F442670

General Info

Members Datasets Scaffolds Average Seq Length
432 291 432 142

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0106170|Ga0495641_0106170_637_1116
Length 159
Sequence VLSPTRPIRGKTAGVLIQGKCHCGNISFSLVWDPDPLEIPARACTCSFCTKHGGVWTSYPAGVLRVAIADAARVSRYAFGTETAEFHVCARCGVVPLVTSRIDDNLYAVVSVNAFEGVDPALLRRVTSNLDGEGKDTRLARRKRNWIARVEFVDGRGAG

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
209 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
286 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
287 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
290 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 4.4
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_419017 2162886006 Unclassified 851
2 JGI24740J21852_10005671 3300001979 Bacteria 5255
3 JGI24739J22299_10000597 3300001989 Bacteria 13005
4 JGI24737J22298_10029261 3300001990 Bacteria 1728
5 JGI25153J46596_10008274 3300003215 Bacteria 4993
6 rootH1_10048821 3300003316 Bacteria 4395
7 Ga0006562J51391_1070621 3300003578 Bacteria 10524
8 Ga0006562J51391_1070622 3300003578 Bacteria 7510
9 Ga0055525_1000082 3300003759 Bacteria 159396
10 Ga0055527_1000179 3300003760 Bacteria 42841
11 Ga0055535_1000405 3300003761 Bacteria 40615
12 Ga0055542_1000431 3300003762 Bacteria 40271
13 Ga0055529_1000428 3300003763 Bacteria 42837
14 Ga0065707_10358043 3300005295 Bacteria 908
15 Ga0070658_11062735 3300005327 Unclassified 704
16 Ga0070683_100102277 3300005329 Bacteria 2699
17 Ga0070683_100457522 3300005329 Bacteria 1218
18 Ga0070690_100048283 3300005330 Bacteria 2710
19 Ga0070690_101295100 3300005330 Bacteria 584
20 Ga0070670_100521232 3300005331 Unclassified 1058
21 Ga0070677_10257150 3300005333 Bacteria 870
22 Ga0068869_100223440 3300005334 Bacteria 1493
23 Ga0068869_100779633 3300005334 Bacteria 820
24 Ga0070666_10003267 3300005335 Bacteria 9844
25 Ga0070666_10021535 3300005335 Bacteria 4179
26 Ga0068868_100055063 3300005338 Bacteria 3137
27 Ga0068868_100328802 3300005338 Bacteria 1304
28 Ga0068868_100539902 3300005338 Bacteria 1026
29 Ga0068868_101179819 3300005338 Bacteria 707
30 Ga0070660_100304010 3300005339 Bacteria 1308
31 Ga0070660_100374102 3300005339 Bacteria 1176
32 Ga0070689_100351039 3300005340 Bacteria 1237
33 Ga0070689_100541819 3300005340 Bacteria 1002
34 Ga0070687_100041467 3300005343 Bacteria 2327
35 Ga0070692_10255510 3300005345 Bacteria 1051
36 Ga0070669_100255383 3300005353 Bacteria 1397
37 Ga0070675_100016707 3300005354 Bacteria 5825
38 Ga0070675_100269175 3300005354 Bacteria 1495
39 Ga0070671_100022423 3300005355 Bacteria 5156
40 Ga0070674_101139077 3300005356 Bacteria 690
41 Ga0070673_100214085 3300005364 Bacteria 1665
42 Ga0070659_100644658 3300005366 Bacteria 913
43 Ga0070667_100000235 3300005367 Bacteria 63272
44 Ga0070667_100043017 3300005367 Bacteria 3790
45 Ga0070667_100157653 3300005367 Bacteria 1997
46 Ga0070667_100647049 3300005367 Bacteria 976
47 Ga0070709_10080646 3300005434 Bacteria 2122
48 Ga0070713_100002285 3300005436 Bacteria 12459
49 Ga0070710_10012175 3300005437 Bacteria 4264
50 Ga0070701_10053332 3300005438 Bacteria 2104
51 Ga0070705_100000798 3300005440 Bacteria 17772
52 Ga0070705_100014059 3300005440 Bacteria 4108
53 Ga0070705_100337496 3300005440 Bacteria 1094
54 Ga0070705_100440637 3300005440 Bacteria 975
55 Ga0070700_100444049 3300005441 Bacteria 985
56 Ga0070694_100024350 3300005444 Bacteria 3907
57 Ga0070694_100024699 3300005444 Bacteria 3880
58 Ga0070708_100190741 3300005445 Bacteria 1917
59 Ga0070663_100000583 3300005455 Bacteria 19478
60 Ga0070663_100144843 3300005455 Bacteria 1817
61 Ga0070678_100010462 3300005456 Bacteria 5671
62 Ga0070662_100035414 3300005457 Bacteria 3525
63 Ga0070662_100311405 3300005457 Unclassified 1282
64 Ga0070662_100405337 3300005457 Bacteria 1126
65 Ga0070681_10000790 3300005458 Bacteria 26387
66 Ga0070681_10866082 3300005458 Bacteria 821
67 Ga0068867_100098725 3300005459 Bacteria 2227
68 Ga0068867_100294809 3300005459 Bacteria 1335
69 Ga0070685_10779732 3300005466 Unclassified 703
70 Ga0070706_100185461 3300005467 Bacteria 1944
71 Ga0070698_100232641 3300005471 Bacteria 1776
72 Ga0070699_100004429 3300005518 Bacteria 12418
73 Ga0070699_100017291 3300005518 Bacteria 6193
74 Ga0070699_100027592 3300005518 Bacteria 4896
75 Ga0070699_100551439 3300005518 Bacteria 1049
76 Ga0070679_100200759 3300005530 Bacteria 1960
77 Ga0070697_100003801 3300005536 Bacteria 11595
78 Ga0068853_100019259 3300005539 Bacteria 5657
79 Ga0068853_100553884 3300005539 Bacteria 1089
80 Ga0070672_100284204 3300005543 Bacteria 1400
81 Ga0070686_100382495 3300005544 Bacteria 1066
82 Ga0070695_100000996 3300005545 Bacteria 15419
83 Ga0070696_100001647 3300005546 Bacteria 14646
84 Ga0070693_100294903 3300005547 Bacteria 1091
85 Ga0070693_100660569 3300005547 Bacteria 761
86 Ga0070693_101164254 3300005547 Bacteria 591
87 Ga0070704_100043520 3300005549 Bacteria 3113
88 Ga0068855_100006624 3300005563 Bacteria 14070
89 Ga0068855_100321299 3300005563 Bacteria 1711
90 Ga0070664_100176270 3300005564 Unclassified 1898
91 Ga0070664_100311043 3300005564 Bacteria 1425
92 Ga0070664_100795998 3300005564 Bacteria 884
93 Ga0068857_100001024 3300005577 Bacteria 21585
94 Ga0068857_100308976 3300005577 Unclassified 1458
95 Ga0068854_100000287 3300005578 Bacteria 33813
96 Ga0068854_100004984 3300005578 Bacteria 8374
97 Ga0068854_100019471 3300005578 Bacteria 4574
98 Ga0068854_100829509 3300005578 Bacteria 808
99 Ga0068854_101742141 3300005578 Unclassified 570
100 Ga0068856_100000138 3300005614 Bacteria 73748
101 Ga0068856_100044167 3300005614 Bacteria 4384
102 Ga0070702_100401168 3300005615 Unclassified 981
103 Ga0070702_100600561 3300005615 Bacteria 825
104 Ga0068852_100670123 3300005616 Unclassified 1046
105 Ga0068859_100013616 3300005617 Bacteria 8153
106 Ga0068859_100197554 3300005617 Bacteria 2096
107 Ga0068859_101656672 3300005617 Bacteria 706
108 Ga0068864_100265372 3300005618 Bacteria 1598
109 Ga0068861_100078670 3300005719 Bacteria 2576
110 Ga0068861_100105457 3300005719 Unclassified 2251
111 Ga0068851_10055845 3300005834 Bacteria 2012
112 Ga0068870_10070540 3300005840 Bacteria 1904
