F442607

General Info

Members Datasets Scaffolds Average Seq Length
432 224 422 286

Family's Representative Sequence

Representative Sequence 3300025903|Ga0207680_10442953|Ga0207680_104429531
Length 250
Sequence MLDSLRVGPGSAARIAERSTDDRLGLEKDEGEKRLHELVERIEELQYRLFAEERRSVLLVLQGLDASGKDGVVRRVFEGVNPTGVGVTSFRAPAGAELEHDYLWRIHRALPRRGTIGVFNRSHYEDVVAVRMYEIAPESVWRPRYGHLRDFERMLVDEGTTVLKAFLNVSRDEQRARFQERVDDWVAAWEEAVTETSTDWAPWHIVPCDKKWYSRLAITELLIEALKGLNMSWPPPDFDVKAEKKRLAGA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
159 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
162 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 0
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.89
Nodule 0.23
Rhizoplane 11.34
Rhizosphere 66.9
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1002758 3300001977 Bacteria 2767
2 JGI24749J21850_1004592 3300002076 Bacteria 1931
3 JGI24744J21845_10002206 3300002077 Bacteria 3956
4 JGI24742J22300_10000515 3300002244 Bacteria 5758
5 Ga0055540_1000069 3300003792 Bacteria 119560
6 Ga0055540_1006433 3300003792 Bacteria 4666
7 Ga0055540_1006525 3300003792 Bacteria 4610
8 Ga0070666_10027690 3300005335 Bacteria 3714
9 Ga0070682_100019076 3300005337 Bacteria 4018
10 Ga0070682_100146004 3300005337 Bacteria 1618
11 Ga0068868_100011966 3300005338 Bacteria 6332
12 Ga0070689_100008880 3300005340 Bacteria 7102
13 Ga0070689_100107346 3300005340 Bacteria 2216
14 Ga0070691_10003658 3300005341 Bacteria 6941
15 Ga0070692_10088860 3300005345 Bacteria 1676
16 Ga0070668_100004990 3300005347 Bacteria 9830
17 Ga0070668_100026006 3300005347 Bacteria 4438
18 Ga0070668_100147868 3300005347 Bacteria 1897
19 Ga0070669_100021736 3300005353 Bacteria 4587
20 Ga0070669_100022970 3300005353 Bacteria 4462
21 Ga0070675_100344191 3300005354 Bacteria 1321
22 Ga0070671_100097690 3300005355 Bacteria 2463
23 Ga0070674_100000896 3300005356 Bacteria 15568
24 Ga0070688_100019189 3300005365 Bacteria 3960
25 Ga0070688_100030394 3300005365 Bacteria 3242
26 Ga0070659_100019465 3300005366 Bacteria 5144
27 Ga0070667_100000515 3300005367 Bacteria 38956
28 Ga0070667_100001428 3300005367 Bacteria 21404
29 Ga0070667_100005890 3300005367 Bacteria 10210
30 Ga0070709_10020267 3300005434 Bacteria 3855
31 Ga0070710_10000757 3300005437 Bacteria 15392
32 Ga0070710_10047871 3300005437 Bacteria 2386
33 Ga0070701_10000936 3300005438 Bacteria 10562
34 Ga0070711_100007261 3300005439 Bacteria 6732
35 Ga0070705_100018692 3300005440 Bacteria 3637
36 Ga0070700_100004370 3300005441 Bacteria 7376
37 Ga0070700_100093655 3300005441 Bacteria 1965
38 Ga0070694_100010635 3300005444 Bacteria 5684
39 Ga0070694_100111579 3300005444 Bacteria 1949
40 Ga0070663_100007561 3300005455 Bacteria 6625
41 Ga0070663_100071036 3300005455 Bacteria 2532
42 Ga0070663_100082769 3300005455 Bacteria 2362
43 Ga0070678_100000686 3300005456 Bacteria 16691
44 Ga0070662_100013323 3300005457 Bacteria 5470
45 Ga0068867_100006381 3300005459 Bacteria 8335
46 Ga0068867_100091400 3300005459 Bacteria 2310
47 Ga0070685_10012203 3300005466 Bacteria 4509
48 Ga0068853_100011795 3300005539 Bacteria 7104
49 Ga0068853_100031066 3300005539 Bacteria 4516
50 Ga0068853_100142572 3300005539 Bacteria 2152
51 Ga0070696_100002978 3300005546 Bacteria 11250
52 Ga0070696_100018091 3300005546 Bacteria 4760
53 Ga0070693_100055970 3300005547 Bacteria 2274
54 Ga0070665_100012435 3300005548 Bacteria 8580
55 Ga0070665_100014427 3300005548 Bacteria 7929
56 Ga0070665_100069616 3300005548 Bacteria 3526
57 Ga0070704_100000067 3300005549 Bacteria 34228
58 Ga0070664_100555966 3300005564 Bacteria 1061
59 Ga0068854_100015466 3300005578 Bacteria 5055
60 Ga0068854_100072882 3300005578 Bacteria 2515
61 Ga0070702_100002799 3300005615 Bacteria 7638
62 Ga0068852_100047479 3300005616 Bacteria 3663
63 Ga0068852_100054403 3300005616 Bacteria 3450
64 Ga0068852_100400522 3300005616 Bacteria 1350
65 Ga0068859_100027333 3300005617 Bacteria 5723
66 Ga0068859_100057319 3300005617 Bacteria 3924
67 Ga0068859_100208690 3300005617 Bacteria 2039
68 Ga0068866_10001888 3300005718 Bacteria 8773
69 Ga0068866_10011705 3300005718 Bacteria 3805
70 Ga0068861_100020312 3300005719 Bacteria 4755
71 Ga0068861_100059335 3300005719 Bacteria 2929
72 Ga0068861_100073947 3300005719 Bacteria 2649
73 Ga0068861_100182384 3300005719 Bacteria 1748
74 Ga0068861_100183230 3300005719 Bacteria 1745
75 Ga0068851_10166374 3300005834 Bacteria 1214
76 Ga0068863_100008513 3300005841 Bacteria 10019
77 Ga0068858_100027279 3300005842 Bacteria 5306
78 Ga0068858_100030818 3300005842 Bacteria 4981
79 Ga0068858_100262468 3300005842 Bacteria 1642
80 Ga0068860_100001873 3300005843 Bacteria 22347
81 Ga0068860_100402747 3300005843 Bacteria 1354
82 Ga0068862_100000578 3300005844 Bacteria 38192
83 Ga0068862_100004548 3300005844 Bacteria 11692
84 Ga0068862_100274786 3300005844 Bacteria 1542
85 Ga0081455_10056244 3300005937 Bacteria 3342
86 Ga0081455_10092937 3300005937 Bacteria 2440
87 Ga0081455_10171027 3300005937 Bacteria 1655
88 Ga0075365_10002248 3300006038 Bacteria 9353
89 Ga0075365_10187367 3300006038 Bacteria 1447
90 Ga0075368_10007423 3300006042 Bacteria 3869
91 Ga0075363_100003300 3300006048 Bacteria 6835
92 Ga0075363_100005367 3300006048 Bacteria 5695
93 Ga0075363_100005980 3300006048 Bacteria 5486
94 Ga0075363_100008101 3300006048 Bacteria 4876
95 Ga0075363_100019967 3300006048 Bacteria 3356
96 Ga0075363_100020134 3300006048 Bacteria 3344
97 Ga0075363_100094186 3300006048 Bacteria 1651
98 Ga0075364_10004076 3300006051 Bacteria 8383
99 Ga0075364_10008104 3300006051 Bacteria 6267
100 Ga0075364_10033993 3300006051 Bacteria 3286
101 Ga0075364_10040120 3300006051 Bacteria 3036
102 Ga0075364_10177575 3300006051 Bacteria 1440
103 Ga0070715_10012418 3300006163 Bacteria 3101
104 Ga0070715_10017920 3300006163 Bacteria 2689
105 Ga0070716_100008070 3300006173 Bacteria 5212
106 Ga0070716_100008375 3300006173 Bacteria 5130
107 Ga0070712_100005216 3300006175 Bacteria 8037
108 Ga0070712_100007203 3300006175 Bacteria 6937
109 Ga0075362_10033478 3300006177 Bacteria 2236
110 Ga0075367_10017878 3300006178 Bacteria 3900
111 Ga0075367_10034967 3300006178 Bacteria 2905
112 Ga0075369_10010786 3300006186 Bacteria 3580
113 Ga0075369_10011465 3300006186 Bacteria 3488
114 Ga0075369_10082175 3300006186 Bacteria 1430
115 Ga0075369_10099520 3300006186 Bacteria 1303
116 Ga0075370_10008814 3300006353 Bacteria 5207
117 Ga0075370_10013258 3300006353 Bacteria 4376
118 Ga0075370_10208721 3300006353 Bacteria 1153
119 Ga0068871_100591662 3300006358 Bacteria 1008
120 Ga0075430_100272778 3300006846 Bacteria 1400
121 Ga0068865_100005599 3300006881 Bacteria 7622
122 Ga0097620_100027328 3300006931 Bacteria 5723
123 Ga0097620_100057317 3300006931 Bacteria 3924
124 Ga0097620_100208716 3300006931 Bacteria 2039
125 Ga0099795_10023471 3300007788 Bacteria 2048
