F442672

General Info

Members Datasets Scaffolds Average Seq Length
432 278 383 259

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001949|Ga0495580_0001949_5705_6589
Length 294
Sequence MNTPRENPNEQVTRIDTETTMVTTHNFNDHVRIEANEDIGVATIVLERPARRNAVDRPVAQALSAAFARFEAEPAWRAAVLFGAGGTFCAGADLTALADDTRRNELHADGRGPGPMGPTRTSFSKPVVAAIAGYAVAGGLELAAMCDLRVVEDDAVLGVFCRRVGIPLIDGGTIRLPRLIGLSRALDLILTGRAVSAQEALSFGLANRVVAKGTARAAAEQMXXXLAALPQAALLADRRSVLENSMLDDFAEALRREGAGGYQAVFEEGVAGAARFAGGAGRHGNIFDTGDGPR

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
6 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
7 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
8 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
9 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
10 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
11 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
12 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
13 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
14 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
15 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
16 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
17 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
18 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
19 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
20 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
21 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
22 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
23 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
24 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
25 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
26 2818991450 Burkholderia sp. 604 Isolate Unclassified
27 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
28 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
29 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
30 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
31 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
32 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
33 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
34 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
35 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
36 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
37 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
38 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
39 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
40 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
41 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
42 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
43 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
44 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
45 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
48 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
49 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
55 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
124 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
125 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
167 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
202 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
269 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
270 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
275 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
276 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
277 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
278 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.96
Metatranscriptomes 0.69
Isolates 11.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.95
Nodule 3.47
Rhizoplane 1.85
Rhizosphere 72.69
Stem 0
Stem Tuber 0
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003835 3300001979 Bacteria 6533
2 JGI24739J22299_10001082 3300001989 Bacteria 10140
3 JGI24735J21928_10000627 3300002067 Bacteria 12433
4 JGI24751J29686_10009316 3300002459 Bacteria 2016
5 JGI25156J39149_1000679 3300002705 Bacteria 18341
6 JGI25165J46597_1001511 3300003214 Bacteria 11803