113 Ga0068863_100052991 3300005841 Bacteria 3844
114 Ga0068858_100016361 3300005842 Bacteria 6966
115 Ga0068858_100068808 3300005842 Bacteria 3281
116 Ga0068858_100138919 3300005842 Bacteria 2281
117 Ga0068858_100385750 3300005842 Bacteria 1345
118 Ga0068858_100714540 3300005842 Bacteria 975
119 Ga0068860_100007576 3300005843 Bacteria 10863
120 Ga0068860_100041141 3300005843 Bacteria 4414
121 Ga0068860_100048100 3300005843 Bacteria 4065
122 Ga0068862_102395839 3300005844 Bacteria 539
123 Ga0070715_10000363 3300006163 Bacteria 11345
124 Ga0070716_100381523 3300006173 Bacteria 1007
125 Ga0070712_100287823 3300006175 Bacteria 1325
126 Ga0097621_100005189 3300006237 Bacteria 9153
127 Ga0097621_100749676 3300006237 Bacteria 902
128 Ga0068871_100055789 3300006358 Bacteria 3208
129 Ga0075428_100006720 3300006844 Bacteria 12796
130 Ga0075430_101051964 3300006846 Unclassified 670
131 Ga0075431_101208796 3300006847 Unclassified 718
132 Ga0075433_10135790 3300006852 Bacteria 2186
133 Ga0075434_100812264 3300006871 Unclassified 951
134 Ga0075429_100186650 3300006880 Bacteria 1817
135 Ga0068865_100084987 3300006881 Bacteria 2282
136 Ga0075436_100214328 3300006914 Bacteria 1365
137 Ga0097620_100013616 3300006931 Bacteria 8153
138 Ga0097620_100197564 3300006931 Bacteria 2096
139 Ga0097620_101656745 3300006931 Bacteria 706
140 Ga0075435_100624168 3300007076 Bacteria 935
141 Ga0075435_101439930 3300007076 Bacteria 604
142 Ga0099794_10122322 3300007265 Bacteria 1310
143 Ga0099794_10184855 3300007265 Bacteria 1064
144 Ga0105240_10003821 3300009093 Bacteria 23283
145 Ga0105240_10009271 3300009093 Bacteria 13959
146 Ga0105240_10019850 3300009093 Bacteria 8977
147 Ga0105240_10139652 3300009093 Bacteria 2898
148 Ga0105240_10515063 3300009093 Bacteria 1328
149 Ga0105240_10628164 3300009093 Bacteria 1180
150 Ga0111539_10001080 3300009094 Bacteria 36018
151 Ga0111539_11001580 3300009094 Bacteria 971
152 Ga0105245_10286176 3300009098 Bacteria 1613
153 Ga0105245_11459392 3300009098 Bacteria 735
154 Ga0105247_10030152 3300009101 Bacteria 3288
155 Ga0114129_10169477 3300009147 Bacteria 2977
156 Ga0105243_10059127 3300009148 Bacteria 3058
157 Ga0105243_11241356 3300009148 Unclassified 760
158 Ga0105241_10004061 3300009174 Bacteria 10829
159 Ga0105242_10105300 3300009176 Bacteria 2396
160 Ga0105248_10000167 3300009177 Bacteria 76591
161 Ga0105248_10372328 3300009177 Bacteria 1608
162 Ga0105248_11352055 3300009177 Bacteria 806
163 Ga0105237_10000095 3300009545 Bacteria 121776
164 Ga0105237_10002091 3300009545 Bacteria 25231
165 Ga0105237_10017179 3300009545 Bacteria 7505
166 Ga0105237_11065513 3300009545 Unclassified 815
167 Ga0105238_10245616 3300009551 Bacteria 1768
168 Ga0105249_10000271 3300009553 Bacteria 54577
169 Ga0105249_10228087 3300009553 Bacteria 1836
170 Ga0105239_10052491 3300010375 Bacteria 4471
171 Ga0105239_10324924 3300010375 Bacteria 1735
172 Ga0105239_10634656 3300010375 Unclassified 1219
173 Ga0105239_10656922 3300010375 Bacteria 1198
174 Ga0105239_11502729 3300010375 Bacteria 778
175 Ga0157314_1000065 3300012500 Bacteria 11331
176 Ga0157373_10299527 3300013100 Unclassified 1141
177 Ga0157369_10250374 3300013105 Bacteria 1849
178 Ga0157369_10443156 3300013105 Bacteria 1345
179 Ga0157374_10040089 3300013296 Bacteria 4312
180 Ga0157378_10005124 3300013297 Bacteria 11505
181 Ga0157378_10097505 3300013297 Bacteria 2680
182 Ga0157378_12074984 3300013297 Unclassified 619
183 Ga0163162_10013023 3300013306 Bacteria 8118
184 Ga0163162_12966540 3300013306 Bacteria 545
185 Ga0157375_10194576 3300013308 Bacteria 2183
186 Ga0157375_10502638 3300013308 Bacteria 1376
187 Ga0163163_10658952 3300014325 Bacteria 1110
188 Ga0157380_10121583 3300014326 Bacteria 2212
189 Ga0157380_11902594 3300014326 Unclassified 655
190 Ga0157377_11244914 3300014745 Unclassified 579
191 Ga0157377_11719531 3300014745 Unclassified 507
192 Ga0157379_10068194 3300014968 Bacteria 3180
193 Ga0157376_10032855 3300014969 Bacteria 4171
194 Ga0157376_10297039 3300014969 Bacteria 1527
195 Ga0157376_11925619 3300014969 Unclassified 628
196 Ga0213874_10006886 3300021377 Bacteria 2708
197 Ga0209672_100826 3300025228 Bacteria 14489
198 Ga0209563_100097 3300025230 Bacteria 159453
199 Ga0209129_1002332 3300025258 Bacteria 9398
200 Ga0209758_1000417 3300025297 Bacteria 72277
201 Ga0207656_10002105 3300025321 Bacteria 6652
202 Ga0207653_10429876 3300025885 Unclassified 518
203 Ga0207682_10127338 3300025893 Bacteria 1134
204 Ga0207692_10009583 3300025898 Bacteria 4052
205 Ga0207642_10121873 3300025899 Bacteria 1347
206 Ga0207688_10133315 3300025901 Bacteria 1457
207 Ga0207680_10013389 3300025903 Bacteria 4212
208 Ga0207680_10344261 3300025903 Bacteria 1046
209 Ga0207680_10913425 3300025903 Bacteria 629
210 Ga0207647_10016127 3300025904 Bacteria 5105
211 Ga0207685_10159855 3300025905 Bacteria 1028
212 Ga0207643_10044964 3300025908 Bacteria 2493
213 Ga0207707_10024269 3300025912 Bacteria 5306
214 Ga0207707_10085348 3300025912 Bacteria 2758
215 Ga0207695_10001371 3300025913 Bacteria 41340
216 Ga0207695_10010635 3300025913 Bacteria 11243
217 Ga0207695_10170504 3300025913 Bacteria 2102
218 Ga0207695_10344067 3300025913 Bacteria 1379
219 Ga0207695_10448458 3300025913 Bacteria 1173
220 Ga0207695_10520430 3300025913 Bacteria 1071
221 Ga0207671_10000026 3300025914 Bacteria 268845
222 Ga0207671_10008618 3300025914 Bacteria 8617
223 Ga0207671_10271692 3300025914 Bacteria 1336
224 Ga0207693_10002400 3300025915 Bacteria 16262
225 Ga0207693_10010091 3300025915 Bacteria 7671
226 Ga0207663_10336188 3300025916 Bacteria 1139
227 Ga0207660_10303650 3300025917 Unclassified 1271
228 Ga0207662_10100923 3300025918 Bacteria 1788
229 Ga0207657_10027904 3300025919 Bacteria 5161
230 Ga0207657_10210929 3300025919 Bacteria 1559
231 Ga0207649_10558642 3300025920 Bacteria 876
232 Ga0207694_10114976 3300025924 Bacteria 2143
233 Ga0207659_10196396 3300025926 Bacteria 1608
234 Ga0207687_10174074 3300025927 Bacteria 1662
235 Ga0207700_10437240 3300025928 Unclassified 1151
236 Ga0207664_10361608 3300025929 Bacteria 1286
237 Ga0207644_10095321 3300025931 Bacteria 2225
238 Ga0207706_10047063 3300025933 Unclassified 3817