126 Ga0105245_10030519 3300009098 Bacteria 4766
127 Ga0105245_10206156 3300009098 Bacteria 1890
128 Ga0105245_10485693 3300009098 Bacteria 1249
129 Ga0105245_10652050 3300009098 Bacteria 1083
130 Ga0105247_10000011 3300009101 Bacteria 296480
131 Ga0105247_10007627 3300009101 Bacteria 6625
132 Ga0105247_10026245 3300009101 Bacteria 3516
133 Ga0105247_10066533 3300009101 Bacteria 2244
134 Ga0105243_10001892 3300009148 Bacteria 17850
135 Ga0105241_10028100 3300009174 Bacteria 4189
136 Ga0105242_10016159 3300009176 Bacteria 5798
137 Ga0105248_10000393 3300009177 Bacteria 50536
138 Ga0105248_10012689 3300009177 Bacteria 9298
139 Ga0105248_10019674 3300009177 Bacteria 7472
140 Ga0105237_10000861 3300009545 Bacteria 41263
141 Ga0105237_10005028 3300009545 Bacteria 15052
142 Ga0105237_10031266 3300009545 Bacteria 5398
143 Ga0105238_10108549 3300009551 Bacteria 2756
144 Ga0105238_10213323 3300009551 Bacteria 1907
145 Ga0105238_10221680 3300009551 Bacteria 1867
146 Ga0105249_10000091 3300009553 Bacteria 126848
147 Ga0105249_10017010 3300009553 Bacteria 6452
148 Ga0105249_10048246 3300009553 Bacteria 3883
149 Ga0105249_10291460 3300009553 Bacteria 1633
150 Ga0105249_10373983 3300009553 Bacteria 1449
151 Ga0099796_10009447 3300010159 Bacteria 2641
152 Ga0105239_10001018 3300010375 Bacteria 39155
153 Ga0105239_10017914 3300010375 Bacteria 7832
154 Ga0105239_10176807 3300010375 Bacteria 2387
155 Ga0105239_10466848 3300010375 Bacteria 1433
156 Ga0105246_10021434 3300011119 Bacteria 4158
157 Ga0105246_10254335 3300011119 Bacteria 1396
158 Ga0157369_10624034 3300013105 Bacteria 1112
159 Ga0157374_10074804 3300013296 Bacteria 3200
160 Ga0157378_10020332 3300013297 Bacteria 5839
161 Ga0157378_10247035 3300013297 Bacteria 1707
162 Ga0163162_10006559 3300013306 Bacteria 11273
163 Ga0163162_10150437 3300013306 Bacteria 2445
164 Ga0157372_10032177 3300013307 Bacteria 5749
165 Ga0157375_10023202 3300013308 Bacteria 5722
166 Ga0157375_10241685 3300013308 Bacteria 1965
167 Ga0157375_10277996 3300013308 Bacteria 1837
168 Ga0157375_10321541 3300013308 Bacteria 1712
169 Ga0157380_10002388 3300014326 Bacteria 12627
170 Ga0157380_10068832 3300014326 Bacteria 2854
171 Ga0157377_10005335 3300014745 Bacteria 6029
172 Ga0157377_10031257 3300014745 Bacteria 2892
173 Ga0157379_10019058 3300014968 Bacteria 6058
174 Ga0157379_10068008 3300014968 Bacteria 3185
175 Ga0157376_10423052 3300014969 Bacteria 1293
176 Ga0163161_10010235 3300017792 Bacteria 6496
177 Ga0163161_10049153 3300017792 Bacteria 3047
178 Ga0163161_10083581 3300017792 Bacteria 2353
179 Ga0163161_10120048 3300017792 Bacteria 1974
180 Ga0209673_1032128 3300025273 Bacteria 1621
181 Ga0209051_1000034 3300025303 Bacteria 371498
182 Ga0209051_1000478 3300025303 Bacteria 51782
183 Ga0209051_1011503 3300025303 Bacteria 4363
184 Ga0209051_1022329 3300025303 Bacteria 2666
185 Ga0207656_10079917 3300025321 Bacteria 1468
186 Ga0207653_10051336 3300025885 Bacteria 1373
187 Ga0207692_10001181 3300025898 Bacteria 9672
188 Ga0207642_10000298 3300025899 Bacteria 14852
189 Ga0207710_10000006 3300025900 Bacteria 538831
190 Ga0207710_10005230 3300025900 Bacteria 5608
191 Ga0207688_10001392 3300025901 Bacteria 12579
192 Ga0207688_10014993 3300025901 Bacteria 4205
193 Ga0207680_10011179 3300025903 Bacteria 4524
194 Ga0207680_10018460 3300025903 Bacteria 3708
195 Ga0207680_10442953 3300025903 Bacteria 922
196 Ga0207647_10029445 3300025904 Bacteria 3554
197 Ga0207685_10009666 3300025905 Bacteria 2811
198 Ga0207685_10030835 3300025905 Bacteria 1913
199 Ga0207654_10031768 3300025911 Bacteria 2911
200 Ga0207671_10008676 3300025914 Bacteria 8580
201 Ga0207671_10022636 3300025914 Bacteria 4747
202 Ga0207693_10010755 3300025915 Bacteria 7429
203 Ga0207693_10015037 3300025915 Bacteria 6213
204 Ga0207663_10012703 3300025916 Bacteria 4559
205 Ga0207681_10006571 3300025923 Bacteria 7139
206 Ga0207681_10009124 3300025923 Bacteria 6059
207 Ga0207694_10113148 3300025924 Bacteria 2161
208 Ga0207694_10320441 3300025924 Bacteria 1279
209 Ga0207687_10000787 3300025927 Bacteria 21377
210 Ga0207644_10047893 3300025931 Bacteria 3053
211 Ga0207690_10119674 3300025932 Bacteria 1911
212 Ga0207706_10009613 3300025933 Bacteria 8874
213 Ga0207706_10276644 3300025933 Bacteria 1465
214 Ga0207686_10009546 3300025934 Bacteria 5264
215 Ga0207709_10007370 3300025935 Bacteria 6130
216 Ga0207669_10012156 3300025937 Bacteria 4222
217 Ga0207704_10000348 3300025938 Bacteria 21539
218 Ga0207665_10008413 3300025939 Bacteria 6802
219 Ga0207665_10037342 3300025939 Bacteria 3233
220 Ga0207691_10131988 3300025940 Bacteria 2205
221 Ga0207711_10000080 3300025941 Bacteria 103331
222 Ga0207711_10006677 3300025941 Bacteria 9714
223 Ga0207711_10034089 3300025941 Bacteria 4311
224 Ga0207711_10156893 3300025941 Bacteria 2057
225 Ga0207689_10002180 3300025942 Bacteria 18382
226 Ga0207689_10062934 3300025942 Bacteria 3051
227 Ga0207679_10451758 3300025945 Bacteria 1140
228 Ga0207651_10265538 3300025960 Bacteria 1411
229 Ga0207712_10000061 3300025961 Bacteria 136114
230 Ga0207712_10009455 3300025961 Bacteria 6168
231 Ga0207712_10080433 3300025961 Bacteria 2370
232 Ga0207668_10002928 3300025972 Bacteria 10017
233 Ga0207668_10005313 3300025972 Bacteria 7580
234 Ga0207668_10097269 3300025972 Bacteria 2178
235 Ga0207658_10000469 3300025986 Bacteria 37626
236 Ga0207658_10002246 3300025986 Bacteria 14311
237 Ga0207658_10042106 3300025986 Bacteria 3310
238 Ga0207658_10123754 3300025986 Bacteria 2066
239 Ga0207677_10009752 3300026023 Bacteria 5408
240 Ga0207677_10319071 3300026023 Bacteria 1290
241 Ga0207703_10126184 3300026035 Bacteria 2204
242 Ga0207639_10010135 3300026041 Bacteria 6519
243 Ga0207639_10020575 3300026041 Bacteria 4725
244 Ga0207678_10018343 3300026067 Bacteria 6147
245 Ga0207678_10021819 3300026067 Bacteria 5616
246 Ga0207678_10045877 3300026067 Bacteria 3779
247 Ga0207678_10050309 3300026067 Bacteria 3601
248 Ga0207708_10000696 3300026075 Bacteria 25516
249 Ga0207708_10076275 3300026075 Bacteria 2571
250 Ga0207641_10003213 3300026088 Bacteria 14621
251 Ga0207641_10134718 3300026088 Bacteria 2222
252 Ga0207648_10003748 3300026089 Bacteria 15887
253 Ga0207648_10047383 3300026089 Bacteria 3767
254 Ga0207676_10086187 3300026095 Bacteria 2565
255 Ga0207675_100000897 3300026118 Bacteria 29742
256 Ga0207675_100031531 3300026118 Bacteria 4936
257 Ga0207675_100083299 3300026118 Bacteria 2999
258 Ga0207675_100310950 3300026118 Bacteria 1537
259 Ga0207683_10000413 3300026121 Bacteria 39512
260 Ga0207698_10101182 3300026142 Bacteria 2389
261 Ga0209813_10013547 3300027866 Bacteria 2179
262 Ga0268266_10017029 3300028379 Bacteria 6206
263 Ga0268266_10017989 3300028379 Bacteria 6026
264 Ga0268266_10091042 3300028379 Bacteria 2674
265 Ga0268266_10215383 3300028379 Bacteria 1763
