc:mga08y16_19902_c1 3300050511 Bacteria 7079
410 nmdc:mga08y16_206757_c1 3300050511 Bacteria 1321
411 nmdc:mga0n895_174204_c1 3300050512 Bacteria 2183
412 nmdc:mga0n895_1771284_c1 3300050512 Bacteria 579
413 nmdc:mga0n895_283900_c1 3300050512 Bacteria 1679
414 nmdc:mga0n895_498391_c1 3300050512 Bacteria 1227
415 nmdc:mga0n895_666324_c1 3300050512 Bacteria 1038
416 nmdc:mga0n895_909557_c1 3300050512 Unclassified 865
417 nmdc:mga0rr50_2147_c1 3300050513 Bacteria 11026
418 nmdc:mga0rr50_48858_c1 3300050513 Bacteria 3129
419 nmdc:mga0rr50_638909_c1 3300050513 Unclassified 908
420 nmdc:mga0rr50_9851_c1 3300050513 Bacteria 6037
421 nmdc:mga08x19_300940_c1 3300050514 Bacteria 1114
422 nmdc:mga08x19_384154_c1 3300050514 Bacteria 984
423 nmdc:mga08x19_41567_c1 3300050514 Bacteria 2928
424 nmdc:mga0a205_274768_c1 3300050515 Bacteria 1561
425 nmdc:mga0a205_316535_c1 3300050515 Bacteria 1432
426 nmdc:mga0a205_349284_c1 3300050515 Bacteria 1347
427 nmdc:mga0a205_35671_c1 3300050515 Bacteria 4775
428 nmdc:mga0a205_374878_c1 3300050515 Bacteria 1289
429 nmdc:mga0a205_889189_c1 3300050515 Bacteria 738
430 Ga0495601_0686495 3300053077 Unclassified 654
431 Ga0495595_0279375 3300053084 Unclassified 838
432 Ga0590077_115868 3300059426 Bacteria 632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_11463921 Ga0070676_114639211 112
2 3300005354 Ga0070675_100002703 Ga0070675_10000270311 112
3 3300005356 Ga0070674_100702120 Ga0070674_1007021202 112
4 3300005364 Ga0070673_100451104 Ga0070673_1004511042 112
5 3300005543 Ga0070672_100125883 Ga0070672_1001258833 112
6 3300014326 Ga0157380_10309954 Ga0157380_103099542 112
7 3300025926 Ga0207659_10003405 Ga0207659_100034055 112
8 3300025937 Ga0207669_10078930 Ga0207669_100789303 112
9 3300025940 Ga0207691_10963228 Ga0207691_109632282 112
10 3300025960 Ga0207651_10391409 Ga0207651_103914092 112
11 3300005445 Ga0070708_101786835 Ga0070708_1017868351 116
12 3300005536 Ga0070697_100010261 Ga0070697_1000102616 116
13 3300009148 Ga0105243_10040910 Ga0105243_100409102 118
14 3300013297 Ga0157378_10355253 Ga0157378_103552531 118
15 3300025941 Ga0207711_10134013 Ga0207711_101340132 118
16 3300026118 Ga0207675_100239376 Ga0207675_1002393762 118
17 3300028381 Ga0268264_10399415 Ga0268264_103994151 118
18 3300050512 nmdc:mga0n895_283900_c1 nmdc:mga0n895_283900_c1_536_895 118
19 3300050513 nmdc:mga0rr50_9851_c1 nmdc:mga0rr50_9851_c1_5186_5545 118
20 3300050514 nmdc:mga08x19_300940_c1 nmdc:mga08x19_300940_c1_717_1076 118
21 3300050515 nmdc:mga0a205_374878_c1 nmdc:mga0a205_374878_c1_218_577 118
22 3300005336 Ga0070680_100175531 Ga0070680_1001755312 119
23 3300005844 Ga0068862_102065677 Ga0068862_1020656771 119
24 3300006871 Ga0075434_100550042 Ga0075434_1005500422 119
25 3300025940 Ga0207691_10173697 Ga0207691_101736972 119
26 3300005345 Ga0070692_11096855 Ga0070692_110968552 121
27 3300005547 Ga0070693_100487929 Ga0070693_1004879292 121
28 3300005617 Ga0068859_100707802 Ga0068859_1007078022 121
29 3300006931 Ga0097620_100707769 Ga0097620_1007077692 121
30 3300025907 Ga0207645_10009358 Ga0207645_100093587 121
31 3300049581 Ga0501047_0582822 Ga0501047_0582822_386_754 121
32 3300005290 Ga0065712_10260629 Ga0065712_102606291 122
33 3300005293 Ga0065715_10004099 Ga0065715_100040991 122
34 3300005293 Ga0065715_10956052 Ga0065715_109560521 122
35 3300005293 Ga0065715_10966283 Ga0065715_109662832 122
36 3300005295 Ga0065707_10373685 Ga0065707_103736851 122
37 3300005295 Ga0065707_10584570 Ga0065707_105845701 122
38 3300005295 Ga0065707_10597712 Ga0065707_105977122 122
39 3300005295 Ga0065707_10951226 Ga0065707_109512261 122