239 Ga0207706_10466849 3300025933 Bacteria 1091
240 Ga0207686_11513425 3300025934 Unclassified 553
241 Ga0207704_10083840 3300025938 Bacteria 2069
242 Ga0207665_10003249 3300025939 Bacteria 10881
243 Ga0207665_10017232 3300025939 Bacteria 4745
244 Ga0207691_10245936 3300025940 Bacteria 1545
245 Ga0207711_10000538 3300025941 Bacteria 38775
246 Ga0207711_10059125 3300025941 Bacteria 3300
247 Ga0207689_10024726 3300025942 Bacteria 5035
248 Ga0207661_10100378 3300025944 Bacteria 2429
249 Ga0207661_10978816 3300025944 Bacteria 779
250 Ga0207679_10227376 3300025945 Unclassified 1573
251 Ga0207667_10000432 3300025949 Bacteria 56395
252 Ga0207667_10001233 3300025949 Bacteria 32072
253 Ga0207651_10476832 3300025960 Bacteria 1075
254 Ga0207712_10000301 3300025961 Bacteria 46175
255 Ga0207640_10000025 3300025981 Bacteria 143903
256 Ga0207640_10000208 3300025981 Bacteria 41443
257 Ga0207658_10000056 3300025986 Bacteria 124846
258 Ga0207658_10368431 3300025986 Bacteria 1255
259 Ga0207658_11394288 3300025986 Bacteria 641
260 Ga0207677_10170041 3300026023 Bacteria 1703
261 Ga0207677_10194345 3300026023 Bacteria 1607
262 Ga0207677_10646811 3300026023 Bacteria 933
263 Ga0207703_10029736 3300026035 Bacteria 4312
264 Ga0207703_10036054 3300026035 Bacteria 3934
265 Ga0207703_10255741 3300026035 Bacteria 1581
266 Ga0207703_10308858 3300026035 Bacteria 1445
267 Ga0207703_10683879 3300026035 Bacteria 975
268 Ga0207639_10016763 3300026041 Bacteria 5189
269 Ga0207678_10000389 3300026067 Bacteria 39987
270 Ga0207678_10073514 3300026067 Bacteria 2930
271 Ga0207678_10149186 3300026067 Bacteria 1996
272 Ga0207678_11165814 3300026067 Bacteria 682
273 Ga0207708_10373727 3300026075 Bacteria 1174
274 Ga0207702_10000740 3300026078 Bacteria 34919
275 Ga0207702_10049557 3300026078 Bacteria 3544
276 Ga0207702_10841088 3300026078 Unclassified 908
277 Ga0207641_10426240 3300026088 Bacteria 1278
278 Ga0207641_10674314 3300026088 Bacteria 1017
279 Ga0207648_10034730 3300026089 Unclassified 4444
280 Ga0207648_10149622 3300026089 Bacteria 2060
281 Ga0207648_10397061 3300026089 Bacteria 1249
282 Ga0207676_10829741 3300026095 Bacteria 903
283 Ga0207674_10000695 3300026116 Bacteria 43737
284 Ga0207675_100196546 3300026118 Bacteria 1936
285 Ga0207675_100228782 3300026118 Bacteria 1793
286 Ga0207683_10001886 3300026121 Bacteria 18558
287 Ga0207683_10512951 3300026121 Bacteria 1108
288 Ga0207698_11464147 3300026142 Bacteria 698
289 Ga0209981_1078091 3300027378 Unclassified 515
290 Ga0209999_1067243 3300027543 Unclassified 685
291 Ga0209971_1026597 3300027682 Bacteria 1383
292 Ga0207428_10008673 3300027907 Bacteria 9181
293 Ga0268266_10493291 3300028379 Bacteria 1169
294 Ga0268264_10013866 3300028381 Bacteria 6627
295 Ga0268264_10036317 3300028381 Bacteria 4059
296 Ga0268264_10163347 3300028381 Bacteria 2008
297 Ga0268264_10752494 3300028381 Bacteria 971
298 Ga0265332_10026980 3300031238 Bacteria 2517
299 Ga0307516_10000067 3300031730 Bacteria 111575
300 Ga0307416_101473391 3300032002 Unclassified 786
301 Ga0307416_102110455 3300032002 Bacteria 665
302 Ga0307507_10283216 3300033179 Unclassified 1034
303 Ga0373929_0112956 3300035085 Bacteria 696
304 Ga0373952_0039646 3300035092 Bacteria 1083
305 Ga0373936_0013565 3300035113 Bacteria 3110
306 Ga0373939_0044601 3300035114 Bacteria 1350
307 Ga0373945_0134708 3300035116 Bacteria 992
308 Ga0373953_0101771 3300035117 Bacteria 1209
309 Ga0373954_0124317 3300035118 Bacteria 1253
310 Ga0373954_0129632 3300035118 Bacteria 1227
311 Ga0373957_0061179 3300035120 Bacteria 1458
312 Ga0373957_0415640 3300035120 Unclassified 580
313 Ga0373960_0039238 3300035121 Bacteria 1361
314 Ga0373943_0022072 3300035170 Bacteria 2945
315 Ga0373955_0020045 3300035172 Bacteria 3354
316 Ga0373955_0050039 3300035172 Bacteria 2271
317 Ga0373942_0009125 3300035207 Bacteria 2317
318 Ga0373961_0011535 3300035241 Bacteria 2195
319 Ga0373924_0007500 3300035410 Bacteria 3940
320 Ga0373931_0088881 3300035691 Bacteria 1718
321 Ga0373935_0070722 3300035692 Bacteria 2250
322 Ga0373935_1196413 3300035692 Unclassified 566
323 Ga0373927_0016136 3300035695 Bacteria 4928
324 Ga0373933_0016236 3300035724 Bacteria 4160
325 Ga0373933_0140040 3300035724 Bacteria 1527
326 Ga0373933_0608754 3300035724 Unclassified 717
327 Ga0373947_0015434 3300035725 Bacteria 4385
328 Ga0373937_0072137 3300036401 Bacteria 3184
329 Ga0373937_0229951 3300036401 Bacteria 1746
330 Ga0373925_0026048 3300037068 Bacteria 4276
331 Ga0373925_0990476 3300037068 Unclassified 692
332 Ga0395905_0001200 3300037471 Bacteria 32396
333 Ga0436360_0217279 3300039438 Bacteria 2534
334 Ga0436363_0215343 3300039450 Bacteria 1736
335 Ga0436363_0475575 3300039450 Bacteria 6155
336 Ga0439453_0066318 3300041408 Unclassified 756
337 Ga0439461_0146470 3300041410 Unclassified 607
338 Ga0451800_0579666 3300041459 Bacteria 1091
339 Ga0439441_028661 3300042001 Bacteria 1068
340 Ga0439443_024284 3300042003 Unclassified 971
341 Ga0439456_031087 3300042013 Bacteria 1143
342 Ga0439446_0086701 3300042156 Bacteria 976
343 Ga0439435_0001421 3300042436 Bacteria 4415
344 Ga0439460_0120596 3300042461 Bacteria 857
345 Ga0466969_0030676 3300044656 Bacteria 2739
346 Ga0466969_0154688 3300044656 Bacteria 1055
347 Ga0466972_0010969 3300044658 Bacteria 4548
348 Ga0466982_0000015 3300044672 Bacteria 131281
349 Ga0466964_0002674 3300044706 Bacteria 6382
350 Ga0466971_0006084 3300044719 Bacteria 5250
351 Ga0466968_0003252 3300044735 Bacteria 5985
352 Ga0466970_0172606 3300044765 Bacteria 1198
353 Ga0466970_0942895 3300044765 Bacteria 508
354 Ga0466957_0056144 3300044842 Bacteria 2407
355 Ga0466957_0221365 3300044842 Bacteria 1250
356 Ga0466957_0265978 3300044842 Bacteria 1144
357 Ga0466960_0048892 3300044901 Bacteria 2033
358 Ga0466959_0468038 3300045049 Bacteria 854
359 Ga0451576_0347992 3300045051 Bacteria 1552
360 Ga0466958_0093619 3300045836 Bacteria 1861
361 Ga0495592_0532414 3300046454 Bacteria 725
362 Ga0495629_0284455 3300046459 Bacteria 1134
363 Ga0495641_0106170 3300046461 Unclassified 1253
364 Ga0495580_0019324 3300046472 Bacteria 5062
365 Ga0495580_0019513 3300046472 Bacteria 5037
366 Ga0495580_0074360 3300046472 Bacteria 2371