266 Ga0268265_10000005 3300028380 Bacteria 535350
267 Ga0268265_10027102 3300028380 Bacteria 4085
268 Ga0268265_10457443 3300028380 Bacteria 1193
269 Ga0268264_10000177 3300028381 Bacteria 135644
270 Ga0268264_10001236 3300028381 Bacteria 24521
271 Ga0268264_10383452 3300028381 Bacteria 1346
272 Ga0265327_10000358 3300031251 Bacteria 86964
273 Ga0265327_10000863 3300031251 Bacteria 45090
274 Ga0307413_10090642 3300031824 Bacteria 1990
275 Ga0307413_10258924 3300031824 Bacteria 1296
276 Ga0307410_10167962 3300031852 Bacteria 1650
277 Ga0307410_10188774 3300031852 Bacteria 1566
278 Ga0307409_100383291 3300031995 Bacteria 1337
279 Ga0307415_100093677 3300032126 Bacteria 2182
280 Ga0307415_100265274 3300032126 Bacteria 1404
281 Ga0373960_0028288 3300035121 Bacteria 1546
282 Ga0373931_0047852 3300035691 Bacteria 2264
283 Ga0395899_0068593 3300037312 Bacteria 2599
284 Ga0395900_0017104 3300037418 Bacteria 7403
285 Ga0395905_0110071 3300037471 Bacteria 2586
286 Ga0439461_0002793 3300041410 Bacteria 2821
287 Ga0439465_0000668 3300041413 Bacteria 10489
288 Ga0439465_0011924 3300041413 Bacteria 2722
289 Ga0451793_0211353 3300041452 Bacteria 2301
290 Ga0439431_0000162 3300041997 Bacteria 12544
291 Ga0439445_0000333 3300042004 Bacteria 9240
292 Ga0439445_0032978 3300042004 Bacteria 1352
293 Ga0439448_0005003 3300042005 Bacteria 3767
294 Ga0439434_0000399 3300042435 Bacteria 12410
295 Ga0439434_0079835 3300042435 Bacteria 1037
296 Ga0466972_0037817 3300044658 Bacteria 2359
297 Ga0466965_0002058 3300044683 Bacteria 8428
298 Ga0466970_0069843 3300044765 Bacteria 1888
299 Ga0466970_0096690 3300044765 Bacteria 1606
300 Ga0466970_0222063 3300044765 Bacteria 1055
301 Ga0466957_0028632 3300044842 Bacteria 3317
302 Ga0466960_0000372 3300044901 Bacteria 15325
303 Ga0466959_0007451 3300045049 Bacteria 7678
304 Ga0466958_0067036 3300045836 Bacteria 2192
305 Ga0466967_0037563 3300045976 Bacteria 4146
306 Ga0466967_0056157 3300045976 Bacteria 3471
307 Ga0466967_0060242 3300045976 Bacteria 3363
308 Ga0466967_0257722 3300045976 Bacteria 1668
309 Ga0495638_0002750 3300046460 Bacteria 14133
310 Ga0495648_0002742 3300046524 Bacteria 15910
311 Ga0495668_0039421 3300046616 Bacteria 2637
312 Ga0495670_0079028 3300046691 Bacteria 1674
313 Ga0495686_0005724 3300047472 Bacteria 9713
314 Ga0495686_0080429 3300047472 Bacteria 1992
315 Ga0496100_0002715 3300048903 Bacteria 9045
316 Ga0496100_0004114 3300048903 Bacteria 7669
317 Ga0496100_0008316 3300048903 Bacteria 5785
318 Ga0496100_0011242 3300048903 Bacteria 5092
319 Ga0496100_0056209 3300048903 Bacteria 2574
320 Ga0496100_0123559 3300048903 Bacteria 1814
321 Ga0496101_0000014 3300048904 Bacteria 253487
322 Ga0496101_0000140 3300048904 Bacteria 63955
323 Ga0496101_0004368 3300048904 Bacteria 8882
324 Ga0496101_0004806 3300048904 Bacteria 8574
325 Ga0496102_0000041 3300048905 Bacteria 196634
326 Ga0496102_0003140 3300048905 Bacteria 14014
327 Ga0496102_0004208 3300048905 Bacteria 12173
328 Ga0496102_0005139 3300048905 Bacteria 11098
329 Ga0496102_0027250 3300048905 Bacteria 5102
330 Ga0496102_0114955 3300048905 Bacteria 2511
331 Ga0496103_0000058 3300048906 Bacteria 141099
332 Ga0496103_0000183 3300048906 Bacteria 63106
333 Ga0496103_0000592 3300048906 Bacteria 28566
334 Ga0496104_0133585 3300048907 Bacteria 2384
335 Ga0496105_0095860 3300048908 Bacteria 2450
336 Ga0496105_0300002 3300048908 Bacteria 1292
337 Ga0496106_0003432 3300048909 Bacteria 11805
338 Ga0496106_0005314 3300048909 Bacteria 9537
339 Ga0496106_0013810 3300048909 Bacteria 5968
340 Ga0496106_0070715 3300048909 Bacteria 2666
341 Ga0496106_0468775 3300048909 Bacteria 1012
342 Ga0496107_0000145 3300048910 Bacteria 35595
343 Ga0496107_0009280 3300048910 Bacteria 6821
344 Ga0496107_0061493 3300048910 Bacteria 2719
345 Ga0496108_0003955 3300048911 Bacteria 11903
346 Ga0496108_0016386 3300048911 Bacteria 6044
347 Ga0496108_0304995 3300048911 Bacteria 1387
348 Ga0496109_0000161 3300048912 Bacteria 65633
349 Ga0496109_0020229 3300048912 Bacteria 5879
350 Ga0496109_0032423 3300048912 Bacteria 4697
351 Ga0496110_0081203 3300048913 Bacteria 2890
352 Ga0496110_0109686 3300048913 Bacteria 2479
353 Ga0496111_0211331 3300048914 Bacteria 1441
354 Ga0496112_0239540 3300048915 Bacteria 1767
355 Ga0496113_0005416 3300048916 Bacteria 7956
356 Ga0496114_0000487 3300048917 Bacteria 29129
357 Ga0496114_0002182 3300048917 Bacteria 14900
358 Ga0496114_0005876 3300048917 Bacteria 9645
359 Ga0496114_0181401 3300048917 Bacteria 1839
360 Ga0496115_0005593 3300048918 Bacteria 9145
361 Ga0496115_0040971 3300048918 Bacteria 3683
362 Ga0496115_0214496 3300048918 Bacteria 1590
363 Ga0496116_0000098 3300048919 Bacteria 196497
364 Ga0496116_0010504 3300048919 Bacteria 7749
365 Ga0496116_0026292 3300048919 Bacteria 4260
366 Ga0496117_0000096 3300048920 Bacteria 196788
367 Ga0496117_0001773 3300048920 Bacteria 29619
368 Ga0496117_0006378 3300048920 Bacteria 11981
369 Ga0496117_0111125 3300048920 Bacteria 1707
370 Ga0496118_0000073 3300048921 Bacteria 196712
371 Ga0496118_0002763 3300048921 Bacteria 23002
372 Ga0496119_0005763 3300048922 Bacteria 11734
373 Ga0496119_0007431 3300048922 Bacteria 9866
374 Ga0496119_0014878 3300048922 Bacteria 6048
375 Ga0496119_0029642 3300048922 Bacteria 3705
376 Ga0496120_0014595 3300048923 Bacteria 5227
377 Ga0496121_0000002 3300048924 Bacteria 1494588
378 Ga0496121_0000354 3300048924 Bacteria 94725
379 Ga0496121_0006415 3300048924 Bacteria 14618
380 Ga0496122_0001055 3300048925 Bacteria 48077
381 Ga0496123_0009045 3300048926 Bacteria 9029
382 Ga0496124_0000002 3300048927 Bacteria 1494588
383 Ga0496125_0000002 3300048928 Bacteria 1480920
384 Ga0496125_0069711 3300048928 Bacteria 2756
385 Ga0496126_0000009 3300048929 Bacteria 750350
386 Ga0496126_0001057 3300048929 Bacteria 46555
387 Ga0496126_0044683 3300048929 Bacteria 4078
388 Ga0501037_0001645 3300049573 Bacteria 16251
389 Ga0501038_0014695 3300049574 Bacteria 7131
390 Ga0501039_0000415 3300049575 Bacteria 30627
391 Ga0501043_0001031 3300049579 Bacteria 24463
392 Ga0501070_0000517 3300049586 Bacteria 35418
393 Ga0501080_0119324 3300049742 Bacteria 2445
394 Ga0501044_0138196 3300049823 Bacteria 2426
395 nmdc:mga03n38_105_c2 3300050490 Bacteria 16032
396 nmdc:mga03n38_106143_c1 3300050490 Bacteria 1361
397 nmdc:mga03n38_39706_c1 3300050490 Bacteria 2042
398 nmdc:mga03n38_6136_c1 3300050490 Bacteria 4152
399 nmdc:mga03n38_988_c1 3300050490 Bacteria 7761
400 nmdc:mga00v17_240943_c1 3300050491 Bacteria 1172
401 nmdc:mga00v17_240971_c1 3300050491 Bacteria 1172
402 nmdc:mga00v17_24480_c1 3300050491 Bacteria 3503
403 nmdc:mga00v17_48664_c1 3300050491 Bacteria 2570
404 nmdc:mga00v17_74866_c1 3300050491 Bacteria 2105
405 nmdc:mga0yw44_115537_c1 3300050492 Bacteria 1724
406 nmdc:mga0yw44_135788_c1 3300050492 Bacteria 1596
407 nmdc:mga0yw44_52498_c1 3300050492 Bacteria 2471