7 rootH2_10152216 3300003320 Bacteria 7206
8 rootH1_10165822 3300003323 Bacteria 5403
9 Ga0055533_1000126 3300003756 Bacteria 86699
10 Ga0055533_1001859 3300003756 Bacteria 5275
11 Ga0055532_1000001 3300003758 Bacteria 1119836
12 Ga0055527_1000014 3300003760 Bacteria 289449
13 Ga0055535_1000001 3300003761 Bacteria 1119836
14 Ga0055542_1000001 3300003762 Bacteria 1119836
15 Ga0055529_1000001 3300003763 Bacteria 826680
16 Ga0055540_1003011 3300003792 Bacteria 8424
17 Ga0055540_1004341 3300003792 Bacteria 6444
18 Ga0070658_10000229 3300005327 Bacteria 49646
19 Ga0070690_100001483 3300005330 Bacteria 12280
20 Ga0068868_100293191 3300005338 Bacteria 1380
21 Ga0070660_100016738 3300005339 Bacteria 5330
22 Ga0070668_100116408 3300005347 Bacteria 2132
23 Ga0070667_100041661 3300005367 Bacteria 3852
24 Ga0070713_100050945 3300005436 Bacteria 3423
25 Ga0070663_100064192 3300005455 Bacteria 2654
26 Ga0070663_100207844 3300005455 Bacteria 1531
27 Ga0068867_100000050 3300005459 Bacteria 71814
28 Ga0070686_100038451 3300005544 Bacteria 2974
29 Ga0068855_100059966 3300005563 Bacteria 4451
30 Ga0068857_100398050 3300005577 Bacteria 1281
31 Ga0068863_100004059 3300005841 Bacteria 14456
32 Ga0075365_10021595 3300006038 Bacteria 4018
33 Ga0075365_10042837 3300006038 Bacteria 2961
34 Ga0075365_10227536 3300006038 Bacteria 1309
35 Ga0075365_10231650 3300006038 Bacteria 1297
36 Ga0075365_10498226 3300006038 Bacteria 861
37 Ga0075368_10052787 3300006042 Bacteria 1618
38 Ga0075363_100285180 3300006048 Bacteria 956
39 Ga0075364_10008451 3300006051 Bacteria 6154
40 Ga0075369_10032367 3300006186 Bacteria 2212
41 Ga0075370_10106235 3300006353 Bacteria 1628
42 Ga0075430_100084074 3300006846 Bacteria 2666
43 Ga0099794_10010286 3300007265 Bacteria 3966
44 Ga0105251_10000947 3300009011 Bacteria 25899
45 Ga0111539_10016373 3300009094 Bacteria 9194
46 Ga0105243_10007492 3300009148 Bacteria 8385
47 Ga0105248_10112236 3300009177 Bacteria 3074
48 Ga0105237_10006598 3300009545 Bacteria 12830
49 Ga0105238_10653705 3300009551 Bacteria 1061
50 Ga0105249_10156762 3300009553 Bacteria 2196
51 Ga0157371_10052558 3300013102 Bacteria 2894
52 Ga0157369_10000200 3300013105 Bacteria 83239
53 Ga0157369_10004045 3300013105 Bacteria 17377
54 Ga0157377_10000037 3300014745 Bacteria 115076
55 Ga0157377_10469832 3300014745 Bacteria 872
56 Ga0157379_10148457 3300014968 Bacteria 2114
57 Ga0157376_10038208 3300014969 Bacteria 3904
58 Ga0157376_10231782 3300014969 Bacteria 1716
59 Ga0182007_10000155 3300015262 Bacteria 46603
60 Ga0213876_10000907 3300021384 Bacteria 19723
61 Ga0209674_100005 3300025226 Bacteria 1708125
62 Ga0209674_100092 3300025226 Bacteria 172272
63 Ga0209672_100001 3300025228 Bacteria 2828210
64 Ga0209147_100001 3300025229 Bacteria 2384371
65 Ga0209563_103707 3300025230 Bacteria 3094
66 Ga0207427_102459 3300025231 Bacteria 4973
67 Ga0209258_100001 3300025242 Bacteria 2384269
68 Ga0209646_1014181 3300025246 Bacteria 1202
69 Ga0209148_1000003 3300025254 Bacteria 2384288
70 Ga0209759_1000053 3300025256 Bacteria 212789
71 Ga0209759_1000120 3300025256 Bacteria 138967
72 Ga0209759_1000172 3300025256 Bacteria 107949
73 Ga0209233_1000016 3300025261 Bacteria 907830
74 Ga0209455_1000001 3300025272 Bacteria 2384278
75 Ga0209673_1025038 3300025273 Bacteria 1992
76 Ga0209051_1003001 3300025303 Bacteria 11451
77 Ga0207713_1000841 3300025735 Bacteria 28231
78 Ga0207647_10030484 3300025904 Bacteria 3478
79 Ga0207647_10142085 3300025904 Bacteria 1407
80 Ga0207695_10344321 3300025913 Bacteria 1378
81 Ga0207657_10077245 3300025919 Bacteria 2807
82 Ga0207700_10039703 3300025928 Bacteria 3429
83 Ga0207709_10006164 3300025935 Bacteria 6751
84 Ga0207711_10055345 3300025941 Bacteria 3406
85 Ga0207658_10096609 3300025986 Bacteria 2304
86 Ga0207677_10243397 3300026023 Bacteria 1457
87 Ga0207678_10084784 3300026067 Bacteria 2709
88 Ga0207641_10017289 3300026088 Bacteria 5903
89 Ga0207648_10000056 3300026089 Bacteria 105754
90 Ga0207674_10250949 3300026116 Bacteria 1716
91 Ga0207675_100214833 3300026118 Bacteria 1851
92 Ga0207698_10219624 3300026142 Bacteria 1716