367 Ga0495582_0274301 3300046473 Bacteria 968
368 Ga0495594_0009332 3300046499 Bacteria 5068
369 Ga0495608_0187105 3300046511 Bacteria 1308
370 Ga0495618_0624424 3300046514 Unclassified 639
371 Ga0495630_0624608 3300046517 Unclassified 825
372 Ga0495665_0177658 3300046531 Bacteria 1107
373 Ga0495586_0701257 3300046535 Unclassified 584
374 Ga0495587_0461325 3300046536 Unclassified 703
375 Ga0495621_0072254 3300046539 Bacteria 1273
376 Ga0495622_0082711 3300046557 Bacteria 1477
377 Ga0495667_0108506 3300046559 Bacteria 1793
378 Ga0495646_0477619 3300046680 Bacteria 642
379 Ga0495647_0303285 3300046681 Bacteria 720
380 Ga0495624_0126061 3300046690 Bacteria 1571
381 Ga0495671_0226406 3300046692 Bacteria 905
382 Ga0495581_0569196 3300047315 Bacteria 657
383 Ga0495604_0125088 3300047317 Bacteria 1855
384 Ga0495674_0446016 3300047319 Bacteria 1040
385 Ga0495680_0019856 3300047322 Bacteria 5664
386 Ga0495686_0004347 3300047472 Bacteria 11705
387 Ga0495593_0205694 3300047673 Bacteria 989
388 Ga0496100_0135429 3300048903 Bacteria 1739
389 Ga0496101_0120702 3300048904 Bacteria 1981
390 Ga0496102_0056347 3300048905 Bacteria 3585
391 Ga0496102_0119776 3300048905 Bacteria 2458
392 Ga0496104_0371098 3300048907 Bacteria 1343
393 Ga0496105_0187844 3300048908 Bacteria 1690
394 Ga0496106_0068273 3300048909 Bacteria 2711
395 Ga0496107_0253845 3300048910 Bacteria 1308
396 Ga0496108_0004541 3300048911 Bacteria 11179
397 Ga0496108_1090921 3300048911 Bacteria 679
398 Ga0496109_0036912 3300048912 Bacteria 4413
399 Ga0496110_0013721 3300048913 Bacteria 6712
400 Ga0496111_0039621 3300048914 Bacteria 3379
401 Ga0496112_0119271 3300048915 Bacteria 2608
402 Ga0496112_0157878 3300048915 Bacteria 2235
403 Ga0496113_0412607 3300048916 Bacteria 1084
404 Ga0496114_0074064 3300048917 Bacteria 2866
405 Ga0496115_0097813 3300048918 Bacteria 2403
406 Ga0496118_0235633 3300048921 Bacteria 1052
407 Ga0496121_0029393 3300048924 Bacteria 5082
408 Ga0496121_0055497 3300048924 Bacteria 3300
409 Ga0496122_0005693 3300048925 Bacteria 14708
410 Ga0496123_0004026 3300048926 Bacteria 15858
411 Ga0496125_0000643 3300048928 Bacteria 58244
412 Ga0496126_0313393 3300048929 Unclassified 1291
413 Ga0501040_0670707 3300049576 Bacteria 749
414 nmdc:mga07m45_119095_c1 3300050496 Bacteria 1524
415 nmdc:mga09592_177764_c1 3300050508 Bacteria 1841
416 nmdc:mga0qj67_319637_c1 3300050509 Bacteria 1257
417 nmdc:mga0qj67_375891_c1 3300050509 Unclassified 1148
418 nmdc:mga08y16_7124_c1 3300050511 Bacteria 11735
419 nmdc:mga0n895_798372_c1 3300050512 Unclassified 934
420 nmdc:mga0rr50_464368_c1 3300050513 Bacteria 1074
421 nmdc:mga08x19_219982_c2 3300050514 Unclassified 797
422 Ga0495601_0342936 3300053077 Bacteria 972
423 Ga0500635_0111634 3300053080 Unclassified 1016
424 Ga0495595_0175930 3300053084 Bacteria 1060
425 Ga0500566_0223875 3300053094 Unclassified 933
426 Ga0500597_000432 3300053120 Bacteria 8806
427 Ga0500597_158327 3300053120 Bacteria 969
428 Ga0500614_085401 3300053123 Unclassified 889
429 Ga0500658_0429254 3300053134 Bacteria 603
430 Ga0500636_0229528 3300053177 Bacteria 961
431 Ga0500637_0294121 3300053178 Unclassified 888
432 Ga0466962_0005764 3300061719 Bacteria 5950

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10658952 Ga0163163_106589522 128
2 3300014745 Ga0157377_11244914 Ga0157377_112449141 131
3 3300005458 Ga0070681_10000790 Ga0070681_100007902 138
4 3300025912 Ga0207707_10085348 Ga0207707_100853482 138
5 3300039438 Ga0436360_0217279 Ga0436360_0217279_2013_2429 138
6 3300003759 Ga0055525_1000082 Ga0055525_1000082115 139
7 3300003760 Ga0055527_1000179 Ga0055527_100017924 139
8 3300003761 Ga0055535_1000405 Ga0055535_100040520 139
9 3300003762 Ga0055542_1000431 Ga0055542_100043119 139
10 3300003763 Ga0055529_1000428 Ga0055529_100042823 139
11 3300005333 Ga0070677_10257150 Ga0070677_102571501 139
12 3300005334 Ga0068869_100223440 Ga0068869_1002234402 139
13 3300005334 Ga0068869_100779633 Ga0068869_1007796331 139
14 3300005335 Ga0070666_10003267 Ga0070666_1000326710 139
15 3300005338 Ga0068868_100055063 Ga0068868_1000550633 139
16 3300005338 Ga0068868_100539902 Ga0068868_1005399023 139
17 3300005340 Ga0070689_100351039 Ga0070689_1003510392 139
18 3300005353 Ga0070669_100255383 Ga0070669_1002553832 139
19 3300005354 Ga0070675_100016707 Ga0070675_1000167077 139
20 3300005355 Ga0070671_100022423 Ga0070671_1000224237 139
21 3300005356 Ga0070674_101139077 Ga0070674_1011390771 139
22 3300005364 Ga0070673_100214085 Ga0070673_1002140852 139
23 3300005367 Ga0070667_100043017 Ga0070667_1000430177 139
24 3300005434 Ga0070709_10080646 Ga0070709_100806461 139
25 3300005436 Ga0070713_100002285 Ga0070713_1000022854 139
26 3300005437 Ga0070710_10012175 Ga0070710_100121757 139
27 3300005440 Ga0070705_100440637 Ga0070705_1004406371 139
28 3300005441 Ga0070700_100444049 Ga0070700_1004440491 139
29 3300005456 Ga0070678_100010462 Ga0070678_1000104626 139
30 3300005459 Ga0068867_100098725 Ga0068867_1000987252 139
31 3300005518 Ga0070699_100004429 Ga0070699_1000044298 139
32 3300005543 Ga0070672_100284204 Ga0070672_1002842042 139
33 3300005547 Ga0070693_100660569 Ga0070693_1006605692 139
34 3300005563 Ga0068855_100321299 Ga0068855_1003212993 139
35 3300005614 Ga0068856_100000138 Ga0068856_10000013854 139
36 3300005614 Ga0068856_100044167 Ga0068856_1000441677 139
37 3300005618 Ga0068864_100265372 Ga0068864_1002653723 139
38 3300005840 Ga0068870_10070540 Ga0068870_100705404 139
39 3300005841 Ga0068863_100052991 Ga0068863_1000529913 139
40 3300005843 Ga0068860_100041141 Ga0068860_1000411416 139
41 3300005844 Ga0068862_102395839 Ga0068862_1023958391 139
42 3300006163 Ga0070715_10000363 Ga0070715_100003638 139
43 3300006173 Ga0070716_100381523 Ga0070716_1003815231 139
44 3300006175 Ga0070712_100287823 Ga0070712_1002878232 139
45 3300006237 Ga0097621_100005189 Ga0097621_1000051899 139
46 3300006846 Ga0075430_101051964 Ga0075430_1010519642 139
47 3300006847 Ga0075431_101208796 Ga0075431_1012087962 139
48 3300006881 Ga0068865_100084987 Ga0068865_1000849872 139
49 3300007076 Ga0075435_100624168 Ga0075435_1006241682 139
50 3300009098 Ga0105245_10286176 Ga0105245_102861762 139