40 3300005328 Ga0070676_10000772 Ga0070676_100007726 122
41 3300005328 Ga0070676_10063587 Ga0070676_100635872 122
42 3300005328 Ga0070676_10544442 Ga0070676_105444421 122
43 3300005328 Ga0070676_10608862 Ga0070676_106088622 122
44 3300005328 Ga0070676_10946558 Ga0070676_109465581 122
45 3300005330 Ga0070690_100015319 Ga0070690_1000153192 122
46 3300005331 Ga0070670_100011102 Ga0070670_1000111023 122
47 3300005331 Ga0070670_100320075 Ga0070670_1003200751 122
48 3300005331 Ga0070670_100540853 Ga0070670_1005408531 122
49 3300005334 Ga0068869_100028433 Ga0068869_1000284333 122
50 3300005334 Ga0068869_100407358 Ga0068869_1004073582 122
51 3300005336 Ga0070680_100735323 Ga0070680_1007353231 122
52 3300005338 Ga0068868_100203321 Ga0068868_1002033211 122
53 3300005338 Ga0068868_100805350 Ga0068868_1008053501 122
54 3300005340 Ga0070689_100132414 Ga0070689_1001324141 122
55 3300005341 Ga0070691_10003323 Ga0070691_100033235 122
56 3300005343 Ga0070687_100039922 Ga0070687_1000399222 122
57 3300005343 Ga0070687_100082971 Ga0070687_1000829712 122
58 3300005343 Ga0070687_100706132 Ga0070687_1007061321 122
59 3300005344 Ga0070661_100305106 Ga0070661_1003051062 122
60 3300005345 Ga0070692_10611016 Ga0070692_106110161 122
61 3300005347 Ga0070668_100093197 Ga0070668_1000931972 122
62 3300005347 Ga0070668_100827339 Ga0070668_1008273391 122
63 3300005353 Ga0070669_100011922 Ga0070669_1000119223 122
64 3300005353 Ga0070669_100239955 Ga0070669_1002399552 122
65 3300005353 Ga0070669_100314854 Ga0070669_1003148541 122
66 3300005353 Ga0070669_101022610 Ga0070669_1010226102 122
67 3300005354 Ga0070675_100000134 Ga0070675_10000013414 122
68 3300005354 Ga0070675_100004521 Ga0070675_1000045217 122
69 3300005354 Ga0070675_100010078 Ga0070675_1000100784 122
70 3300005354 Ga0070675_100013460 Ga0070675_1000134603 122
71 3300005354 Ga0070675_100093147 Ga0070675_1000931472 122
72 3300005354 Ga0070675_101769947 Ga0070675_1017699471 122
73 3300005355 Ga0070671_100395081 Ga0070671_1003950811 122
74 3300005355 Ga0070671_101691815 Ga0070671_1016918151 122
75 3300005356 Ga0070674_100115119 Ga0070674_1001151192 122
76 3300005356 Ga0070674_100271409 Ga0070674_1002714092 122
77 3300005364 Ga0070673_100038290 Ga0070673_1000382903 122
78 3300005364 Ga0070673_100579407 Ga0070673_1005794072 122
79 3300005364 Ga0070673_100790386 Ga0070673_1007903862 122
80 3300005365 Ga0070688_100152885 Ga0070688_1001528852 122
81 3300005365 Ga0070688_100215101 Ga0070688_1002151012 122
82 3300005367 Ga0070667_101430512 Ga0070667_1014305121 122
83 3300005367 Ga0070667_101701867 Ga0070667_1017018671 122
84 3300005435 Ga0070714_100071785 Ga0070714_1000717851 122
85 3300005438 Ga0070701_10029606 Ga0070701_100296063 122
86 3300005438 Ga0070701_10159400 Ga0070701_101594002 122
87 3300005438 Ga0070701_11033050 Ga0070701_110330501 122
88 3300005440 Ga0070705_100161315 Ga0070705_1001613152 122
89 3300005440 Ga0070705_100613172 Ga0070705_1006131722 122
90 3300005440 Ga0070705_100702104 Ga0070705_1007021042 122
91 3300005441 Ga0070700_100115552 Ga0070700_1001155522 122
92 3300005441 Ga0070700_100287487 Ga0070700_1002874871 122
93 3300005441 Ga0070700_100348072 Ga0070700_1003480722 122
94 3300005441 Ga0070700_100351532 Ga0070700_1003515322 122
95 3300005444 Ga0070694_100108561 Ga0070694_1001085612 122
96 3300005444 Ga0070694_100198605 Ga0070694_1001986052 122
97 3300005444 Ga0070694_100214432 Ga0070694_1002144322 122
98 3300005444 Ga0070694_101063715 Ga0070694_1010637152 122
99 3300005444 Ga0070694_101383246 Ga0070694_1013832461 122
100 3300005445 Ga0070708_102201704 Ga0070708_1022017041 122