93 Ga0265354_1002387 3300028016 Bacteria 2339
94 Ga0265356_1002577 3300028017 Bacteria 2389
95 Ga0265357_1010645 3300028023 Bacteria 928
96 Ga0265338_10208043 3300028800 Bacteria 1471
97 Ga0307511_10140213 3300030521 Bacteria 1423
98 Ga0265770_1000025 3300030878 Bacteria 15155
99 Ga0265765_1000124 3300030879 Bacteria 4542
100 Ga0265760_10002670 3300031090 Bacteria 5218
101 Ga0307408_100001575 3300031548 Bacteria 16847
102 Ga0265314_10054311 3300031711 Bacteria 2773
103 Ga0307405_10018763 3300031731 Bacteria 3824
104 Ga0307405_10207365 3300031731 Bacteria 1428
105 Ga0307407_10297687 3300031903 Bacteria 1124
106 Ga0307412_10000051 3300031911 Bacteria 150433
107 Ga0307412_10012980 3300031911 Bacteria 4870
108 Ga0373926_0022558 3300035083 Bacteria 2183
109 Ga0373953_0028630 3300035117 Bacteria 2150
110 Ga0373924_0000207 3300035410 Bacteria 17868
111 Ga0373937_0070064 3300036401 Bacteria 3234
112 Ga0373925_0013643 3300037068 Bacteria 5883
113 Ga0395899_0000008 3300037312 Bacteria 567572
114 Ga0395899_0039333 3300037312 Bacteria 3540
115 Ga0395900_0002437 3300037418 Bacteria 20493
116 Ga0395900_0018724 3300037418 Bacteria 7062
117 Ga0395898_0000386 3300037466 Bacteria 96561
118 Ga0395898_0540511 3300037466 Bacteria 1107
119 Ga0436364_1026830 3300037853 Bacteria 1182
120 Ga0436364_1245740 3300037853 Bacteria 6410
121 Ga0436364_1481726 3300037853 Bacteria 1145
122 Ga0395901_0084836 3300038443 Bacteria 3310
123 Ga0436365_0286650 3300039437 Bacteria 14391
124 Ga0436365_1902253 3300039437 Bacteria 723
125 Ga0436361_0632299 3300039447 Bacteria 968
126 Ga0436363_0420194 3300039450 Bacteria 3741
127 Ga0451807_0068990 3300041486 Bacteria 977
128 Ga0466969_0085270 3300044656 Bacteria 1502
129 Ga0466965_0013631 3300044683 Bacteria 3838
130 Ga0466966_0000608 3300044684 Bacteria 22701
131 Ga0466966_0067987 3300044684 Bacteria 2237
132 Ga0466961_0010990 3300044693 Bacteria 5784
133 Ga0466961_0316168 3300044693 Bacteria 953
134 Ga0466963_0000868 3300044694 Bacteria 15303
135 Ga0466963_0074406 3300044694 Bacteria 2291
136 Ga0466964_0009629 3300044706 Bacteria 3639
137 Ga0466971_0030745 3300044719 Bacteria 2403
138 Ga0466971_0038904 3300044719 Bacteria 2135
139 Ga0466970_0010230 3300044765 Bacteria 4756
140 Ga0466970_0048850 3300044765 Bacteria 2256
141 Ga0466957_0007276 3300044842 Bacteria 6255
142 Ga0466957_0008968 3300044842 Bacteria 5702
143 Ga0466957_0013981 3300044842 Bacteria 4668
144 Ga0466957_0014339 3300044842 Bacteria 4613
145 Ga0466960_0001271 3300044901 Bacteria 9134
146 Ga0466959_0012698 3300045049 Bacteria 6092
147 Ga0466958_0029341 3300045836 Bacteria 3264
148 Ga0466958_0084714 3300045836 Bacteria 1955
149 Ga0466967_0037408 3300045976 Bacteria 4153
150 Ga0495617_016520 3300046452 Bacteria 2496
151 Ga0495592_0063382 3300046454 Bacteria 2712
152 Ga0495603_0001398 3300046455 Bacteria 14042
153 Ga0495603_0016032 3300046455 Bacteria 4530
154 Ga0495603_0186495 3300046455 Bacteria 1200
155 Ga0495590_0003975 3300046457 Bacteria 6003
156 Ga0495590_0015693 3300046457 Bacteria 2744
157 Ga0495590_0088597 3300046457 Bacteria 1094
158 Ga0495591_002815 3300046458 Bacteria 9371
159 Ga0495629_0000015 3300046459 Bacteria 182026
160 Ga0495629_0019879 3300046459 Bacteria 4792
161 Ga0495629_0144152 3300046459 Bacteria 1657
162 Ga0495638_0009011 3300046460 Bacteria 7035
163 Ga0495638_0009097 3300046460 Bacteria 6993
164 Ga0495641_0048669 3300046461 Bacteria 1943
165 Ga0495651_0010517 3300046462 Bacteria 7110
166 Ga0495653_0009072 3300046463 Bacteria 8134
167 Ga0495653_0014131 3300046463 Bacteria 6509
168 Ga0495653_0020871 3300046463 Bacteria 5307
169 Ga0495653_0091069 3300046463 Bacteria 2229
170 Ga0495650_0008701 3300046471 Bacteria 5878
171 Ga0495650_0035295 3300046471 Bacteria 2202
172 Ga0495650_0078735 3300046471 Bacteria 1275
173 Ga0495580_0000313 3300046472 Bacteria 39653
174 Ga0495580_0001949 3300046472 Bacteria 18119
175 Ga0495580_0006838 3300046472 Bacteria 9236
176 Ga0495580_0010793 3300046472 Bacteria 7094
177 Ga0495582_0000334 3300046473 Bacteria 25733
178 Ga0495582_0288280 3300046473 Bacteria 943
179 Ga0495605_0002255 3300046474 Bacteria 12051