51 3300009101 Ga0105247_10030152 Ga0105247_100301526 139
52 3300009147 Ga0114129_10169477 Ga0114129_101694774 139
53 3300009148 Ga0105243_11241356 Ga0105243_112413562 139
54 3300009174 Ga0105241_10004061 Ga0105241_1000406111 139
55 3300009176 Ga0105242_10105300 Ga0105242_101053002 139
56 3300009545 Ga0105237_10017179 Ga0105237_100171792 139
57 3300010375 Ga0105239_10656922 Ga0105239_106569222 139
58 3300013296 Ga0157374_10040089 Ga0157374_100400897 139
59 3300013297 Ga0157378_10005124 Ga0157378_100051249 139
60 3300013306 Ga0163162_10013023 Ga0163162_100130236 139
61 3300013308 Ga0157375_10194576 Ga0157375_101945762 139
62 3300014326 Ga0157380_11902594 Ga0157380_119025942 139
63 3300014745 Ga0157377_11719531 Ga0157377_117195311 139
64 3300014968 Ga0157379_10068194 Ga0157379_100681942 139
65 3300014969 Ga0157376_10297039 Ga0157376_102970392 139
66 3300021377 Ga0213874_10006886 Ga0213874_100068863 139
67 3300025230 Ga0209563_100097 Ga0209563_100097117 139
68 3300025893 Ga0207682_10127338 Ga0207682_101273382 139
69 3300025898 Ga0207692_10009583 Ga0207692_100095833 139
70 3300025899 Ga0207642_10121873 Ga0207642_101218733 139
71 3300025901 Ga0207688_10133315 Ga0207688_101333152 139
72 3300025903 Ga0207680_10344261 Ga0207680_103442612 139
73 3300025905 Ga0207685_10159855 Ga0207685_101598552 139
74 3300025908 Ga0207643_10044964 Ga0207643_100449642 139
75 3300025915 Ga0207693_10002400 Ga0207693_1000240024 139
76 3300025916 Ga0207663_10336188 Ga0207663_103361882 139
77 3300025926 Ga0207659_10196396 Ga0207659_101963962 139
78 3300025927 Ga0207687_10174074 Ga0207687_101740742 139
79 3300025928 Ga0207700_10437240 Ga0207700_104372402 139
80 3300025931 Ga0207644_10095321 Ga0207644_100953212 139
81 3300025934 Ga0207686_11513425 Ga0207686_115134252 139
82 3300025938 Ga0207704_10083840 Ga0207704_100838402 139
83 3300025939 Ga0207665_10003249 Ga0207665_100032498 139
84 3300025941 Ga0207711_10059125 Ga0207711_100591252 139
85 3300025942 Ga0207689_10024726 Ga0207689_100247269 139
86 3300026023 Ga0207677_10170041 Ga0207677_101700412 139
87 3300026023 Ga0207677_10646811 Ga0207677_106468112 139
88 3300026075 Ga0207708_10373727 Ga0207708_103737272 139
89 3300026078 Ga0207702_10000740 Ga0207702_100007407 139
90 3300026088 Ga0207641_10426240 Ga0207641_104262403 139
91 3300026089 Ga0207648_10149622 Ga0207648_101496224 139
92 3300026095 Ga0207676_10829741 Ga0207676_108297412 139
93 3300026121 Ga0207683_10001886 Ga0207683_1000188618 139
94 3300027378 Ga0209981_1078091 Ga0209981_10780911 139
95 3300027543 Ga0209999_1067243 Ga0209999_10672431 139
96 3300027682 Ga0209971_1026597 Ga0209971_10265972 139
97 3300028381 Ga0268264_10163347 Ga0268264_101633472 139
98 3300031730 Ga0307516_10000067 Ga0307516_1000006756 139
99 3300032002 Ga0307416_102110455 Ga0307416_1021104552 139
100 3300035116 Ga0373945_0134708 Ga0373945_0134708_133_552 139
101 3300035118 Ga0373954_0124317 Ga0373954_0124317_295_714 139
102 3300035120 Ga0373957_0415640 Ga0373957_0415640_137_556 139
103 3300035172 Ga0373955_0050039 Ga0373955_0050039_537_956 139
104 3300035692 Ga0373935_0070722 Ga0373935_0070722_923_1342 139
105 3300035695 Ga0373927_0016136 Ga0373927_0016136_1299_1718 139
106 3300035724 Ga0373933_0140040 Ga0373933_0140040_824_1243 139
107 3300035725 Ga0373947_0015434 Ga0373947_0015434_582_1001 139
108 3300036401 Ga0373937_0229951 Ga0373937_0229951_277_696 139
109 3300037068 Ga0373925_0026048 Ga0373925_0026048_811_1230 139
110 3300039450 Ga0436363_0475575 Ga0436363_0475575_938_1357 139
111 3300041408 Ga0439453_0066318 Ga0439453_0066318_327_746 139
112 3300041410 Ga0439461_0146470 Ga0439461_0146470_59_478 139
113 3300042001 Ga0439441_028661 Ga0439441_028661_585_1004 139
114 3300042003 Ga0439443_024284 Ga0439443_024284_146_565 139
115 3300042013 Ga0439456_031087 Ga0439456_031087_670_1089 139
116 3300042156 Ga0439446_0086701 Ga0439446_0086701_485_904 139
117 3300042436 Ga0439435_0001421 Ga0439435_0001421_2586_3005 139
118 3300042461 Ga0439460_0120596 Ga0439460_0120596_305_724 139
119 3300044842 Ga0466957_0265978 Ga0466957_0265978_166_585 139
120 3300046454 Ga0495592_0532414 Ga0495592_0532414_55_474 139
121 3300046459 Ga0495629_0284455 Ga0495629_0284455_201_620 139
122 3300046472 Ga0495580_0019324 Ga0495580_0019324_2806_3225 139
123 3300046472 Ga0495580_0019513 Ga0495580_0019513_1860_2279 139
124 3300046473 Ga0495582_0274301 Ga0495582_0274301_397_816 139
125 3300046531 Ga0495665_0177658 Ga0495665_0177658_36_455 139
126 3300046535 Ga0495586_0701257 Ga0495586_0701257_132_551 139
127 3300046680 Ga0495646_0477619 Ga0495646_0477619_83_502 139
128 3300046681 Ga0495647_0303285 Ga0495647_0303285_52_471 139
129 3300047315 Ga0495581_0569196 Ga0495581_0569196_200_619 139
130 3300047319 Ga0495674_0446016 Ga0495674_0446016_186_605 139
131 3300048903 Ga0496100_0135429 Ga0496100_0135429_207_626 139
132 3300048904 Ga0496101_0120702 Ga0496101_0120702_940_1359 139
133 3300048905 Ga0496102_0056347 Ga0496102_0056347_1777_2196 139
134 3300048907 Ga0496104_0371098 Ga0496104_0371098_129_548 139
135 3300048908 Ga0496105_0187844 Ga0496105_0187844_745_1164 139
136 3300048909 Ga0496106_0068273 Ga0496106_0068273_1356_1775 139
137 3300048910 Ga0496107_0253845 Ga0496107_0253845_17_436 139
138 3300048911 Ga0496108_0004541 Ga0496108_0004541_1639_2058 139
139 3300048912 Ga0496109_0036912 Ga0496109_0036912_2975_3394 139
140 3300048913 Ga0496110_0013721 Ga0496110_0013721_3498_3917 139
141 3300048914 Ga0496111_0039621 Ga0496111_0039621_453_872 139
142 3300048915 Ga0496112_0119271 Ga0496112_0119271_153_572 139
143 3300048916 Ga0496113_0412607 Ga0496113_0412607_527_946 139
144 3300048917 Ga0496114_0074064 Ga0496114_0074064_1068_1487 139
145 3300048918 Ga0496115_0097813 Ga0496115_0097813_1462_1881 139
146 3300049576 Ga0501040_0670707 Ga0501040_0670707_240_659 139
147 3300050509 nmdc:mga0qj67_319637_c1 nmdc:mga0qj67_319637_c1_218_637 139
148 3300050509 nmdc:mga0qj67_375891_c1 nmdc:mga0qj67_375891_c1_391_810 139
149 3300050513 nmdc:mga0rr50_464368_c1 nmdc:mga0rr50_464368_c1_217_636 139
150 3300053077 Ga0495601_0342936 Ga0495601_0342936_435_854 139
151 3300005330 Ga0070690_100048283 Ga0070690_1000482836 140