101 3300005456 Ga0070678_100316312 Ga0070678_1003163122 122
102 3300005457 Ga0070662_100375089 Ga0070662_1003750891 122
103 3300005457 Ga0070662_100475477 Ga0070662_1004754772 122
104 3300005457 Ga0070662_100625686 Ga0070662_1006256862 122
105 3300005459 Ga0068867_100002471 Ga0068867_1000024719 122
106 3300005459 Ga0068867_100077859 Ga0068867_1000778593 122
107 3300005459 Ga0068867_101680600 Ga0068867_1016806001 122
108 3300005467 Ga0070706_100271019 Ga0070706_1002710192 122
109 3300005467 Ga0070706_100675143 Ga0070706_1006751432 122
110 3300005467 Ga0070706_100806930 Ga0070706_1008069301 122
111 3300005468 Ga0070707_100225396 Ga0070707_1002253962 122
112 3300005471 Ga0070698_100237049 Ga0070698_1002370492 122
113 3300005471 Ga0070698_100245859 Ga0070698_1002458592 122
114 3300005471 Ga0070698_100433514 Ga0070698_1004335143 122
115 3300005471 Ga0070698_100584547 Ga0070698_1005845471 122
116 3300005518 Ga0070699_100995075 Ga0070699_1009950751 122
117 3300005518 Ga0070699_101207953 Ga0070699_1012079532 122
118 3300005518 Ga0070699_101271942 Ga0070699_1012719421 122
119 3300005536 Ga0070697_100525901 Ga0070697_1005259012 122
120 3300005536 Ga0070697_101066377 Ga0070697_1010663772 122
121 3300005536 Ga0070697_102089153 Ga0070697_1020891531 122
122 3300005543 Ga0070672_100103909 Ga0070672_1001039092 122
123 3300005543 Ga0070672_101064989 Ga0070672_1010649891 122
124 3300005544 Ga0070686_100778376 Ga0070686_1007783762 122
125 3300005545 Ga0070695_100016394 Ga0070695_1000163943 122
126 3300005545 Ga0070695_100045021 Ga0070695_1000450212 122
127 3300005545 Ga0070695_100071548 Ga0070695_1000715482 122
128 3300005546 Ga0070696_100205875 Ga0070696_1002058752 122
129 3300005546 Ga0070696_100433920 Ga0070696_1004339201 122
130 3300005546 Ga0070696_100662132 Ga0070696_1006621322 122
131 3300005546 Ga0070696_100970282 Ga0070696_1009702821 122
132 3300005548 Ga0070665_100003241 Ga0070665_1000032415 122
133 3300005549 Ga0070704_100006526 Ga0070704_1000065265 122
134 3300005549 Ga0070704_100028176 Ga0070704_1000281765 122
135 3300005549 Ga0070704_100043538 Ga0070704_1000435383 122
136 3300005549 Ga0070704_100195300 Ga0070704_1001953002 122
137 3300005549 Ga0070704_100571885 Ga0070704_1005718852 122
138 3300005549 Ga0070704_100719464 Ga0070704_1007194641 122
139 3300005564 Ga0070664_100004179 Ga0070664_1000041794 122
140 3300005564 Ga0070664_100576940 Ga0070664_1005769402 122
141 3300005577 Ga0068857_101222967 Ga0068857_1012229671 122
142 3300005578 Ga0068854_100027196 Ga0068854_1000271962 122
143 3300005615 Ga0070702_100012752 Ga0070702_1000127525 122
144 3300005615 Ga0070702_101249667 Ga0070702_1012496672 122
145 3300005616 Ga0068852_101385923 Ga0068852_1013859232 122
146 3300005617 Ga0068859_100118683 Ga0068859_1001186833 122
147 3300005617 Ga0068859_100162151 Ga0068859_1001621513 122
148 3300005617 Ga0068859_100896007 Ga0068859_1008960072 122
149 3300005617 Ga0068859_101166858 Ga0068859_1011668581 122
150 3300005618 Ga0068864_100206721 Ga0068864_1002067212 122
151 3300005618 Ga0068864_100506087 Ga0068864_1005060872 122
152 3300005718 Ga0068866_10031285 Ga0068866_100312853 122
153 3300005718 Ga0068866_10768834 Ga0068866_107688341 122
154 3300005719 Ga0068861_100084604 Ga0068861_1000846042 122
155 3300005719 Ga0068861_100161943 Ga0068861_1001619432 122
156 3300005719 Ga0068861_100450249 Ga0068861_1004502492 122
157 3300005719 Ga0068861_100547816 Ga0068861_1005478162 122
158 3300005719 Ga0068861_100709909 Ga0068861_1007099092 122
159 3300005719 Ga0068861_101494574 Ga0068861_1014945742 122