408 nmdc:mga0yw44_8019_c1 3300050492 Bacteria 5236
409 nmdc:mga06z11_207547_c1 3300050494 Bacteria 1140
410 nmdc:mga06z11_89003_c1 3300050494 Bacteria 1672
411 nmdc:mga04h51_15870_c1 3300050495 Bacteria 2177
412 nmdc:mga07m45_180976_c1 3300050496 Bacteria 1226
413 nmdc:mga07m45_26090_c1 3300050496 Bacteria 3209
414 nmdc:mga07m45_42152_c1 3300050496 Bacteria 2558
415 nmdc:mga07m45_781_c1 3300050496 Bacteria 13679
416 nmdc:mga0qj67_275730_c1 3300050509 Bacteria 1363
417 nmdc:mga0sz30_88948_c1 3300050516 Bacteria 1342
418 Ga0495619_0334607 3300053085 Bacteria 1048
419 Ga0500643_002399 3300053087 Bacteria 9712
420 Ga0500562_001512 3300053108 Bacteria 5749
421 Ga0500652_003069 3300053131 Bacteria 5036
422 Ga0500616_0014848 3300053153 Bacteria 4464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_88948_c1 nmdc:mga0sz30_88948_c1_489_1217 242
2 3300050494 nmdc:mga06z11_207547_c1 nmdc:mga06z11_207547_c1_315_1127 246
3 3300025903 Ga0207680_10442953 Ga0207680_104429531 248
4 3300048917 Ga0496114_0181401 Ga0496114_0181401_454_1200 248
5 3300009101 Ga0105247_10066533 Ga0105247_100665331 257
6 3300048909 Ga0496106_0468775 Ga0496106_0468775_70_849 259
7 3300048903 Ga0496100_0056209 Ga0496100_0056209_1774_2562 262
8 3300044658 Ga0466972_0037817 Ga0466972_0037817_1362_2231 265
9 3300050496 nmdc:mga07m45_26090_c1 nmdc:mga07m45_26090_c1_1388_2257 265
10 3300006048 Ga0075363_100094186 Ga0075363_1000941862 268
11 3300006186 Ga0075369_10011465 Ga0075369_100114653 268
12 3300006353 Ga0075370_10208721 Ga0075370_102087212 268
13 3300025986 Ga0207658_10123754 Ga0207658_101237542 268
14 3300050490 nmdc:mga03n38_106143_c1 nmdc:mga03n38_106143_c1_439_1308 268
15 3300050496 nmdc:mga07m45_180976_c1 nmdc:mga07m45_180976_c1_68_937 268
16 3300053085 Ga0495619_0334607 Ga0495619_0334607_208_1017 269
17 3300006051 Ga0075364_10008104 Ga0075364_100081045 270
18 3300037312 Ga0395899_0068593 Ga0395899_0068593_492_1310 270
19 3300037418 Ga0395900_0017104 Ga0395900_0017104_5038_5856 270
20 3300037471 Ga0395905_0110071 Ga0395905_0110071_1420_2238 270
21 3300041413 Ga0439465_0011924 Ga0439465_0011924_29_844 270
22 3300046691 Ga0495670_0079028 Ga0495670_0079028_424_1257 270
23 3300005719 Ga0068861_100073947 Ga0068861_1000739473 271
24 3300005844 Ga0068862_100274786 Ga0068862_1002747861 271
25 3300009545 Ga0105237_10005028 Ga0105237_100050288 271
26 3300009553 Ga0105249_10291460 Ga0105249_102914602 271
27 3300010375 Ga0105239_10466848 Ga0105239_104668482 271
28 3300025914 Ga0207671_10022636 Ga0207671_100226361 271
29 3300025961 Ga0207712_10080433 Ga0207712_100804331 271
30 3300026118 Ga0207675_100031531 Ga0207675_1000315312 271
31 3300041410 Ga0439461_0002793 Ga0439461_0002793_55_927 273
32 3300041997 Ga0439431_0000162 Ga0439431_0000162_6370_7242 273
33 3300042004 Ga0439445_0000333 Ga0439445_0000333_6466_7338 273
34 3300042435 Ga0439434_0000399 Ga0439434_0000399_5085_5957 273
35 3300041413 Ga0439465_0000668 Ga0439465_0000668_7952_8788 277
36 3300042004 Ga0439445_0032978 Ga0439445_0032978_11_847 277
37 3300042435 Ga0439434_0079835 Ga0439434_0079835_59_895 277
38 3300031251 Ga0265327_10000358 Ga0265327_1000035812 279
39 iso_pu_bacteria 2738541264 2738665838 282
40 iso_pu_bacteria 2738541356 2739144972 282
41 iso_pu_bacteria 2902837492 2902839405 282
42 iso_pu_bacteria 2929212328 2929213222 282
43 iso_pu_bacteria 2939582691 2939587061 283
44 3300025942 Ga0207689_10062934 Ga0207689_100629342 284
45 3300048903 Ga0496100_0123559 Ga0496100_0123559_891_1748 284
46 3300048905 Ga0496102_0114955 Ga0496102_0114955_961_1818 284
47 3300048907 Ga0496104_0133585 Ga0496104_0133585_965_1822 284
48 3300048908 Ga0496105_0300002 Ga0496105_0300002_143_1000 284
49 3300048909 Ga0496106_0070715 Ga0496106_0070715_1702_2559 284
50 3300048910 Ga0496107_0061493 Ga0496107_0061493_308_1165 284
51 iso_pu_bacteria 2842134933 2842135114 284
52 3300048920 Ga0496117_0111125 Ga0496117_0111125_38_895 285
53 3300050491 nmdc:mga00v17_240943_c1 nmdc:mga00v17_240943_c1_205_1062 285
54 3300053131 Ga0500652_003069 Ga0500652_003069_2291_3148 285
55 3300003792 Ga0055540_1000069 Ga0055540_100006924 286
56 3300003792 Ga0055540_1006433 Ga0055540_10064333 286
57 3300005335 Ga0070666_10027690 Ga0070666_100276903 286
58 3300005337 Ga0070682_100146004 Ga0070682_1001460042 286
59 3300005367 Ga0070667_100005890 Ga0070667_1000058906 286
60 3300005455 Ga0070663_100082769 Ga0070663_1000827693 286
61 3300005842 Ga0068858_100262468 Ga0068858_1002624682 286
62 3300005843 Ga0068860_100402747 Ga0068860_1004027472 286
63 3300006051 Ga0075364_10177575 Ga0075364_101775752 286
64 3300009101 Ga0105247_10026245 Ga0105247_100262453 286
65 3300009177 Ga0105248_10012689 Ga0105248_1001268910 286
66 3300013308 Ga0157375_10277996 Ga0157375_102779962 286
67 3300025273 Ga0209673_1032128 Ga0209673_10321282 286
68 3300025303 Ga0209051_1000034 Ga0209051_1000034267 286
69 3300025903 Ga0207680_10018460 Ga0207680_100184603 286
70 3300025941 Ga0207711_10006677 Ga0207711_100066778 286
71 3300025986 Ga0207658_10002246 Ga0207658_1000224612 286
72 3300026067 Ga0207678_10050309 Ga0207678_100503092 286
73 3300026088 Ga0207641_10134718 Ga0207641_101347182 286
74 3300028381 Ga0268264_10383452 Ga0268264_103834522 286
75 3300031251 Ga0265327_10000863 Ga0265327_1000086341 286
76 3300042005 Ga0439448_0005003 Ga0439448_0005003_607_1467 286
77 3300044683 Ga0466965_0002058 Ga0466965_0002058_1943_2830 286
78 3300044901 Ga0466960_0000372 Ga0466960_0000372_12002_12889 286
79 3300048903 Ga0496100_0002715 Ga0496100_0002715_1506_2366 286
80 3300048903 Ga0496100_0008316 Ga0496100_0008316_13_873 286
81 3300048904 Ga0496101_0000140 Ga0496101_0000140_58162_59022 286
82 3300048904 Ga0496101_0004806 Ga0496101_0004806_5744_6604 286
83 3300048905 Ga0496102_0003140 Ga0496102_0003140_2082_2942 286
84 3300048906 Ga0496103_0000183 Ga0496103_0000183_57359_58219 286
85 3300048908 Ga0496105_0095860 Ga0496105_0095860_209_1069 286
86 3300048909 Ga0496106_0005314 Ga0496106_0005314_8008_8868 286
87 3300048909 Ga0496106_0013810 Ga0496106_0013810_4931_5791 286
88 3300048910 Ga0496107_0000145 Ga0496107_0000145_4908_5768 286
89 3300048910 Ga0496107_0009280 Ga0496107_0009280_5903_6763 286
90 3300048911 Ga0496108_0304995 Ga0496108_0304995_430_1290 286
91 3300048912 Ga0496109_0000161 Ga0496109_0000161_59878_60738 286
92 3300048917 Ga0496114_0002182 Ga0496114_0002182_12621_13481 286
93 3300048917 Ga0496114_0005876 Ga0496114_0005876_3849_4709 286
94 3300048918 Ga0496115_0005593 Ga0496115_0005593_6486_7346 286
95 3300048918 Ga0496115_0214496 Ga0496115_0214496_710_1570 286
96 3300048919 Ga0496116_0010504 Ga0496116_0010504_6789_7649 286
97 3300048920 Ga0496117_0006378 Ga0496117_0006378_7124_7984 286
98 3300048922 Ga0496119_0007431 Ga0496119_0007431_8200_9060 286
99 3300048924 Ga0496121_0000002 Ga0496121_0000002_598563_599423 286