152 3300005345 Ga0070692_10255510 Ga0070692_102555102 140
153 3300005438 Ga0070701_10053332 Ga0070701_100533323 140
154 3300005549 Ga0070704_100043520 Ga0070704_1000435201 140
155 3300005578 Ga0068854_101742141 Ga0068854_1017421411 140
156 3300005617 Ga0068859_100013616 Ga0068859_10001361611 140
157 3300005719 Ga0068861_100078670 Ga0068861_1000786702 140
158 3300005842 Ga0068858_100385750 Ga0068858_1003857501 140
159 3300006931 Ga0097620_100013616 Ga0097620_1000136165 140
160 3300009148 Ga0105243_10059127 Ga0105243_100591273 140
161 3300009177 Ga0105248_10372328 Ga0105248_103723282 140
162 3300010375 Ga0105239_11502729 Ga0105239_115027292 140
163 3300013306 Ga0163162_12966540 Ga0163162_129665402 140
164 3300014326 Ga0157380_10121583 Ga0157380_101215832 140
165 3300014969 Ga0157376_11925619 Ga0157376_119256192 140
166 3300025986 Ga0207658_11394288 Ga0207658_113942882 140
167 3300026035 Ga0207703_10036054 Ga0207703_100360543 140
168 3300026118 Ga0207675_100228782 Ga0207675_1002287822 140
169 3300028381 Ga0268264_10752494 Ga0268264_107524942 140
170 3300032002 Ga0307416_101473391 Ga0307416_1014733912 140
171 3300037068 Ga0373925_0990476 Ga0373925_0990476_122_544 140
172 3300039450 Ga0436363_0215343 Ga0436363_0215343_1222_1647 140
173 3300005440 Ga0070705_100000798 Ga0070705_10000079811 141
174 3300005444 Ga0070694_100024699 Ga0070694_1000246994 141
175 3300005467 Ga0070706_100185461 Ga0070706_1001854613 141
176 3300005518 Ga0070699_100017291 Ga0070699_1000172912 141
177 3300005536 Ga0070697_100003801 Ga0070697_10000380114 141
178 3300005545 Ga0070695_100000996 Ga0070695_1000009964 141
179 3300005546 Ga0070696_100001647 Ga0070696_10000164711 141
180 3300006914 Ga0075436_100214328 Ga0075436_1002143283 141
181 3300007076 Ga0075435_101439930 Ga0075435_1014399301 141
182 3300044656 Ga0466969_0154688 Ga0466969_0154688_355_780 141
183 3300044765 Ga0466970_0942895 Ga0466970_0942895_36_461 141
184 3300044842 Ga0466957_0221365 Ga0466957_0221365_129_554 141
185 3300045049 Ga0466959_0468038 Ga0466959_0468038_222_647 141
186 3300046692 Ga0495671_0226406 Ga0495671_0226406_195_620 141
187 3300053134 Ga0500658_0429254 Ga0500658_0429254_157_582 141
188 3300005327 Ga0070658_11062735 Ga0070658_110627351 142
189 3300005329 Ga0070683_100457522 Ga0070683_1004575222 142
190 3300005330 Ga0070690_101295100 Ga0070690_1012951001 142
191 3300005335 Ga0070666_10021535 Ga0070666_100215356 142
192 3300005338 Ga0068868_100328802 Ga0068868_1003288023 142
193 3300005340 Ga0070689_100541819 Ga0070689_1005418191 142
194 3300005343 Ga0070687_100041467 Ga0070687_1000414674 142
195 3300005367 Ga0070667_100647049 Ga0070667_1006470491 142
196 3300005457 Ga0070662_100035414 Ga0070662_1000354144 142
197 3300005459 Ga0068867_100294809 Ga0068867_1002948092 142
198 3300005518 Ga0070699_100551439 Ga0070699_1005514392 142
199 3300005564 Ga0070664_100311043 Ga0070664_1003110433 142
200 3300005616 Ga0068852_100670123 Ga0068852_1006701232 142
201 3300005719 Ga0068861_100105457 Ga0068861_1001054572 142
202 3300005843 Ga0068860_100007576 Ga0068860_1000075768 142
203 3300006237 Ga0097621_100749676 Ga0097621_1007496762 142
204 3300006844 Ga0075428_100006720 Ga0075428_1000067208 142
205 3300006880 Ga0075429_100186650 Ga0075429_1001866503 142
206 3300009094 Ga0111539_10001080 Ga0111539_100010809 142
207 3300009094 Ga0111539_11001580 Ga0111539_110015802 142
208 3300025228 Ga0209672_100826 Ga0209672_1008265 142
209 3300025903 Ga0207680_10013389 Ga0207680_100133895 142
210 3300025918 Ga0207662_10100923 Ga0207662_101009232 142
211 3300025944 Ga0207661_10978816 Ga0207661_109788161 142
212 3300026088 Ga0207641_10674314 Ga0207641_106743142 142
213 3300026089 Ga0207648_10034730 Ga0207648_100347306 142
214 3300026089 Ga0207648_10397061 Ga0207648_103970612 142
215 3300026118 Ga0207675_100196546 Ga0207675_1001965462 142
216 3300026121 Ga0207683_10512951 Ga0207683_105129512 142
217 3300027907 Ga0207428_10008673 Ga0207428_100086739 142
218 3300028379 Ga0268266_10493291 Ga0268266_104932912 142
219 3300028381 Ga0268264_10013866 Ga0268264_100138664 142
220 3300031238 Ga0265332_10026980 Ga0265332_100269803 142
221 3300035085 Ga0373929_0112956 Ga0373929_0112956_12_440 142
222 3300035092 Ga0373952_0039646 Ga0373952_0039646_557_985 142
223 3300035241 Ga0373961_0011535 Ga0373961_0011535_77_505 142
224 3300046539 Ga0495621_0072254 Ga0495621_0072254_498_926 142
225 3300050508 nmdc:mga09592_177764_c1 nmdc:mga09592_177764_c1_64_492 142
226 3300050511 nmdc:mga08y16_7124_c1 nmdc:mga08y16_7124_c1_10601_11029 142
227 2162886006 SwRhRL3b_contig_419017 SwRhRL3b_0964.00002170 143
228 3300001979 JGI24740J21852_10005671 JGI24740J21852_100056712 143
229 3300001989 JGI24739J22299_10000597 JGI24739J22299_100005975 143
230 3300001990 JGI24737J22298_10029261 JGI24737J22298_100292612 143
231 3300003215 JGI25153J46596_10008274 JGI25153J46596_100082743 143
232 3300003316 rootH1_10048821 rootH1_100488213 143
233 3300003578 Ga0006562J51391_1070621 Ga0006562J51391_10706213 143
234 3300003578 Ga0006562J51391_1070622 Ga0006562J51391_10706225 143
235 3300005295 Ga0065707_10358043 Ga0065707_103580432 143
236 3300005329 Ga0070683_100102277 Ga0070683_1001022773 143
237 3300005331 Ga0070670_100521232 Ga0070670_1005212321 143
238 3300005338 Ga0068868_101179819 Ga0068868_1011798191 143
239 3300005339 Ga0070660_100304010 Ga0070660_1003040103 143
240 3300005339 Ga0070660_100374102 Ga0070660_1003741023 143
241 3300005354 Ga0070675_100269175 Ga0070675_1002691752 143
242 3300005366 Ga0070659_100644658 Ga0070659_1006446581 143
243 3300005367 Ga0070667_100000235 Ga0070667_10000023522 143
244 3300005367 Ga0070667_100157653 Ga0070667_1001576534 143
245 3300005440 Ga0070705_100014059 Ga0070705_1000140591 143
246 3300005440 Ga0070705_100337496 Ga0070705_1003374962 143
247 3300005444 Ga0070694_100024350 Ga0070694_1000243501 143
248 3300005445 Ga0070708_100190741 Ga0070708_1001907411 143
249 3300005455 Ga0070663_100000583 Ga0070663_10000058313 143
250 3300005455 Ga0070663_100144843 Ga0070663_1001448432 143
251 3300005457 Ga0070662_100311405 Ga0070662_1003114053 143
252 3300005457 Ga0070662_100405337 Ga0070662_1004053372 143