160 3300005840 Ga0068870_10182186 Ga0068870_101821862 122
161 3300005841 Ga0068863_100841998 Ga0068863_1008419982 122
162 3300005842 Ga0068858_100053011 Ga0068858_1000530113 122
163 3300005842 Ga0068858_100121838 Ga0068858_1001218382 122
164 3300005842 Ga0068858_100135937 Ga0068858_1001359373 122
165 3300005842 Ga0068858_100270268 Ga0068858_1002702683 122
166 3300005842 Ga0068858_100781899 Ga0068858_1007818992 122
167 3300005842 Ga0068858_101571539 Ga0068858_1015715391 122
168 3300005843 Ga0068860_100031680 Ga0068860_1000316804 122
169 3300005843 Ga0068860_100181362 Ga0068860_1001813622 122
170 3300005843 Ga0068860_100308750 Ga0068860_1003087502 122
171 3300005844 Ga0068862_100091363 Ga0068862_1000913632 122
172 3300005844 Ga0068862_100112959 Ga0068862_1001129592 122
173 3300005844 Ga0068862_100338178 Ga0068862_1003381782 122
174 3300005844 Ga0068862_100393159 Ga0068862_1003931592 122
175 3300005844 Ga0068862_100533218 Ga0068862_1005332182 122
176 3300005844 Ga0068862_101120995 Ga0068862_1011209951 122
177 3300005844 Ga0068862_102660205 Ga0068862_1026602051 122
178 3300006237 Ga0097621_100103884 Ga0097621_1001038842 122
179 3300006237 Ga0097621_100349306 Ga0097621_1003493062 122
180 3300006237 Ga0097621_100608972 Ga0097621_1006089722 122
181 3300006358 Ga0068871_100480960 Ga0068871_1004809601 122
182 3300006358 Ga0068871_100509066 Ga0068871_1005090662 122
183 3300006358 Ga0068871_100898158 Ga0068871_1008981581 122
184 3300006847 Ga0075431_100027642 Ga0075431_1000276426 122
185 3300006852 Ga0075433_10094811 Ga0075433_100948114 122
186 3300006852 Ga0075433_10180539 Ga0075433_101805392 122
187 3300006852 Ga0075433_10221383 Ga0075433_102213832 122
188 3300006852 Ga0075433_10484241 Ga0075433_104842412 122
189 3300006852 Ga0075433_10551277 Ga0075433_105512772 122
190 3300006871 Ga0075434_100006512 Ga0075434_1000065122 122
191 3300006871 Ga0075434_100453016 Ga0075434_1004530162 122
192 3300006871 Ga0075434_100456080 Ga0075434_1004560802 122
193 3300006871 Ga0075434_100570862 Ga0075434_1005708622 122
194 3300006871 Ga0075434_100860805 Ga0075434_1008608052 122
195 3300006871 Ga0075434_101310961 Ga0075434_1013109612 122
196 3300006881 Ga0068865_100116681 Ga0068865_1001166812 122
197 3300006881 Ga0068865_100146897 Ga0068865_1001468971 122
198 3300006881 Ga0068865_100371654 Ga0068865_1003716542 122
199 3300006881 Ga0068865_100715980 Ga0068865_1007159801 122
200 3300006881 Ga0068865_102176477 Ga0068865_1021764771 122
201 3300006914 Ga0075436_100201556 Ga0075436_1002015562 122
202 3300006914 Ga0075436_100347949 Ga0075436_1003479492 122
203 3300006914 Ga0075436_100733439 Ga0075436_1007334392 122
204 3300006931 Ga0097620_100118692 Ga0097620_1001186923 122
205 3300006931 Ga0097620_100162151 Ga0097620_1001621513 122
206 3300006931 Ga0097620_100895998 Ga0097620_1008959982 122
207 3300006931 Ga0097620_101166924 Ga0097620_1011669242 122
208 3300007076 Ga0075435_100001872 Ga0075435_1000018728 122
209 3300007076 Ga0075435_100002472 Ga0075435_1000024722 122
210 3300009094 Ga0111539_10006183 Ga0111539_1000618317 122
211 3300009094 Ga0111539_10180224 Ga0111539_101802242 122
212 3300009094 Ga0111539_10325037 Ga0111539_103250371 122
213 3300009094 Ga0111539_11855493 Ga0111539_118554931 122
214 3300009098 Ga0105245_11180841 Ga0105245_111808412 122
215 3300009101 Ga0105247_10016032 Ga0105247_100160323 122
216 3300009101 Ga0105247_10954489 Ga0105247_109544891 122
217 3300009147 Ga0114129_10002338 Ga0114129_1000233824 122
218 3300009147 Ga0114129_10003015 Ga0114129_1000301517 122
219 3300009147 Ga0114129_10008349 Ga0114129_100083495 122