180 Ga0495639_0198085 3300046475 Bacteria 982
181 Ga0495662_0006748 3300046476 Bacteria 5717
182 Ga0495662_0071904 3300046476 Bacteria 1676
183 Ga0495664_0000651 3300046477 Bacteria 17673
184 Ga0495664_0145419 3300046477 Bacteria 1437
185 Ga0495585_0038804 3300046492 Bacteria 2679
186 Ga0495594_0060879 3300046499 Bacteria 2088
187 Ga0495596_0002420 3300046500 Bacteria 10069
188 Ga0495596_0055816 3300046500 Bacteria 1543
189 Ga0495607_0026838 3300046501 Bacteria 3569
190 Ga0495583_0000062 3300046506 Bacteria 195151
191 Ga0495583_0002886 3300046506 Bacteria 13913
192 Ga0495583_0062992 3300046506 Bacteria 1649
193 Ga0495606_0001633 3300046507 Bacteria 29221
194 Ga0495606_0020287 3300046507 Bacteria 4906
195 Ga0495606_0027241 3300046507 Bacteria 4057
196 Ga0495606_0031205 3300046507 Bacteria 3708
197 Ga0495606_0073732 3300046507 Bacteria 2140
198 Ga0495608_0006704 3300046511 Bacteria 8164
199 Ga0495608_0025582 3300046511 Bacteria 4029
200 Ga0495616_0018374 3300046513 Bacteria 3839
201 Ga0495618_0004611 3300046514 Bacteria 8441
202 Ga0495618_0011193 3300046514 Bacteria 5437
203 Ga0495618_0026653 3300046514 Bacteria 3596
204 Ga0495618_0097975 3300046514 Bacteria 1876
205 Ga0495620_0015146 3300046515 Bacteria 3900
206 Ga0495620_0032598 3300046515 Bacteria 2371
207 Ga0495628_0012140 3300046516 Bacteria 7261
208 Ga0495628_0042453 3300046516 Bacteria 3627
209 Ga0495628_0056411 3300046516 Bacteria 3091
210 Ga0495628_0320119 3300046516 Bacteria 1144
211 Ga0495630_0018177 3300046517 Bacteria 5162
212 Ga0495630_0063229 3300046517 Bacteria 2780
213 Ga0495630_0084362 3300046517 Bacteria 2398
214 Ga0495630_0234394 3300046517 Bacteria 1402
215 Ga0495631_0004976 3300046518 Bacteria 7002
216 Ga0495648_0042812 3300046524 Bacteria 2845
217 Ga0495648_0176616 3300046524 Bacteria 1089
218 Ga0495666_0000814 3300046526 Bacteria 14439
219 Ga0495666_0001775 3300046526 Bacteria 10645
220 Ga0495666_0018687 3300046526 Bacteria 3444
221 Ga0495642_0024961 3300046528 Bacteria 2367
222 Ga0495642_0124934 3300046528 Bacteria 1105
223 Ga0495652_0068250 3300046529 Unclassified 2979
224 Ga0495652_0116668 3300046529 Bacteria 2137
225 Ga0495652_0459767 3300046529 Bacteria 889
226 Ga0495665_0014493 3300046531 Bacteria 4253
227 Ga0495665_0018688 3300046531 Bacteria 3723
228 Ga0495665_0150580 3300046531 Bacteria 1214
229 Ga0495640_0000462 3300046533 Bacteria 29633
230 Ga0495640_0017916 3300046533 Bacteria 5265
231 Ga0495640_0333289 3300046533 Bacteria 938
232 Ga0495586_0008858 3300046535 Bacteria 5360
233 Ga0495586_0076821 3300046535 Bacteria 1830
234 Ga0495587_0006065 3300046536 Bacteria 7885
235 Ga0495587_0053944 3300046536 Bacteria 2369
236 Ga0495609_0073456 3300046538 Bacteria 1500
237 Ga0495597_0116351 3300046542 Bacteria 1117
238 Ga0495645_0005691 3300046543 Bacteria 8584
239 Ga0495645_0095926 3300046543 Bacteria 2114
240 Ga0495622_0005077 3300046557 Bacteria 6100
241 Ga0495622_0067504 3300046557 Bacteria 1652
242 Ga0495667_0203762 3300046559 Bacteria 1266
243 Ga0495634_0030365 3300046642 Bacteria 3732
244 Ga0495634_0052600 3300046642 Bacteria 2729
245 Ga0495611_0047495 3300046648 Bacteria 1927
246 Ga0495625_0062665 3300046660 Bacteria 2628
247 Ga0495635_0057593 3300046663 Bacteria 2673
248 Ga0495661_0002228 3300046665 Bacteria 15062
249 Ga0495661_0019991 3300046665 Bacteria 4379
250 Ga0495661_0101900 3300046665 Bacteria 1614
251 Ga0495599_0026197 3300046678 Bacteria 3653
252 Ga0495599_0038069 3300046678 Bacteria 3021
253 Ga0495599_0038376 3300046678 Bacteria 3010
254 Ga0495623_0030904 3300046679 Bacteria 3445
255 Ga0495623_0059869 3300046679 Unclassified 2390
256 Ga0495623_0063769 3300046679 Bacteria 2306
257 Ga0495623_0141980 3300046679 Bacteria 1427
258 Ga0495646_0000252 3300046680 Bacteria 27008
259 Ga0495646_0002434 3300046680 Bacteria 11419
260 Ga0495646_0009527 3300046680 Bacteria 6165
261 Ga0495646_0118185 3300046680 Bacteria 1502
262 Ga0495613_0002811 3300046689 Bacteria 13063
263 Ga0495613_0015810 3300046689 Bacteria 5617
264 Ga0495613_0193047 3300046689 Bacteria 1439
265 Ga0495624_0000132 3300046690 Bacteria 52886