253 3300005458 Ga0070681_10866082 Ga0070681_108660821 143
254 3300005466 Ga0070685_10779732 Ga0070685_107797321 143
255 3300005471 Ga0070698_100232641 Ga0070698_1002326411 143
256 3300005518 Ga0070699_100027592 Ga0070699_1000275925 143
257 3300005530 Ga0070679_100200759 Ga0070679_1002007591 143
258 3300005539 Ga0068853_100019259 Ga0068853_1000192598 143
259 3300005539 Ga0068853_100553884 Ga0068853_1005538841 143
260 3300005544 Ga0070686_100382495 Ga0070686_1003824951 143
261 3300005547 Ga0070693_100294903 Ga0070693_1002949032 143
262 3300005547 Ga0070693_101164254 Ga0070693_1011642541 143
263 3300005563 Ga0068855_100006624 Ga0068855_10000662410 143
264 3300005564 Ga0070664_100176270 Ga0070664_1001762702 143
265 3300005564 Ga0070664_100795998 Ga0070664_1007959981 143
266 3300005577 Ga0068857_100001024 Ga0068857_1000010242 143
267 3300005577 Ga0068857_100308976 Ga0068857_1003089762 143
268 3300005578 Ga0068854_100000287 Ga0068854_10000028721 143
269 3300005578 Ga0068854_100004984 Ga0068854_1000049847 143
270 3300005578 Ga0068854_100019471 Ga0068854_1000194714 143
271 3300005578 Ga0068854_100829509 Ga0068854_1008295092 143
272 3300005615 Ga0070702_100401168 Ga0070702_1004011681 143
273 3300005615 Ga0070702_100600561 Ga0070702_1006005611 143
274 3300005617 Ga0068859_100197554 Ga0068859_1001975543 143
275 3300005617 Ga0068859_101656672 Ga0068859_1016566722 143
276 3300005834 Ga0068851_10055845 Ga0068851_100558452 143
277 3300005842 Ga0068858_100016361 Ga0068858_1000163612 143
278 3300005842 Ga0068858_100068808 Ga0068858_1000688087 143
279 3300005842 Ga0068858_100138919 Ga0068858_1001389193 143
280 3300005842 Ga0068858_100714540 Ga0068858_1007145402 143
281 3300005843 Ga0068860_100048100 Ga0068860_1000481002 143
282 3300006358 Ga0068871_100055789 Ga0068871_1000557893 143
283 3300006852 Ga0075433_10135790 Ga0075433_101357901 143
284 3300006871 Ga0075434_100812264 Ga0075434_1008122642 143
285 3300006931 Ga0097620_100197564 Ga0097620_1001975641 143
286 3300006931 Ga0097620_101656745 Ga0097620_1016567452 143
287 3300007265 Ga0099794_10122322 Ga0099794_101223222 143
288 3300007265 Ga0099794_10184855 Ga0099794_101848551 143
289 3300009093 Ga0105240_10003821 Ga0105240_1000382111 143
290 3300009093 Ga0105240_10009271 Ga0105240_100092719 143
291 3300009093 Ga0105240_10019850 Ga0105240_100198506 143
292 3300009093 Ga0105240_10139652 Ga0105240_101396522 143
293 3300009093 Ga0105240_10515063 Ga0105240_105150632 143
294 3300009093 Ga0105240_10628164 Ga0105240_106281641 143
295 3300009098 Ga0105245_11459392 Ga0105245_114593922 143
296 3300009177 Ga0105248_10000167 Ga0105248_1000016731 143
297 3300009177 Ga0105248_11352055 Ga0105248_113520551 143
298 3300009545 Ga0105237_10000095 Ga0105237_1000009554 143
299 3300009545 Ga0105237_10002091 Ga0105237_100020917 143
300 3300009545 Ga0105237_11065513 Ga0105237_110655131 143
301 3300009551 Ga0105238_10245616 Ga0105238_102456163 143
302 3300009553 Ga0105249_10000271 Ga0105249_1000027131 143
303 3300009553 Ga0105249_10228087 Ga0105249_102280872 143
304 3300010375 Ga0105239_10052491 Ga0105239_100524912 143
305 3300010375 Ga0105239_10324924 Ga0105239_103249243 143
306 3300010375 Ga0105239_10634656 Ga0105239_106346561 143
307 3300012500 Ga0157314_1000065 Ga0157314_10000652 143
308 3300013100 Ga0157373_10299527 Ga0157373_102995272 143
309 3300013105 Ga0157369_10250374 Ga0157369_102503742 143
310 3300013105 Ga0157369_10443156 Ga0157369_104431562 143
311 3300013297 Ga0157378_10097505 Ga0157378_100975053 143
312 3300013297 Ga0157378_12074984 Ga0157378_120749841 143
313 3300013308 Ga0157375_10502638 Ga0157375_105026382 143
314 3300014969 Ga0157376_10032855 Ga0157376_100328552 143
315 3300025258 Ga0209129_1002332 Ga0209129_10023322 143
316 3300025297 Ga0209758_1000417 Ga0209758_100041722 143
317 3300025321 Ga0207656_10002105 Ga0207656_100021053 143
318 3300025885 Ga0207653_10429876 Ga0207653_104298761 143
319 3300025903 Ga0207680_10913425 Ga0207680_109134251 143
320 3300025904 Ga0207647_10016127 Ga0207647_100161272 143
321 3300025912 Ga0207707_10024269 Ga0207707_100242693 143
322 3300025913 Ga0207695_10001371 Ga0207695_100013715 143
323 3300025913 Ga0207695_10010635 Ga0207695_100106354 143
324 3300025913 Ga0207695_10170504 Ga0207695_101705043 143
325 3300025913 Ga0207695_10344067 Ga0207695_103440672 143
326 3300025913 Ga0207695_10448458 Ga0207695_104484582 143
327 3300025913 Ga0207695_10520430 Ga0207695_105204302 143
328 3300025914 Ga0207671_10000026 Ga0207671_1000002667 143
329 3300025914 Ga0207671_10008618 Ga0207671_100086185 143
330 3300025914 Ga0207671_10271692 Ga0207671_102716923 143
331 3300025915 Ga0207693_10010091 Ga0207693_100100916 143
332 3300025917 Ga0207660_10303650 Ga0207660_103036501 143
333 3300025919 Ga0207657_10027904 Ga0207657_100279044 143
334 3300025919 Ga0207657_10210929 Ga0207657_102109294 143
335 3300025920 Ga0207649_10558642 Ga0207649_105586422 143
336 3300025924 Ga0207694_10114976 Ga0207694_101149763 143
337 3300025929 Ga0207664_10361608 Ga0207664_103616083 143
338 3300025933 Ga0207706_10047063 Ga0207706_100470634 143
339 3300025933 Ga0207706_10466849 Ga0207706_104668491 143
340 3300025939 Ga0207665_10017232 Ga0207665_100172327 143
341 3300025940 Ga0207691_10245936 Ga0207691_102459363 143
342 3300025941 Ga0207711_10000538 Ga0207711_1000053811 143
343 3300025944 Ga0207661_10100378 Ga0207661_101003783 143
344 3300025945 Ga0207679_10227376 Ga0207679_102273763 143
345 3300025949 Ga0207667_10000432 Ga0207667_1000043226 143
346 3300025949 Ga0207667_10001233 Ga0207667_1000123326 143
347 3300025960 Ga0207651_10476832 Ga0207651_104768322 143
348 3300025961 Ga0207712_10000301 Ga0207712_1000030123 143
349 3300025981 Ga0207640_10000025 Ga0207640_10000025117 143
350 3300025981 Ga0207640_10000208 Ga0207640_1000020816 143
351 3300025986 Ga0207658_10000056 Ga0207658_100000564 143
352 3300025986 Ga0207658_10368431 Ga0207658_103684313 143
353 3300026023 Ga0207677_10194345 Ga0207677_101943452 143
354 3300026035 Ga0207703_10029736 Ga0207703_100297366 143
355 3300026035 Ga0207703_10255741 Ga0207703_102557412 143
356 3300026035 Ga0207703_10308858 Ga0207703_103088583 143
357 3300026035 Ga0207703_10683879 Ga0207703_106838791 143