220 3300009147 Ga0114129_10011933 Ga0114129_1001193311 122
221 3300009147 Ga0114129_10267176 Ga0114129_102671762 122
222 3300009147 Ga0114129_10332135 Ga0114129_103321352 122
223 3300009147 Ga0114129_10521056 Ga0114129_105210562 122
224 3300009147 Ga0114129_10720094 Ga0114129_107200942 122
225 3300009147 Ga0114129_12343899 Ga0114129_123438992 122
226 3300009148 Ga0105243_10018413 Ga0105243_100184135 122
227 3300009148 Ga0105243_11110617 Ga0105243_111106171 122
228 3300009148 Ga0105243_11319373 Ga0105243_113193731 122
229 3300009148 Ga0105243_11321441 Ga0105243_113214412 122
230 3300009176 Ga0105242_10003811 Ga0105242_100038116 122
231 3300009176 Ga0105242_10275423 Ga0105242_102754232 122
232 3300009176 Ga0105242_10372413 Ga0105242_103724132 122
233 3300009176 Ga0105242_10579698 Ga0105242_105796981 122
234 3300009177 Ga0105248_10475992 Ga0105248_104759922 122
235 3300009177 Ga0105248_10497640 Ga0105248_104976402 122
236 3300009177 Ga0105248_10530983 Ga0105248_105309832 122
237 3300009177 Ga0105248_10643888 Ga0105248_106438882 122
238 3300009177 Ga0105248_10836842 Ga0105248_108368421 122
239 3300009177 Ga0105248_12188994 Ga0105248_121889941 122
240 3300009177 Ga0105248_12318309 Ga0105248_123183091 122
241 3300009551 Ga0105238_10009232 Ga0105238_100092328 122
242 3300009553 Ga0105249_10076304 Ga0105249_100763044 122
243 3300009553 Ga0105249_10136146 Ga0105249_101361462 122
244 3300009553 Ga0105249_10392426 Ga0105249_103924262 122
245 3300009553 Ga0105249_11001182 Ga0105249_110011822 122
246 3300009553 Ga0105249_11319282 Ga0105249_113192822 122
247 3300009553 Ga0105249_12374363 Ga0105249_123743631 122
248 3300011119 Ga0105246_10095252 Ga0105246_100952522 122
249 3300011119 Ga0105246_10468986 Ga0105246_104689862 122
250 3300013296 Ga0157374_10775031 Ga0157374_107750312 122
251 3300013306 Ga0163162_11186418 Ga0163162_111864182 122
252 3300013306 Ga0163162_11605626 Ga0163162_116056261 122
253 3300013308 Ga0157375_11716411 Ga0157375_117164111 122
254 3300013308 Ga0157375_12437788 Ga0157375_124377882 122
255 3300013308 Ga0157375_13280316 Ga0157375_132803161 122
256 3300014325 Ga0163163_10013225 Ga0163163_100132254 122
257 3300014325 Ga0163163_10031372 Ga0163163_100313723 122
258 3300014326 Ga0157380_10007495 Ga0157380_100074955 122
259 3300014326 Ga0157380_10063926 Ga0157380_100639263 122
260 3300014326 Ga0157380_10205100 Ga0157380_102051002 122
261 3300014326 Ga0157380_10246992 Ga0157380_102469922 122
262 3300014326 Ga0157380_10268796 Ga0157380_102687962 122
263 3300014326 Ga0157380_10951018 Ga0157380_109510182 122
264 3300014326 Ga0157380_11489910 Ga0157380_114899102 122
265 3300014745 Ga0157377_10092174 Ga0157377_100921742 122
266 3300014968 Ga0157379_10017769 Ga0157379_100177691 122
267 3300014968 Ga0157379_11206798 Ga0157379_112067982 122
268 3300017792 Ga0163161_10563171 Ga0163161_105631712 122
269 3300017792 Ga0163161_10719320 Ga0163161_107193202 122
270 3300025321 Ga0207656_10019414 Ga0207656_100194142 122
271 3300025893 Ga0207682_10051023 Ga0207682_100510232 122
272 3300025899 Ga0207642_10036146 Ga0207642_100361461 122
273 3300025899 Ga0207642_10211369 Ga0207642_102113692 122
274 3300025903 Ga0207680_10790538 Ga0207680_107905382 122
275 3300025906 Ga0207699_10003219 Ga0207699_100032191 122
276 3300025907 Ga0207645_10006143 Ga0207645_100061435 122
277 3300025907 Ga0207645_10026243 Ga0207645_100262432 122
278 3300025907 Ga0207645_10550974 Ga0207645_105509742 122
279 3300025907 Ga0207645_10582533 Ga0207645_105825331 122
280 3300025907 Ga0207645_10776749 Ga0207645_107767492 122
281 3300025908 Ga0207643_10175007 Ga0207643_101750072 122