266 Ga0495624_0013207 3300046690 Bacteria 5630
267 Ga0495624_0054585 3300046690 Bacteria 2518
268 Ga0495649_0000247 3300046694 Bacteria 47906
269 Ga0495649_0035474 3300046694 Bacteria 2743
270 Ga0495649_0036050 3300046694 Bacteria 2719
271 Ga0495649_0229432 3300046694 Bacteria 958
272 Ga0495589_0002656 3300046794 Bacteria 9898
273 Ga0495589_0021725 3300046794 Bacteria 3278
274 Ga0495589_0058962 3300046794 Bacteria 1887
275 Ga0495589_0105047 3300046794 Bacteria 1365
276 Ga0495600_0001538 3300046809 Bacteria 12822
277 Ga0495581_0000198 3300047315 Bacteria 28030
278 Ga0495581_0006007 3300047315 Bacteria 7038
279 Ga0495581_0143772 3300047315 Bacteria 1392
280 Ga0495581_0147137 3300047315 Bacteria 1375
281 Ga0495604_0004386 3300047317 Bacteria 11169
282 Ga0495604_0005611 3300047317 Bacteria 9951
283 Ga0495604_0009505 3300047317 Bacteria 7684
284 Ga0495604_0018264 3300047317 Bacteria 5616
285 Ga0495604_0087473 3300047317 Bacteria 2321
286 Ga0495674_0006015 3300047319 Bacteria 11653
287 Ga0495674_0086126 3300047319 Bacteria 2690
288 Ga0495674_0386487 3300047319 Bacteria 1131
289 Ga0495672_0044542 3300047320 Bacteria 2662
290 Ga0495672_0062444 3300047320 Bacteria 2143
291 Ga0495676_0009226 3300047321 Bacteria 8989
292 Ga0495676_0143364 3300047321 Bacteria 1709
293 Ga0495676_0195232 3300047321 Bacteria 1409
294 Ga0495680_0005456 3300047322 Bacteria 11969
295 Ga0495680_0134793 3300047322 Bacteria 1811
296 Ga0495683_0003930 3300047323 Bacteria 8552
297 Ga0495683_0004268 3300047323 Bacteria 8147
298 Ga0495683_0082648 3300047323 Bacteria 1564
299 Ga0495683_0114662 3300047323 Bacteria 1283
300 Ga0495687_039103 3300047443 Bacteria 2101
301 Ga0495675_0001601 3300047444 Bacteria 13609
302 Ga0495675_0077753 3300047444 Bacteria 2090
303 Ga0495675_0093235 3300047444 Bacteria 1889
304 Ga0495675_0143233 3300047444 Bacteria 1480
305 Ga0495679_000045 3300047446 Bacteria 133780
306 Ga0495679_003527 3300047446 Bacteria 7480
307 Ga0495679_024876 3300047446 Bacteria 2010
308 Ga0495673_0009745 3300047469 Bacteria 5287
309 Ga0495673_0045004 3300047469 Bacteria 1964
310 Ga0495686_0145060 3300047472 Bacteria 1398
311 Ga0495593_0007050 3300047673 Bacteria 6591
312 Ga0495593_0009280 3300047673 Bacteria 5707
313 Ga0495593_0035725 3300047673 Bacteria 2696
314 Ga0495602_0012039 3300048088 Bacteria 8920
315 Ga0495602_0066980 3300048088 Bacteria 3091
316 Ga0495602_0086446 3300048088 Bacteria 2617
317 Ga0495602_0206758 3300048088 Bacteria 1493
318 Ga0495614_0050403 3300048089 Bacteria 1783
319 Ga0495614_0059321 3300048089 Bacteria 1643
320 Ga0495614_0106385 3300048089 Bacteria 1229
321 Ga0495626_0010620 3300048091 Bacteria 4899
322 Ga0495626_0056291 3300048091 Bacteria 1801
323 Ga0495626_0067680 3300048091 Bacteria 1612
324 Ga0496102_0569864 3300048905 Bacteria 1055
325 Ga0496106_0000067 3300048909 Bacteria 83475
326 Ga0496106_0002998 3300048909 Bacteria 12572
327 Ga0496109_0001251 3300048912 Bacteria 21083
328 Ga0496113_0134060 3300048916 Bacteria 1945
329 Ga0496113_0441745 3300048916 Bacteria 1045
330 Ga0496116_0024471 3300048919 Bacteria 4466
331 Ga0496117_0033575 3300048920 Bacteria 3878
332 Ga0496117_0045490 3300048920 Bacteria 3169
333 Ga0496117_0073371 3300048920 Bacteria 2283
334 Ga0496117_0086110 3300048920 Bacteria 2043
335 Ga0496118_0000248 3300048921 Bacteria 95533
336 Ga0496118_0027675 3300048921 Bacteria 4790
337 Ga0496118_0037767 3300048921 Bacteria 3881
338 Ga0496121_0004616 3300048924 Bacteria 18345
339 Ga0496121_0264279 3300048924 Bacteria 1186
340 Ga0496126_0002353 3300048929 Bacteria 25826
341 Ga0496126_0004564 3300048929 Bacteria 16450
342 Ga0495678_021427 3300049459 Bacteria 2846
343 Ga0495682_0009376 3300049460 Bacteria 3820
344 Ga0495682_0031820 3300049460 Bacteria 1949
345 Ga0501031_0144705 3300049568 Bacteria 1553
346 Ga0501032_0009163 3300049569 Bacteria 7182
347 Ga0501033_0038886 3300049570 Bacteria 3554
348 Ga0501034_0082780 3300049571 Bacteria 3211
349 Ga0501036_0195237 3300049572 Bacteria 1703
350 Ga0501037_0028490 3300049573 Bacteria 4126
351 Ga0501043_0077518 3300049579 Bacteria 2611
352 Ga0501043_0325942 3300049579 Bacteria 1170