100 3300048925 Ga0496122_0001055 Ga0496122_0001055_4911_5771 286
101 3300048926 Ga0496123_0009045 Ga0496123_0009045_4779_5639 286
102 3300048927 Ga0496124_0000002 Ga0496124_0000002_895166_896026 286
103 3300048928 Ga0496125_0000002 Ga0496125_0000002_598563_599423 286
104 3300048929 Ga0496126_0000009 Ga0496126_0000009_150928_151788 286
105 3300053153 Ga0500616_0014848 Ga0500616_0014848_561_1421 286
106 iso_pu_bacteria 2643221687 2644487299 286
107 iso_pu_bacteria 2643221715 2644638913 286
108 iso_pu_bacteria 2902810491 2902814038 286
109 3300005616 Ga0068852_100400522 Ga0068852_1004005221 287
110 3300006038 Ga0075365_10002248 Ga0075365_1000224810 287
111 3300006038 Ga0075365_10187367 Ga0075365_101873672 287
112 3300006042 Ga0075368_10007423 Ga0075368_100074233 287
113 3300006048 Ga0075363_100005367 Ga0075363_1000053678 287
114 3300006048 Ga0075363_100005980 Ga0075363_1000059805 287
115 3300006048 Ga0075363_100019967 Ga0075363_1000199673 287
116 3300006048 Ga0075363_100020134 Ga0075363_1000201343 287
117 3300006051 Ga0075364_10004076 Ga0075364_100040768 287
118 3300006051 Ga0075364_10040120 Ga0075364_100401202 287
119 3300006178 Ga0075367_10017878 Ga0075367_100178782 287
120 3300006186 Ga0075369_10082175 Ga0075369_100821751 287
121 3300006186 Ga0075369_10099520 Ga0075369_100995202 287
122 3300006353 Ga0075370_10008814 Ga0075370_100088143 287
123 3300006353 Ga0075370_10013258 Ga0075370_100132583 287
124 3300009098 Ga0105245_10485693 Ga0105245_104856932 287
125 3300009545 Ga0105237_10000861 Ga0105237_1000086115 287
126 3300011119 Ga0105246_10254335 Ga0105246_102543352 287
127 3300025914 Ga0207671_10008676 Ga0207671_1000867610 287
128 3300028379 Ga0268266_10215383 Ga0268266_102153832 287
129 3300031824 Ga0307413_10090642 Ga0307413_100906422 287
130 3300031824 Ga0307413_10258924 Ga0307413_102589242 287
131 3300031852 Ga0307410_10167962 Ga0307410_101679622 287
132 3300031995 Ga0307409_100383291 Ga0307409_1003832912 287
133 3300032126 Ga0307415_100093677 Ga0307415_1000936772 287
134 3300044765 Ga0466970_0096690 Ga0466970_0096690_381_1247 287
135 3300046460 Ga0495638_0002750 Ga0495638_0002750_3956_4819 287
136 3300048903 Ga0496100_0011242 Ga0496100_0011242_2654_3517 287
137 3300048904 Ga0496101_0000014 Ga0496101_0000014_195292_196155 287
138 3300048905 Ga0496102_0000041 Ga0496102_0000041_64523_65386 287
139 3300048906 Ga0496103_0000058 Ga0496103_0000058_58545_59408 287
140 3300048912 Ga0496109_0032423 Ga0496109_0032423_1907_2773 287
141 3300048916 Ga0496113_0005416 Ga0496113_0005416_4467_5336 287
142 3300048919 Ga0496116_0000098 Ga0496116_0000098_64386_65249 287
143 3300048920 Ga0496117_0000096 Ga0496117_0000096_64677_65540 287
144 3300048921 Ga0496118_0000073 Ga0496118_0000073_131249_132112 287
145 3300048922 Ga0496119_0005763 Ga0496119_0005763_8172_9035 287
146 3300048924 Ga0496121_0000354 Ga0496121_0000354_51308_52171 287
147 3300048929 Ga0496126_0001057 Ga0496126_0001057_19504_20367 287
148 3300048929 Ga0496126_0044683 Ga0496126_0044683_2194_3063 287
149 3300049742 Ga0501080_0119324 Ga0501080_0119324_191_1054 287
150 3300050490 nmdc:mga03n38_105_c2 nmdc:mga03n38_105_c2_14023_14886 287
151 3300050490 nmdc:mga03n38_39706_c1 nmdc:mga03n38_39706_c1_133_996 287
152 3300050490 nmdc:mga03n38_6136_c1 nmdc:mga03n38_6136_c1_2110_2973 287
153 3300050491 nmdc:mga00v17_24480_c1 nmdc:mga00v17_24480_c1_1282_2145 287
154 3300050491 nmdc:mga00v17_48664_c1 nmdc:mga00v17_48664_c1_1607_2470 287
155 3300050491 nmdc:mga00v17_74866_c1 nmdc:mga00v17_74866_c1_53_916 287
156 3300050492 nmdc:mga0yw44_115537_c1 nmdc:mga0yw44_115537_c1_226_1089 287
157 3300050492 nmdc:mga0yw44_135788_c1 nmdc:mga0yw44_135788_c1_218_1081 287
158 3300050492 nmdc:mga0yw44_52498_c1 nmdc:mga0yw44_52498_c1_956_1819 287
159 3300050494 nmdc:mga06z11_89003_c1 nmdc:mga06z11_89003_c1_526_1389 287
160 3300050496 nmdc:mga07m45_42152_c1 nmdc:mga07m45_42152_c1_954_1817 287
161 3300050496 nmdc:mga07m45_781_c1 nmdc:mga07m45_781_c1_9789_10652 287
162 3300001977 JGI24746J21847_1002758 JGI24746J21847_10027582 288
163 3300002076 JGI24749J21850_1004592 JGI24749J21850_10045922 288
164 3300002077 JGI24744J21845_10002206 JGI24744J21845_100022062 288
165 3300002244 JGI24742J22300_10000515 JGI24742J22300_100005156 288
166 3300003792 Ga0055540_1006525 Ga0055540_10065254 288
167 3300005337 Ga0070682_100019076 Ga0070682_1000190762 288
168 3300005338 Ga0068868_100011966 Ga0068868_1000119666 288
169 3300005340 Ga0070689_100008880 Ga0070689_1000088809 288
170 3300005340 Ga0070689_100107346 Ga0070689_1001073462 288
171 3300005341 Ga0070691_10003658 Ga0070691_100036586 288
172 3300005345 Ga0070692_10088860 Ga0070692_100888602 288
173 3300005347 Ga0070668_100004990 Ga0070668_1000049903 288
174 3300005347 Ga0070668_100026006 Ga0070668_1000260063 288
175 3300005347 Ga0070668_100147868 Ga0070668_1001478682 288
176 3300005353 Ga0070669_100021736 Ga0070669_1000217363 288
177 3300005353 Ga0070669_100022970 Ga0070669_1000229703 288
178 3300005354 Ga0070675_100344191 Ga0070675_1003441911 288
179 3300005355 Ga0070671_100097690 Ga0070671_1000976901 288
180 3300005356 Ga0070674_100000896 Ga0070674_10000089619 288
181 3300005365 Ga0070688_100019189 Ga0070688_1000191892 288
182 3300005365 Ga0070688_100030394 Ga0070688_1000303942 288
183 3300005366 Ga0070659_100019465 Ga0070659_1000194654 288
184 3300005367 Ga0070667_100000515 Ga0070667_1000005153 288
185 3300005367 Ga0070667_100001428 Ga0070667_10000142822 288
186 3300005434 Ga0070709_10020267 Ga0070709_100202673 288
187 3300005437 Ga0070710_10000757 Ga0070710_100007572 288
188 3300005437 Ga0070710_10047871 Ga0070710_100478713 288
189 3300005438 Ga0070701_10000936 Ga0070701_100009366 288
190 3300005439 Ga0070711_100007261 Ga0070711_1000072614 288
191 3300005440 Ga0070705_100018692 Ga0070705_1000186922 288
192 3300005441 Ga0070700_100004370 Ga0070700_1000043703 288
193 3300005441 Ga0070700_100093655 Ga0070700_1000936552 288
194 3300005444 Ga0070694_100010635 Ga0070694_1000106353 288
195 3300005444 Ga0070694_100111579 Ga0070694_1001115792 288
196 3300005455 Ga0070663_100007561 Ga0070663_1000075615 288
197 3300005455 Ga0070663_100071036 Ga0070663_1000710363 288
198 3300005456 Ga0070678_100000686 Ga0070678_10000068619 288
199 3300005457 Ga0070662_100013323 Ga0070662_1000133234 288
200 3300005459 Ga0068867_100006381 Ga0068867_1000063815 288
201 3300005459 Ga0068867_100091400 Ga0068867_1000914002 288
202 3300005466 Ga0070685_10012203 Ga0070685_100122033 288
203 3300005539 Ga0068853_100011795 Ga0068853_1000117952 288
204 3300005539 Ga0068853_100031066 Ga0068853_1000310665 288
205 3300005539 Ga0068853_100142572 Ga0068853_1001425722 288
206 3300005546 Ga0070696_100002978 Ga0070696_10000297815 288
207 3300005546 Ga0070696_100018091 Ga0070696_1000180914 288
208 3300005547 Ga0070693_100055970 Ga0070693_1000559703 288