282 3300025908 Ga0207643_10227997 Ga0207643_102279972 122
283 3300025908 Ga0207643_10383590 Ga0207643_103835902 122
284 3300025910 Ga0207684_10217424 Ga0207684_102174241 122
285 3300025910 Ga0207684_10478228 Ga0207684_104782281 122
286 3300025910 Ga0207684_10928632 Ga0207684_109286321 122
287 3300025915 Ga0207693_10926389 Ga0207693_109263891 122
288 3300025917 Ga0207660_10662149 Ga0207660_106621491 122
289 3300025918 Ga0207662_10128175 Ga0207662_101281752 122
290 3300025918 Ga0207662_10650109 Ga0207662_106501091 122
291 3300025922 Ga0207646_10151441 Ga0207646_101514412 122
292 3300025922 Ga0207646_10591322 Ga0207646_105913222 122
293 3300025923 Ga0207681_10045885 Ga0207681_100458853 122
294 3300025923 Ga0207681_10082634 Ga0207681_100826342 122
295 3300025923 Ga0207681_10489670 Ga0207681_104896702 122
296 3300025923 Ga0207681_10581934 Ga0207681_105819342 122
297 3300025924 Ga0207694_10105278 Ga0207694_101052782 122
298 3300025925 Ga0207650_10023087 Ga0207650_100230873 122
299 3300025925 Ga0207650_11141134 Ga0207650_111411342 122
300 3300025926 Ga0207659_10005870 Ga0207659_100058704 122
301 3300025926 Ga0207659_10011934 Ga0207659_100119346 122
302 3300025926 Ga0207659_10021247 Ga0207659_100212472 122
303 3300025929 Ga0207664_10226592 Ga0207664_102265921 122
304 3300025931 Ga0207644_10465135 Ga0207644_104651351 122
305 3300025933 Ga0207706_10299928 Ga0207706_102999282 122
306 3300025933 Ga0207706_10381794 Ga0207706_103817942 122
307 3300025934 Ga0207686_10049431 Ga0207686_100494312 122
308 3300025934 Ga0207686_10206304 Ga0207686_102063042 122
309 3300025935 Ga0207709_10018269 Ga0207709_100182694 122
310 3300025937 Ga0207669_10251089 Ga0207669_102510892 122
311 3300025937 Ga0207669_10542144 Ga0207669_105421441 122
312 3300025938 Ga0207704_10182611 Ga0207704_101826111 122
313 3300025938 Ga0207704_10327150 Ga0207704_103271502 122
314 3300025940 Ga0207691_10041792 Ga0207691_100417923 122
315 3300025940 Ga0207691_10061776 Ga0207691_100617762 122
316 3300025940 Ga0207691_10062653 Ga0207691_100626532 122
317 3300025940 Ga0207691_10117284 Ga0207691_101172842 122
318 3300025941 Ga0207711_10473934 Ga0207711_104739342 122
319 3300025942 Ga0207689_10004999 Ga0207689_100049996 122
320 3300025945 Ga0207679_10037705 Ga0207679_100377052 122
321 3300025945 Ga0207679_10456875 Ga0207679_104568751 122
322 3300025960 Ga0207651_10346533 Ga0207651_103465332 122
323 3300025961 Ga0207712_10075642 Ga0207712_100756422 122
324 3300025972 Ga0207668_10081944 Ga0207668_100819442 122
325 3300025972 Ga0207668_10163891 Ga0207668_101638912 122
326 3300025972 Ga0207668_10827281 Ga0207668_108272811 122
327 3300025981 Ga0207640_10075431 Ga0207640_100754312 122
328 3300025981 Ga0207640_10127977 Ga0207640_101279772 122
329 3300025986 Ga0207658_10657834 Ga0207658_106578341 122
330 3300026023 Ga0207677_10407515 Ga0207677_104075152 122
331 3300026023 Ga0207677_10796073 Ga0207677_107960732 122
332 3300026023 Ga0207677_11416726 Ga0207677_114167262 122
333 3300026035 Ga0207703_10035293 Ga0207703_100352935 122
334 3300026035 Ga0207703_10167725 Ga0207703_101677252 122
335 3300026035 Ga0207703_10419437 Ga0207703_104194372 122
336 3300026035 Ga0207703_11515332 Ga0207703_115153321 122
337 3300026075 Ga0207708_10004832 Ga0207708_100048326 122
338 3300026075 Ga0207708_10056354 Ga0207708_100563544 122
339 3300026075 Ga0207708_10157195 Ga0207708_101571952 122
340 3300026075 Ga0207708_11000505 Ga0207708_110005051 122
341 3300026088 Ga0207641_10806270 Ga0207641_108062701 122
342 3300026088 Ga0207641_11302814 Ga0207641_113028141 122
343 3300026089 Ga0207648_10000427 Ga0207648_1000042727 122