353 Ga0501043_0417336 3300049579 Bacteria 1012
354 Ga0501047_0010399 3300049581 Bacteria 8805
355 Ga0501048_0118050 3300049582 Bacteria 1874
356 Ga0501067_0000265 3300049583 Bacteria 28603
357 Ga0501067_0010342 3300049583 Bacteria 5163
358 Ga0501068_0015957 3300049584 Bacteria 4326
359 Ga0501070_0055550 3300049586 Bacteria 3282
360 Ga0501072_0019307 3300049588 Bacteria 5267
361 Ga0501073_0000002 3300049589 Bacteria 323865
362 Ga0501073_0297533 3300049589 Bacteria 1113
363 Ga0501077_0000075 3300049593 Bacteria 49907
364 Ga0501080_0009453 3300049742 Bacteria 8892
365 Ga0501080_0347899 3300049742 Bacteria 1339
366 Ga0501035_0000662 3300049822 Bacteria 37968
367 Ga0501044_0004319 3300049823 Bacteria 15932
368 Ga0501044_0006193 3300049823 Bacteria 13223
369 nmdc:mga03683_14462_c1 3300050489 Bacteria 2921
370 nmdc:mga0yw44_203102_c1 3300050492 Bacteria 1309
371 nmdc:mga0yw44_23603_c1 3300050492 Bacteria 3468
372 nmdc:mga0yw44_286624_c1 3300050492 Bacteria 1101
373 nmdc:mga0yw44_360937_c1 3300050492 Bacteria 979
374 nmdc:mga0yw44_361542_c1 3300050492 Bacteria 978
375 nmdc:mga0qj67_324629_c1 3300050509 Bacteria 1246
376 nmdc:mga08y16_65690_c1 3300050511 Bacteria 3787
377 nmdc:mga0sz30_41255_c1 3300050516 Bacteria 1940
378 Ga0500635_0003685 3300053080 Bacteria 3874
379 Ga0500562_000901 3300053108 Bacteria 7209
380 Ga0500562_003558 3300053108 Bacteria 3907
381 Ga0500616_0002192 3300053153 Bacteria 16815
382 Ga0501082_0286174 3300060353 Bacteria 1435
383 Ga0466962_0023410 3300061719 Bacteria 2969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046665 Ga0495661_0019991 Ga0495661_0019991_3740_4363 197
2 3300046794 Ga0495589_0021725 Ga0495589_0021725_2639_3262 197
3 3300039437 Ga0436365_1902253 Ga0436365_1902253_79_705 198
4 3300021384 Ga0213876_10000907 Ga0213876_100009076 207
5 3300037853 Ga0436364_1481726 Ga0436364_1481726_326_1114 207
6 3300014745 Ga0157377_10469832 Ga0157377_104698321 216
7 3300037466 Ga0395898_0540511 Ga0395898_0540511_39_719 218
8 3300046533 Ga0495640_0333289 Ga0495640_0333289_229_915 219
9 3300046528 Ga0495642_0124934 Ga0495642_0124934_350_1060 222
10 3300046694 Ga0495649_0229432 Ga0495649_0229432_227_937 222
11 3300050492 nmdc:mga0yw44_361542_c1 nmdc:mga0yw44_361542_c1_264_968 225
12 3300039450 Ga0436363_0420194 Ga0436363_0420194_1056_1883 227
13 3300037853 Ga0436364_1026830 Ga0436364_1026830_386_1138 228
14 3300049583 Ga0501067_0010342 Ga0501067_0010342_2902_3672 228
15 3300014968 Ga0157379_10148457 Ga0157379_101484572 229
16 3300028016 Ga0265354_1002387 Ga0265354_10023871 229
17 3300030878 Ga0265770_1000025 Ga0265770_10000258 229
18 3300030879 Ga0265765_1000124 Ga0265765_10001244 229
19 3300031090 Ga0265760_10002670 Ga0265760_100026702 229
20 3300009553 Ga0105249_10156762 Ga0105249_101567624 230
21 3300031903 Ga0307407_10297687 Ga0307407_102976872 230
22 3300047443 Ga0495687_039103 Ga0495687_039103_451_1215 230
23 3300048916 Ga0496113_0134060 Ga0496113_0134060_237_1022 230
24 3300048916 Ga0496113_0441745 Ga0496113_0441745_137_961 230
25 3300049579 Ga0501043_0417336 Ga0501043_0417336_53_865 230
26 3300053153 Ga0500616_0002192 Ga0500616_0002192_14692_15480 230
27 3300006353 Ga0075370_10106235 Ga0075370_101062353 231
28 3300009094 Ga0111539_10016373 Ga0111539_100163734 231
29 3300031731 Ga0307405_10207365 Ga0307405_102073651 231
30 3300050492 nmdc:mga0yw44_23603_c1 nmdc:mga0yw44_23603_c1_1117_1836 231
31 3300050511 nmdc:mga08y16_65690_c1 nmdc:mga08y16_65690_c1_1626_2345 231
32 3300044693 Ga0466961_0010990 Ga0466961_0010990_1419_2207 232
33 3300049586 Ga0501070_0055550 Ga0501070_0055550_2435_3187 232
34 3300049589 Ga0501073_0297533 Ga0501073_0297533_163_915 232
35 3300005436 Ga0070713_100050945 Ga0070713_1000509452 233
36 3300025928 Ga0207700_10039703 Ga0207700_100397032 233
37 3300035117 Ga0373953_0028630 Ga0373953_0028630_789_1577 233
38 3300047320 Ga0495672_0062444 Ga0495672_0062444_677_1444 233
39 3300050492 nmdc:mga0yw44_360937_c1 nmdc:mga0yw44_360937_c1_90_842 233
40 3300007265 Ga0099794_10010286 Ga0099794_100102862 234
41 3300049588 Ga0501072_0019307 Ga0501072_0019307_3889_4701 234