209 3300005548 Ga0070665_100012435 Ga0070665_1000124356 288
210 3300005548 Ga0070665_100014427 Ga0070665_1000144274 288
211 3300005548 Ga0070665_100069616 Ga0070665_1000696163 288
212 3300005549 Ga0070704_100000067 Ga0070704_10000006725 288
213 3300005564 Ga0070664_100555966 Ga0070664_1005559662 288
214 3300005578 Ga0068854_100015466 Ga0068854_1000154663 288
215 3300005578 Ga0068854_100072882 Ga0068854_1000728822 288
216 3300005615 Ga0070702_100002799 Ga0070702_1000027996 288
217 3300005616 Ga0068852_100047479 Ga0068852_1000474792 288
218 3300005616 Ga0068852_100054403 Ga0068852_1000544034 288
219 3300005617 Ga0068859_100027333 Ga0068859_1000273336 288
220 3300005617 Ga0068859_100057319 Ga0068859_1000573194 288
221 3300005617 Ga0068859_100208690 Ga0068859_1002086902 288
222 3300005718 Ga0068866_10001888 Ga0068866_1000188810 288
223 3300005718 Ga0068866_10011705 Ga0068866_100117054 288
224 3300005719 Ga0068861_100020312 Ga0068861_1000203122 288
225 3300005719 Ga0068861_100059335 Ga0068861_1000593352 288
226 3300005719 Ga0068861_100182384 Ga0068861_1001823842 288
227 3300005719 Ga0068861_100183230 Ga0068861_1001832302 288
228 3300005834 Ga0068851_10166374 Ga0068851_101663741 288
229 3300005841 Ga0068863_100008513 Ga0068863_1000085131 288
230 3300005842 Ga0068858_100027279 Ga0068858_1000272792 288
231 3300005842 Ga0068858_100030818 Ga0068858_1000308186 288
232 3300005843 Ga0068860_100001873 Ga0068860_1000018733 288
233 3300005844 Ga0068862_100000578 Ga0068862_10000057836 288
234 3300005844 Ga0068862_100004548 Ga0068862_1000045489 288
235 3300005937 Ga0081455_10056244 Ga0081455_100562442 288
236 3300005937 Ga0081455_10092937 Ga0081455_100929372 288
237 3300005937 Ga0081455_10171027 Ga0081455_101710272 288
238 3300006048 Ga0075363_100003300 Ga0075363_1000033003 288
239 3300006048 Ga0075363_100008101 Ga0075363_1000081013 288
240 3300006051 Ga0075364_10033993 Ga0075364_100339932 288
241 3300006163 Ga0070715_10012418 Ga0070715_100124182 288
242 3300006163 Ga0070715_10017920 Ga0070715_100179203 288
243 3300006173 Ga0070716_100008070 Ga0070716_1000080706 288
244 3300006173 Ga0070716_100008375 Ga0070716_1000083752 288
245 3300006175 Ga0070712_100005216 Ga0070712_1000052169 288
246 3300006175 Ga0070712_100007203 Ga0070712_1000072033 288
247 3300006177 Ga0075362_10033478 Ga0075362_100334782 288
248 3300006178 Ga0075367_10034967 Ga0075367_100349672 288
249 3300006186 Ga0075369_10010786 Ga0075369_100107863 288
250 3300006358 Ga0068871_100591662 Ga0068871_1005916622 288
251 3300006846 Ga0075430_100272778 Ga0075430_1002727782 288
252 3300006881 Ga0068865_100005599 Ga0068865_1000055996 288
253 3300006931 Ga0097620_100027328 Ga0097620_1000273286 288
254 3300006931 Ga0097620_100057317 Ga0097620_1000573172 288
255 3300006931 Ga0097620_100208716 Ga0097620_1002087162 288
256 3300007788 Ga0099795_10023471 Ga0099795_100234711 288
257 3300009098 Ga0105245_10030519 Ga0105245_100305192 288
258 3300009098 Ga0105245_10206156 Ga0105245_102061562 288
259 3300009098 Ga0105245_10652050 Ga0105245_106520502 288
260 3300009101 Ga0105247_10000011 Ga0105247_10000011282 288
261 3300009101 Ga0105247_10007627 Ga0105247_100076276 288
262 3300009148 Ga0105243_10001892 Ga0105243_100018925 288
263 3300009174 Ga0105241_10028100 Ga0105241_100281002 288
264 3300009176 Ga0105242_10016159 Ga0105242_100161595 288
265 3300009177 Ga0105248_10000393 Ga0105248_1000039310 288
266 3300009177 Ga0105248_10019674 Ga0105248_100196744 288
267 3300009545 Ga0105237_10031266 Ga0105237_100312663 288
268 3300009551 Ga0105238_10108549 Ga0105238_101085493 288
269 3300009551 Ga0105238_10213323 Ga0105238_102133232 288
270 3300009551 Ga0105238_10221680 Ga0105238_102216802 288
271 3300009553 Ga0105249_10000091 Ga0105249_10000091163 288
272 3300009553 Ga0105249_10017010 Ga0105249_100170103 288
273 3300009553 Ga0105249_10048246 Ga0105249_100482463 288
274 3300009553 Ga0105249_10373983 Ga0105249_103739832 288
275 3300010159 Ga0099796_10009447 Ga0099796_100094472 288
276 3300010375 Ga0105239_10001018 Ga0105239_1000101815 288
277 3300010375 Ga0105239_10017914 Ga0105239_100179145 288
278 3300010375 Ga0105239_10176807 Ga0105239_101768072 288
279 3300011119 Ga0105246_10021434 Ga0105246_100214343 288
280 3300013105 Ga0157369_10624034 Ga0157369_106240341 288
281 3300013296 Ga0157374_10074804 Ga0157374_100748043 288
282 3300013297 Ga0157378_10020332 Ga0157378_100203323 288
283 3300013297 Ga0157378_10247035 Ga0157378_102470353 288
284 3300013306 Ga0163162_10006559 Ga0163162_1000655912 288
285 3300013306 Ga0163162_10150437 Ga0163162_101504372 288
286 3300013307 Ga0157372_10032177 Ga0157372_100321773 288
287 3300013308 Ga0157375_10023202 Ga0157375_100232024 288
288 3300013308 Ga0157375_10241685 Ga0157375_102416852 288
289 3300013308 Ga0157375_10321541 Ga0157375_103215413 288
290 3300014326 Ga0157380_10002388 Ga0157380_100023882 288
291 3300014326 Ga0157380_10068832 Ga0157380_100688322 288
292 3300014745 Ga0157377_10005335 Ga0157377_100053353 288
293 3300014745 Ga0157377_10031257 Ga0157377_100312572 288
294 3300014968 Ga0157379_10019058 Ga0157379_100190582 288
295 3300014968 Ga0157379_10068008 Ga0157379_100680082 288
296 3300014969 Ga0157376_10423052 Ga0157376_104230522 288
297 3300017792 Ga0163161_10010235 Ga0163161_100102353 288
298 3300017792 Ga0163161_10049153 Ga0163161_100491533 288
299 3300017792 Ga0163161_10083581 Ga0163161_100835813 288
300 3300017792 Ga0163161_10120048 Ga0163161_101200482 288
301 3300025303 Ga0209051_1000478 Ga0209051_100047837 288
302 3300025303 Ga0209051_1011503 Ga0209051_10115033 288
303 3300025303 Ga0209051_1022329 Ga0209051_10223293 288
304 3300025321 Ga0207656_10079917 Ga0207656_100799172 288
305 3300025885 Ga0207653_10051336 Ga0207653_100513362 288
306 3300025898 Ga0207692_10001181 Ga0207692_1000118114 288
307 3300025899 Ga0207642_10000298 Ga0207642_1000029814 288
308 3300025900 Ga0207710_10000006 Ga0207710_10000006150 288
309 3300025900 Ga0207710_10005230 Ga0207710_100052304 288
310 3300025901 Ga0207688_10001392 Ga0207688_100013924 288
311 3300025901 Ga0207688_10014993 Ga0207688_100149934 288
312 3300025903 Ga0207680_10011179 Ga0207680_100111792 288
313 3300025904 Ga0207647_10029445 Ga0207647_100294453 288
314 3300025905 Ga0207685_10009666 Ga0207685_100096663 288
315 3300025905 Ga0207685_10030835 Ga0207685_100308352 288
316 3300025911 Ga0207654_10031768 Ga0207654_100317682 288
317 3300025915 Ga0207693_10010755 Ga0207693_100107555 288
318 3300025915 Ga0207693_10015037 Ga0207693_100150375 288
319 3300025916 Ga0207663_10012703 Ga0207663_100127033 288
320 3300025923 Ga0207681_10006571 Ga0207681_100065715 288
321 3300025923 Ga0207681_10009124 Ga0207681_100091246 288
322 3300025924 Ga0207694_10113148 Ga0207694_101131482 288
323 3300025924 Ga0207694_10320441 Ga0207694_103204412 288