344 3300026089 Ga0207648_10029767 Ga0207648_100297672 122
345 3300026089 Ga0207648_10411048 Ga0207648_104110482 122
346 3300026095 Ga0207676_10065565 Ga0207676_100655652 122
347 3300026095 Ga0207676_10468962 Ga0207676_104689622 122
348 3300026095 Ga0207676_10595011 Ga0207676_105950112 122
349 3300026116 Ga0207674_10400941 Ga0207674_104009413 122
350 3300026116 Ga0207674_11840701 Ga0207674_118407012 122
351 3300026118 Ga0207675_100029356 Ga0207675_1000293562 122
352 3300026118 Ga0207675_100105870 Ga0207675_1001058702 122
353 3300026118 Ga0207675_100173276 Ga0207675_1001732762 122
354 3300026118 Ga0207675_100344818 Ga0207675_1003448182 122
355 3300026118 Ga0207675_100490314 Ga0207675_1004903142 122
356 3300026121 Ga0207683_10135105 Ga0207683_101351052 122
357 3300026121 Ga0207683_11502745 Ga0207683_115027451 122
358 3300027907 Ga0207428_10238569 Ga0207428_102385692 122
359 3300028379 Ga0268266_10014977 Ga0268266_100149774 122
360 3300028380 Ga0268265_10050623 Ga0268265_100506234 122
361 3300028380 Ga0268265_10169218 Ga0268265_101692181 122
362 3300028380 Ga0268265_10439933 Ga0268265_104399332 122
363 3300028380 Ga0268265_11075306 Ga0268265_110753062 122
364 3300028381 Ga0268264_10040918 Ga0268264_100409182 122
365 3300028381 Ga0268264_10105102 Ga0268264_101051023 122
366 3300028381 Ga0268264_10112417 Ga0268264_101124172 122
367 3300028381 Ga0268264_10290521 Ga0268264_102905212 122
368 3300028786 Ga0307517_10466016 Ga0307517_104660161 122
369 3300031711 Ga0265314_10022431 Ga0265314_100224315 122
370 3300032002 Ga0307416_102302584 Ga0307416_1023025841 122
371 3300034819 Ga0373958_0086853 Ga0373958_0086853_163_534 122
372 3300035725 Ga0373947_0548401 Ga0373947_0548401_368_739 122
373 3300037068 Ga0373925_0744545 Ga0373925_0744545_241_612 122
374 3300037068 Ga0373925_0928399 Ga0373925_0928399_176_547 122
375 3300037068 Ga0373925_1413131 Ga0373925_1413131_127_498 122
376 3300042876 Ga0451577_0043391 Ga0451577_0043391_2660_3028 122
377 3300044694 Ga0466963_0053935 Ga0466963_0053935_183_554 122
378 3300044712 Ga0453684_0028794 Ga0453684_0028794_4094_4465 122
379 3300044712 Ga0453684_2072960 Ga0453684_2072960_69_440 122
380 3300045976 Ga0466967_0171270 Ga0466967_0171270_1148_1519 122
381 3300046455 Ga0495603_0220265 Ga0495603_0220265_260_631 122
382 3300046475 Ga0495639_0263159 Ga0495639_0263159_416_787 122
383 3300046511 Ga0495608_0310200 Ga0495608_0310200_79_450 122
384 3300046557 Ga0495622_0295680 Ga0495622_0295680_230_601 122
385 3300046675 Ga0495657_0820585 Ga0495657_0820585_52_423 122
386 3300046683 Ga0495658_0052328 Ga0495658_0052328_574_945 122
387 3300046683 Ga0495658_0105500 Ga0495658_0105500_1122_1493 122
388 3300046689 Ga0495613_0211846 Ga0495613_0211846_517_888 122
389 3300047315 Ga0495581_0587888 Ga0495581_0587888_256_627 122
390 3300047319 Ga0495674_0939579 Ga0495674_0939579_109_480 122
391 3300047321 Ga0495676_0564828 Ga0495676_0564828_142_513 122
392 3300048907 Ga0496104_0364244 Ga0496104_0364244_403_774 122
393 3300048907 Ga0496104_0469228 Ga0496104_0469228_369_740 122
394 3300048909 Ga0496106_1428186 Ga0496106_1428186_38_406 122
395 3300048915 Ga0496112_0633083 Ga0496112_0633083_75_446 122
396 3300048916 Ga0496113_0113361 Ga0496113_0113361_72_443 122
397 3300048917 Ga0496114_0158937 Ga0496114_0158937_105_476 122
398 3300048917 Ga0496114_1142127 Ga0496114_1142127_223_594 122
399 3300049588 Ga0501072_0759900 Ga0501072_0759900_210_581 122
400 3300050507 nmdc:mga05p37_142887_c1 nmdc:mga05p37_142887_c1_1151_1522 122
401 3300050507 nmdc:mga05p37_1519075_c1 nmdc:mga05p37_1519075_c1_266_637 122