42 3300060353 Ga0501082_0286174 Ga0501082_0286174_21_833 234
43 3300048091 Ga0495626_0056291 Ga0495626_0056291_548_1315 235
44 3300053108 Ga0500562_000901 Ga0500562_000901_1729_2496 235
45 3300003792 Ga0055540_1003011 Ga0055540_10030116 236
46 3300005338 Ga0068868_100293191 Ga0068868_1002931911 236
47 3300005347 Ga0070668_100116408 Ga0070668_1001164082 236
48 3300006038 Ga0075365_10227536 Ga0075365_102275362 236
49 3300025273 Ga0209673_1025038 Ga0209673_10250384 236
50 3300025303 Ga0209051_1003001 Ga0209051_10030016 236
51 3300036401 Ga0373937_0070064 Ga0373937_0070064_747_1535 236
52 3300046516 Ga0495628_0056411 Ga0495628_0056411_13_765 236
53 3300046529 Ga0495652_0068250 Ga0495652_0068250_1635_2423 236
54 3300048909 Ga0496106_0002998 Ga0496106_0002998_1063_1809 236
55 3300049568 Ga0501031_0144705 Ga0501031_0144705_119_886 236
56 3300049570 Ga0501033_0038886 Ga0501033_0038886_1521_2288 236
57 3300049571 Ga0501034_0082780 Ga0501034_0082780_766_1533 236
58 3300049572 Ga0501036_0195237 Ga0501036_0195237_252_1019 236
59 3300049579 Ga0501043_0325942 Ga0501043_0325942_16_783 236
60 3300049581 Ga0501047_0010399 Ga0501047_0010399_5897_6664 236
61 3300049582 Ga0501048_0118050 Ga0501048_0118050_375_1142 236
62 3300049822 Ga0501035_0000662 Ga0501035_0000662_14538_15305 236
63 3300049823 Ga0501044_0004319 Ga0501044_0004319_2919_3686 236
64 3300050492 nmdc:mga0yw44_203102_c1 nmdc:mga0yw44_203102_c1_440_1210 236
65 3300026023 Ga0207677_10243397 Ga0207677_102433972 237
66 3300026118 Ga0207675_100214833 Ga0207675_1002148332 237
67 3300037853 Ga0436364_1245740 Ga0436364_1245740_1169_1936 237
68 3300039437 Ga0436365_0286650 Ga0436365_0286650_3068_3856 237
69 3300044683 Ga0466965_0013631 Ga0466965_0013631_2430_3194 237
70 3300044901 Ga0466960_0001271 Ga0466960_0001271_7062_7826 237
71 3300046455 Ga0495603_0186495 Ga0495603_0186495_98_883 237
72 3300046458 Ga0495591_002815 Ga0495591_002815_1822_2607 237
73 3300046459 Ga0495629_0019879 Ga0495629_0019879_315_1100 237
74 3300046462 Ga0495651_0010517 Ga0495651_0010517_922_1707 237
75 3300046463 Ga0495653_0091069 Ga0495653_0091069_127_912 237
76 3300046476 Ga0495662_0006748 Ga0495662_0006748_953_1738 237
77 3300046500 Ga0495596_0002420 Ga0495596_0002420_8363_9148 237
78 3300046511 Ga0495608_0006704 Ga0495608_0006704_3478_4263 237
79 3300046514 Ga0495618_0004611 Ga0495618_0004611_464_1249 237
80 3300046517 Ga0495630_0018177 Ga0495630_0018177_435_1220 237
81 3300046526 Ga0495666_0018687 Ga0495666_0018687_473_1258 237
82 3300046531 Ga0495665_0018688 Ga0495665_0018688_2386_3171 237
83 3300046533 Ga0495640_0017916 Ga0495640_0017916_2869_3654 237
84 3300046536 Ga0495587_0053944 Ga0495587_0053944_676_1461 237
85 3300046543 Ga0495645_0095926 Ga0495645_0095926_1185_1970 237
86 3300046559 Ga0495667_0203762 Ga0495667_0203762_159_944 237
87 3300046642 Ga0495634_0052600 Ga0495634_0052600_1654_2439 237
88 3300046663 Ga0495635_0057593 Ga0495635_0057593_107_892 237
89 3300046665 Ga0495661_0002228 Ga0495661_0002228_6093_6878 237
90 3300046678 Ga0495599_0038376 Ga0495599_0038376_853_1638 237
91 3300046679 Ga0495623_0030904 Ga0495623_0030904_937_1722 237
92 3300046680 Ga0495646_0009527 Ga0495646_0009527_4463_5248 237
93 3300046689 Ga0495613_0002811 Ga0495613_0002811_10186_10971 237
94 3300046690 Ga0495624_0054585 Ga0495624_0054585_419_1204 237
95 3300046794 Ga0495589_0002656 Ga0495589_0002656_2643_3428 237
96 3300046809 Ga0495600_0001538 Ga0495600_0001538_1968_2753 237
97 3300047315 Ga0495581_0147137 Ga0495581_0147137_254_1039 237
98 3300047317 Ga0495604_0004386 Ga0495604_0004386_2072_2857 237
99 3300047319 Ga0495674_0086126 Ga0495674_0086126_1477_2262 237
100 3300047323 Ga0495683_0004268 Ga0495683_0004268_889_1674 237
101 3300047444 Ga0495675_0001601 Ga0495675_0001601_937_1722 237
102 3300047446 Ga0495679_003527 Ga0495679_003527_3624_4409 237
103 3300047469 Ga0495673_0009745 Ga0495673_0009745_3729_4514 237
104 3300047673 Ga0495593_0009280 Ga0495593_0009280_2280_3065 237
105 3300048088 Ga0495602_0086446 Ga0495602_0086446_1480_2265 237
106 3300048089 Ga0495614_0050403 Ga0495614_0050403_554_1339 237