324 3300025927 Ga0207687_10000787 Ga0207687_100007872 288
325 3300025931 Ga0207644_10047893 Ga0207644_100478932 288
326 3300025932 Ga0207690_10119674 Ga0207690_101196742 288
327 3300025933 Ga0207706_10009613 Ga0207706_100096136 288
328 3300025933 Ga0207706_10276644 Ga0207706_102766441 288
329 3300025934 Ga0207686_10009546 Ga0207686_100095462 288
330 3300025935 Ga0207709_10007370 Ga0207709_100073706 288
331 3300025937 Ga0207669_10012156 Ga0207669_100121564 288
332 3300025938 Ga0207704_10000348 Ga0207704_1000034824 288
333 3300025939 Ga0207665_10008413 Ga0207665_100084134 288
334 3300025939 Ga0207665_10037342 Ga0207665_100373424 288
335 3300025940 Ga0207691_10131988 Ga0207691_101319883 288
336 3300025941 Ga0207711_10000080 Ga0207711_1000008011 288
337 3300025941 Ga0207711_10034089 Ga0207711_100340892 288
338 3300025941 Ga0207711_10156893 Ga0207711_101568932 288
339 3300025942 Ga0207689_10002180 Ga0207689_1000218016 288
340 3300025945 Ga0207679_10451758 Ga0207679_104517581 288
341 3300025960 Ga0207651_10265538 Ga0207651_102655382 288
342 3300025961 Ga0207712_10000061 Ga0207712_10000061164 288
343 3300025961 Ga0207712_10009455 Ga0207712_100094554 288
344 3300025972 Ga0207668_10002928 Ga0207668_100029283 288
345 3300025972 Ga0207668_10005313 Ga0207668_100053138 288
346 3300025972 Ga0207668_10097269 Ga0207668_100972692 288
347 3300025986 Ga0207658_10000469 Ga0207658_100004696 288
348 3300025986 Ga0207658_10042106 Ga0207658_100421063 288
349 3300026023 Ga0207677_10009752 Ga0207677_100097522 288
350 3300026023 Ga0207677_10319071 Ga0207677_103190712 288
351 3300026035 Ga0207703_10126184 Ga0207703_101261843 288
352 3300026041 Ga0207639_10010135 Ga0207639_100101359 288
353 3300026041 Ga0207639_10020575 Ga0207639_100205753 288
354 3300026067 Ga0207678_10018343 Ga0207678_100183433 288
355 3300026067 Ga0207678_10021819 Ga0207678_100218193 288
356 3300026067 Ga0207678_10045877 Ga0207678_100458773 288
357 3300026075 Ga0207708_10000696 Ga0207708_1000069626 288
358 3300026075 Ga0207708_10076275 Ga0207708_100762752 288
359 3300026088 Ga0207641_10003213 Ga0207641_1000321313 288
360 3300026089 Ga0207648_10003748 Ga0207648_100037485 288
361 3300026089 Ga0207648_10047383 Ga0207648_100473834 288
362 3300026095 Ga0207676_10086187 Ga0207676_100861872 288
363 3300026118 Ga0207675_100000897 Ga0207675_1000008975 288
364 3300026118 Ga0207675_100083299 Ga0207675_1000832992 288
365 3300026118 Ga0207675_100310950 Ga0207675_1003109502 288
366 3300026121 Ga0207683_10000413 Ga0207683_100004135 288
367 3300026142 Ga0207698_10101182 Ga0207698_101011822 288
368 3300027866 Ga0209813_10013547 Ga0209813_100135473 288
369 3300028379 Ga0268266_10017029 Ga0268266_100170294 288
370 3300028379 Ga0268266_10017989 Ga0268266_100179895 288
371 3300028379 Ga0268266_10091042 Ga0268266_100910422 288
372 3300028380 Ga0268265_10000005 Ga0268265_1000000511 288
373 3300028380 Ga0268265_10027102 Ga0268265_100271024 288
374 3300028380 Ga0268265_10457443 Ga0268265_104574431 288
375 3300028381 Ga0268264_10000177 Ga0268264_1000017742 288
376 3300028381 Ga0268264_10001236 Ga0268264_100012364 288
377 3300031852 Ga0307410_10188774 Ga0307410_101887742 288
378 3300032126 Ga0307415_100265274 Ga0307415_1002652742 288
379 3300035121 Ga0373960_0028288 Ga0373960_0028288_604_1470 288
380 3300035691 Ga0373931_0047852 Ga0373931_0047852_120_986 288
381 3300041452 Ga0451793_0211353 Ga0451793_0211353_497_1369 288
382 3300044765 Ga0466970_0069843 Ga0466970_0069843_596_1477 288
383 3300044765 Ga0466970_0222063 Ga0466970_0222063_104_973 288
384 3300044842 Ga0466957_0028632 Ga0466957_0028632_2351_3232 288
385 3300045049 Ga0466959_0007451 Ga0466959_0007451_872_1753 288
386 3300045836 Ga0466958_0067036 Ga0466958_0067036_109_990 288
387 3300045976 Ga0466967_0037563 Ga0466967_0037563_1122_1988 288
388 3300045976 Ga0466967_0056157 Ga0466967_0056157_979_1860 288
389 3300045976 Ga0466967_0060242 Ga0466967_0060242_962_1828 288
390 3300045976 Ga0466967_0257722 Ga0466967_0257722_673_1539 288
391 3300046524 Ga0495648_0002742 Ga0495648_0002742_7420_8286 288
392 3300046616 Ga0495668_0039421 Ga0495668_0039421_855_1721 288
393 3300047472 Ga0495686_0005724 Ga0495686_0005724_8782_9654 288
394 3300047472 Ga0495686_0080429 Ga0495686_0080429_529_1410 288
395 3300048903 Ga0496100_0004114 Ga0496100_0004114_2632_3498 288
396 3300048904 Ga0496101_0004368 Ga0496101_0004368_4909_5775 288
397 3300048905 Ga0496102_0004208 Ga0496102_0004208_9594_10460 288
398 3300048905 Ga0496102_0005139 Ga0496102_0005139_6207_7073 288
399 3300048905 Ga0496102_0027250 Ga0496102_0027250_637_1503 288
400 3300048906 Ga0496103_0000592 Ga0496103_0000592_27688_28554 288
401 3300048909 Ga0496106_0003432 Ga0496106_0003432_6620_7486 288
402 3300048911 Ga0496108_0003955 Ga0496108_0003955_3086_3952 288
403 3300048911 Ga0496108_0016386 Ga0496108_0016386_3512_4381 288
404 3300048912 Ga0496109_0020229 Ga0496109_0020229_1140_2006 288
405 3300048913 Ga0496110_0081203 Ga0496110_0081203_1350_2216 288
406 3300048913 Ga0496110_0109686 Ga0496110_0109686_60_929 288
407 3300048914 Ga0496111_0211331 Ga0496111_0211331_287_1153 288
408 3300048915 Ga0496112_0239540 Ga0496112_0239540_37_903 288
409 3300048917 Ga0496114_0000487 Ga0496114_0000487_23523_24389 288
410 3300048918 Ga0496115_0040971 Ga0496115_0040971_2319_3185 288
411 3300048919 Ga0496116_0026292 Ga0496116_0026292_1100_1966 288
412 3300048920 Ga0496117_0001773 Ga0496117_0001773_19395_20261 288
413 3300048921 Ga0496118_0002763 Ga0496118_0002763_21203_22069 288
414 3300048922 Ga0496119_0014878 Ga0496119_0014878_4546_5412 288
415 3300048922 Ga0496119_0029642 Ga0496119_0029642_874_1749 288
416 3300048923 Ga0496120_0014595 Ga0496120_0014595_3645_4511 288
417 3300048924 Ga0496121_0006415 Ga0496121_0006415_1159_2025 288
418 3300048928 Ga0496125_0069711 Ga0496125_0069711_1472_2338 288
419 3300049573 Ga0501037_0001645 Ga0501037_0001645_7393_8271 288
420 3300049574 Ga0501038_0014695 Ga0501038_0014695_2940_3818 288
421 3300049575 Ga0501039_0000415 Ga0501039_0000415_21769_22647 288
422 3300049579 Ga0501043_0001031 Ga0501043_0001031_7393_8271 288
423 3300049586 Ga0501070_0000517 Ga0501070_0000517_7868_8746 288
424 3300049823 Ga0501044_0138196 Ga0501044_0138196_1017_1895 288
425 3300050490 nmdc:mga03n38_988_c1 nmdc:mga03n38_988_c1_5767_6636 288
426 3300050491 nmdc:mga00v17_240971_c1 nmdc:mga00v17_240971_c1_70_942 288
427 3300050492 nmdc:mga0yw44_8019_c1 nmdc:mga0yw44_8019_c1_1598_2467 288
428 3300050495 nmdc:mga04h51_15870_c1 nmdc:mga04h51_15870_c1_1277_2146 288
429 3300050509 nmdc:mga0qj67_275730_c1 nmdc:mga0qj67_275730_c1_207_1073 288
430 3300053087 Ga0500643_002399 Ga0500643_002399_6746_7612 288
431 3300053108 Ga0500562_001512 Ga0500562_001512_1989_2855 288
432 iso_pu_bacteria 2902792274 2902794473 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