358 3300026041 Ga0207639_10016763 Ga0207639_100167634 143
359 3300026067 Ga0207678_10000389 Ga0207678_1000038936 143
360 3300026067 Ga0207678_10073514 Ga0207678_100735141 143
361 3300026067 Ga0207678_10149186 Ga0207678_101491863 143
362 3300026067 Ga0207678_11165814 Ga0207678_111658141 143
363 3300026078 Ga0207702_10049557 Ga0207702_100495574 143
364 3300026078 Ga0207702_10841088 Ga0207702_108410881 143
365 3300026116 Ga0207674_10000695 Ga0207674_1000069524 143
366 3300026142 Ga0207698_11464147 Ga0207698_114641471 143
367 3300028381 Ga0268264_10036317 Ga0268264_100363173 143
368 3300033179 Ga0307507_10283216 Ga0307507_102832162 143
369 3300035113 Ga0373936_0013565 Ga0373936_0013565_2638_3069 143
370 3300035114 Ga0373939_0044601 Ga0373939_0044601_68_505 143
371 3300035117 Ga0373953_0101771 Ga0373953_0101771_270_701 143
372 3300035118 Ga0373954_0129632 Ga0373954_0129632_749_1180 143
373 3300035120 Ga0373957_0061179 Ga0373957_0061179_73_504 143
374 3300035121 Ga0373960_0039238 Ga0373960_0039238_470_919 143
375 3300035170 Ga0373943_0022072 Ga0373943_0022072_651_1082 143
376 3300035172 Ga0373955_0020045 Ga0373955_0020045_185_616 143
377 3300035207 Ga0373942_0009125 Ga0373942_0009125_940_1383 143
378 3300035410 Ga0373924_0007500 Ga0373924_0007500_1170_1601 143
379 3300035691 Ga0373931_0088881 Ga0373931_0088881_1092_1529 143
380 3300035692 Ga0373935_1196413 Ga0373935_1196413_108_539 143
381 3300035724 Ga0373933_0016236 Ga0373933_0016236_3703_4134 143
382 3300035724 Ga0373933_0608754 Ga0373933_0608754_83_514 143
383 3300036401 Ga0373937_0072137 Ga0373937_0072137_591_1022 143
384 3300037471 Ga0395905_0001200 Ga0395905_0001200_17073_17504 143
385 3300041459 Ga0451800_0579666 Ga0451800_0579666_261_707 143
386 3300044656 Ga0466969_0030676 Ga0466969_0030676_86_517 143
387 3300044658 Ga0466972_0010969 Ga0466972_0010969_1749_2180 143
388 3300044672 Ga0466982_0000015 Ga0466982_0000015_61532_61963 143
389 3300044706 Ga0466964_0002674 Ga0466964_0002674_3662_4093 143
390 3300044719 Ga0466971_0006084 Ga0466971_0006084_2342_2773 143
391 3300044735 Ga0466968_0003252 Ga0466968_0003252_2748_3179 143
392 3300044765 Ga0466970_0172606 Ga0466970_0172606_676_1107 143
393 3300044842 Ga0466957_0056144 Ga0466957_0056144_224_655 143
394 3300044901 Ga0466960_0048892 Ga0466960_0048892_676_1107 143
395 3300045051 Ga0451576_0347992 Ga0451576_0347992_1078_1509 143
396 3300045836 Ga0466958_0093619 Ga0466958_0093619_267_698 143
397 3300046461 Ga0495641_0106170 Ga0495641_0106170_637_1116 143
398 3300046472 Ga0495580_0074360 Ga0495580_0074360_1093_1524 143
399 3300046499 Ga0495594_0009332 Ga0495594_0009332_4522_4953 143
400 3300046511 Ga0495608_0187105 Ga0495608_0187105_157_588 143
401 3300046514 Ga0495618_0624424 Ga0495618_0624424_73_504 143
402 3300046517 Ga0495630_0624608 Ga0495630_0624608_238_669 143
403 3300046536 Ga0495587_0461325 Ga0495587_0461325_133_564 143
404 3300046557 Ga0495622_0082711 Ga0495622_0082711_718_1197 143
405 3300046559 Ga0495667_0108506 Ga0495667_0108506_185_616 143
406 3300046690 Ga0495624_0126061 Ga0495624_0126061_86_517 143
407 3300047317 Ga0495604_0125088 Ga0495604_0125088_1399_1830 143
408 3300047322 Ga0495680_0019856 Ga0495680_0019856_5064_5495 143
409 3300047472 Ga0495686_0004347 Ga0495686_0004347_7757_8230 143
410 3300047673 Ga0495593_0205694 Ga0495593_0205694_102_533 143
411 3300048905 Ga0496102_0119776 Ga0496102_0119776_1175_1606 143
412 3300048911 Ga0496108_1090921 Ga0496108_1090921_197_631 143
413 3300048915 Ga0496112_0157878 Ga0496112_0157878_1547_1978 143
414 3300048921 Ga0496118_0235633 Ga0496118_0235633_257_730 143
415 3300048924 Ga0496121_0029393 Ga0496121_0029393_1345_1776 143
416 3300048924 Ga0496121_0055497 Ga0496121_0055497_2160_2633 143
417 3300048925 Ga0496122_0005693 Ga0496122_0005693_9796_10269 143
418 3300048926 Ga0496123_0004026 Ga0496123_0004026_5675_6148 143
419 3300048928 Ga0496125_0000643 Ga0496125_0000643_11716_12147 143
420 3300048929 Ga0496126_0313393 Ga0496126_0313393_433_906 143
421 3300050496 nmdc:mga07m45_119095_c1 nmdc:mga07m45_119095_c1_858_1289 143
422 3300050512 nmdc:mga0n895_798372_c1 nmdc:mga0n895_798372_c1_42_473 143
423 3300050514 nmdc:mga08x19_219982_c2 nmdc:mga08x19_219982_c2_19_450 143
424 3300053080 Ga0500635_0111634 Ga0500635_0111634_87_521 143
425 3300053084 Ga0495595_0175930 Ga0495595_0175930_116_547 143
426 3300053094 Ga0500566_0223875 Ga0500566_0223875_455_889 143
427 3300053120 Ga0500597_000432 Ga0500597_000432_1712_2185 143
428 3300053120 Ga0500597_158327 Ga0500597_158327_48_485 143
429 3300053123 Ga0500614_085401 Ga0500614_085401_89_523 143
430 3300053177 Ga0500636_0229528 Ga0500636_0229528_44_481 143
431 3300053178 Ga0500637_0294121 Ga0500637_0294121_386_820 143
432 3300061719 Ga0466962_0005764 Ga0466962_0005764_3084_3515 143

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7703 4 114
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.7683 58 99
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7581 4 114
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.7124 60 103
5jcf-assembly2.cif.gz_B crystal structure of chicken mda5 with 5'p 10-mer dsrna and adp-mg2+ at 2.6 a resolution (orthorhombic form). 0.552 59 107
ID Description Score Start End Superfamily
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8122 4 105 2.170.150.70
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7891 5 119 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.784 4 105 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7635 4 116 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7517 4 116 2.170.150.70
ID Description Score Start End GO Terms
AF-F8C8H7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9917 1 140 GO:0016846
GO:0046872
AF-A0A329VZ18-F1-model_v4 CENP-V/GFA domain-containing protein 0.9898 16 139 GO:0016846
GO:0046872
AF-A0A534AD10-F1-model_v4 CENP-V/GFA domain-containing protein 0.9866 1 111 GO:0016846
GO:0046872
AF-A0A522JPP6-F1-model_v4 CENP-V/GFA domain-containing protein 0.9855 1 142 GO:0016846
GO:0046872
AF-A0A2E5PMV7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9846 1 133 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map