402 3300050507 nmdc:mga05p37_188067_c1 nmdc:mga05p37_188067_c1_1525_1902 122
403 3300050507 nmdc:mga05p37_28045_c1 nmdc:mga05p37_28045_c1_5884_6255 122
404 3300050507 nmdc:mga05p37_302449_c1 nmdc:mga05p37_302449_c1_310_681 122
405 3300050507 nmdc:mga05p37_45445_c1 nmdc:mga05p37_45445_c1_1250_1621 122
406 3300050507 nmdc:mga05p37_58555_c1 nmdc:mga05p37_58555_c1_935_1306 122
407 3300050507 nmdc:mga05p37_59260_c1 nmdc:mga05p37_59260_c1_350_727 122
408 3300050507 nmdc:mga05p37_733170_c1 nmdc:mga05p37_733170_c1_463_834 122
409 3300050510 nmdc:mga06r32_31673_c1 nmdc:mga06r32_31673_c1_4342_4713 122
410 3300050511 nmdc:mga08y16_116221_c1 nmdc:mga08y16_116221_c1_804_1175 122
411 3300050511 nmdc:mga08y16_1325237_c1 nmdc:mga08y16_1325237_c1_213_587 122
412 3300050511 nmdc:mga08y16_1518367_c1 nmdc:mga08y16_1518367_c1_14_394 122
413 3300050511 nmdc:mga08y16_19902_c1 nmdc:mga08y16_19902_c1_6027_6398 122
414 3300050511 nmdc:mga08y16_206757_c1 nmdc:mga08y16_206757_c1_439_810 122
415 3300050512 nmdc:mga0n895_174204_c1 nmdc:mga0n895_174204_c1_790_1161 122
416 3300050512 nmdc:mga0n895_1771284_c1 nmdc:mga0n895_1771284_c1_160_531 122
417 3300050512 nmdc:mga0n895_498391_c1 nmdc:mga0n895_498391_c1_530_901 122
418 3300050512 nmdc:mga0n895_666324_c1 nmdc:mga0n895_666324_c1_354_728 122
419 3300050512 nmdc:mga0n895_909557_c1 nmdc:mga0n895_909557_c1_225_605 122
420 3300050513 nmdc:mga0rr50_2147_c1 nmdc:mga0rr50_2147_c1_7218_7589 122
421 3300050513 nmdc:mga0rr50_48858_c1 nmdc:mga0rr50_48858_c1_568_939 122
422 3300050513 nmdc:mga0rr50_638909_c1 nmdc:mga0rr50_638909_c1_363_737 122
423 3300050514 nmdc:mga08x19_384154_c1 nmdc:mga08x19_384154_c1_383_757 122
424 3300050514 nmdc:mga08x19_41567_c1 nmdc:mga08x19_41567_c1_1632_2003 122
425 3300050515 nmdc:mga0a205_274768_c1 nmdc:mga0a205_274768_c1_1164_1535 122
426 3300050515 nmdc:mga0a205_316535_c1 nmdc:mga0a205_316535_c1_631_1011 122
427 3300050515 nmdc:mga0a205_349284_c1 nmdc:mga0a205_349284_c1_361_732 122
428 3300050515 nmdc:mga0a205_35671_c1 nmdc:mga0a205_35671_c1_4202_4573 122
429 3300050515 nmdc:mga0a205_889189_c1 nmdc:mga0a205_889189_c1_196_567 122
430 3300053077 Ga0495601_0686495 Ga0495601_0686495_198_569 122
431 3300053084 Ga0495595_0279375 Ga0495595_0279375_367_738 122
432 3300059426 Ga0590077_115868 Ga0590077_115868_45_419 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

20

134

0.95

PF02629

CoA_binding

CoA binding domain

18

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9489 2 114
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9321 2 116
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9245 2 101
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9182 3 114
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9088 2 114
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9088 2 114 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8935 1 114 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8926 1 114 3.40.50.720
af_Q5A3M0_1_157_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8922 2 114 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8783 1 114 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8E4Y9-F1-model_v4 CoA-binding protein 0.997 1 109
AF-A0A2W4U2J1-F1-model_v4 CoA-binding protein 0.9937 3 120
AF-A0A7V4EKN4-F1-model_v4 CoA-binding protein 0.9934 2 120
AF-A0A7X4I2S9-F1-model_v4 CoA-binding protein 0.9921 4 120
AF-A0A5E4HRV0-F1-model_v4 Acetate--CoA ligase [ADP-forming] II subunit alpha (EC 6.2.1.13) 0.9886 4 120 GO:0043758

Feature Viewer

pLDDT pTM Quality
96.93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map