25

190

0.97

PF03976

PPK2

Polyphosphate kinase 2 (PPK2)

182

233

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhf-assembly1.cif.gz_A crystal structure of polyphosphate kinase 2 from arthrobacter aurescens tc1 0.9744 11 288
3rhf-assembly3.cif.gz_D crystal structure of polyphosphate kinase 2 from arthrobacter aurescens tc1 0.963 11 288
5o6m-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber n121d bound to atp 0.9623 19 273
5lcd-assembly1.cif.gz_A structure of polyphosphate kinase from meiothermus ruber bound to amp 0.9616 19 273
3rhf-assembly1.cif.gz_A crystal structure of polyphosphate kinase 2 from arthrobacter aurescens tc1 0.9541 11 288
ID Description Score Start End Superfamily
3rhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.973 11 288 3.40.50.300
5ldbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9648 23 277 3.40.50.300
3rhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9525 11 288 3.40.50.300
6aqeA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 15 279 3.40.50.300
3czpB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9345 27 266 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X1NMV6-F1-model_v4 Polyphosphate kinase 2 family protein 0.9781 16 288 GO:0006797
GO:0008976
AF-A0A352KHH6-F1-model_v4 Polyphosphate kinase 2 0.9774 30 269 GO:0006797
GO:0008976
AF-A0A560MKG9-F1-model_v4 deleted 0.9771 11 288
AF-A0A7C2GW70-F1-model_v4 RNA polymerase sigma factor SigS 0.977 50 275 GO:0003677
GO:0003700
GO:0006352
GO:0006797
GO:0016301
GO:0016776
AF-A0A3N2AQW8-F1-model_v4 PPK2 family polyphosphate:nucleotide phosphotransferase 0.9764 14 287 GO:0006797
GO:0016776

Feature Viewer

pLDDT pTM Quality
93.03 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map