107 3300002459 JGI24751J29686_10009316 JGI24751J29686_100093162 238
108 3300005330 Ga0070690_100001483 Ga0070690_1000014837 238
109 3300005367 Ga0070667_100041661 Ga0070667_1000416613 238
110 3300005544 Ga0070686_100038451 Ga0070686_1000384512 238
111 3300005841 Ga0068863_100004059 Ga0068863_10000405914 238
112 3300025986 Ga0207658_10096609 Ga0207658_100966093 238
113 3300026088 Ga0207641_10017289 Ga0207641_100172899 238
114 3300044656 Ga0466969_0085270 Ga0466969_0085270_375_1130 238
115 3300044693 Ga0466961_0316168 Ga0466961_0316168_172_927 238
116 3300044706 Ga0466964_0009629 Ga0466964_0009629_1064_1882 238
117 3300044719 Ga0466971_0038904 Ga0466971_0038904_1158_1976 238
118 3300044842 Ga0466957_0007276 Ga0466957_0007276_985_1803 238
119 3300045049 Ga0466959_0012698 Ga0466959_0012698_209_1027 238
120 3300045836 Ga0466958_0029341 Ga0466958_0029341_515_1333 238
121 3300045976 Ga0466967_0037408 Ga0466967_0037408_1725_2465 238
122 3300046679 Ga0495623_0059869 Ga0495623_0059869_1457_2260 238
123 3300005577 Ga0068857_100398050 Ga0068857_1003980502 239
124 3300006038 Ga0075365_10231650 Ga0075365_102316502 239
125 3300026116 Ga0207674_10250949 Ga0207674_102509492 239
126 3300037312 Ga0395899_0000008 Ga0395899_0000008_240752_241570 240
127 3300037418 Ga0395900_0002437 Ga0395900_0002437_5679_6497 240
128 3300037466 Ga0395898_0000386 Ga0395898_0000386_24137_24955 240
129 3300046459 Ga0495629_0144152 Ga0495629_0144152_88_834 240
130 3300046473 Ga0495582_0288280 Ga0495582_0288280_78_824 240
131 3300046475 Ga0495639_0198085 Ga0495639_0198085_144_890 240
132 3300047315 Ga0495581_0143772 Ga0495581_0143772_335_1081 240
133 3300005563 Ga0068855_100059966 Ga0068855_1000599663 241
134 3300013105 Ga0157369_10000200 Ga0157369_100002003 241
135 3300014969 Ga0157376_10038208 Ga0157376_100382082 241
136 3300049569 Ga0501032_0009163 Ga0501032_0009163_2455_3267 241
137 3300049573 Ga0501037_0028490 Ga0501037_0028490_2317_3129 241
138 3300049579 Ga0501043_0077518 Ga0501043_0077518_342_1154 241
139 3300049583 Ga0501067_0000265 Ga0501067_0000265_18651_19463 241
140 3300049584 Ga0501068_0015957 Ga0501068_0015957_2360_3172 241
141 3300049589 Ga0501073_0000002 Ga0501073_0000002_290027_290839 241
142 3300049593 Ga0501077_0000075 Ga0501077_0000075_15910_16722 241
143 3300049742 Ga0501080_0009453 Ga0501080_0009453_7032_7844 241
144 3300049742 Ga0501080_0347899 Ga0501080_0347899_221_997 241
145 3300049823 Ga0501044_0006193 Ga0501044_0006193_2234_3046 241
146 iso_pu_bacteria 2902799365 2902803560 241
147 3300006846 Ga0075430_100084074 Ga0075430_1000840742 242
148 3300050509 nmdc:mga0qj67_324629_c1 nmdc:mga0qj67_324629_c1_141_959 242
149 iso_pu_bacteria 2773857762 2774395855 242
150 iso_pu_bacteria 2811994878 2812348028 242
151 iso_pu_bacteria 2917736166 2917737972 242
152 3300005327 Ga0070658_10000229 Ga0070658_1000022947 243
153 3300006038 Ga0075365_10498226 Ga0075365_104982261 243
154 3300006186 Ga0075369_10032367 Ga0075369_100323672 243
155 3300026142 Ga0207698_10219624 Ga0207698_102196242 243
156 3300048912 Ga0496109_0001251 Ga0496109_0001251_15375_16160 243
157 3300050492 nmdc:mga0yw44_286624_c1 nmdc:mga0yw44_286624_c1_252_1013 243
158 3300050516 nmdc:mga0sz30_41255_c1 nmdc:mga0sz30_41255_c1_213_974 243
159 3300046452 Ga0495617_016520 Ga0495617_016520_1607_2371 244
160 3300046455 Ga0495603_0016032 Ga0495603_0016032_3263_4027 244
161 3300046457 Ga0495590_0088597 Ga0495590_0088597_32_796 244
162 3300046492 Ga0495585_0038804 Ga0495585_0038804_1095_1859 244
163 3300046499 Ga0495594_0060879 Ga0495594_0060879_504_1268 244
164 3300046501 Ga0495607_0026838 Ga0495607_0026838_830_1594 244
165 3300046506 Ga0495583_0062992 Ga0495583_0062992_574_1338 244
166 3300046507 Ga0495606_0020287 Ga0495606_0020287_4084_4848 244
167 3300046513 Ga0495616_0018374 Ga0495616_0018374_3050_3814 244
168 3300046515 Ga0495620_0032598 Ga0495620_0032598_1390_2154 244
169 3300046518 Ga0495631_0004976 Ga0495631_0004976_5282_6046 244
170 3300046538 Ga0495609_0073456 Ga0495609_0073456_79_843 244
171 3300046542 Ga0495597_0116351 Ga0495597_0116351_160_924 244
172 3300046557 Ga0495622_0005077 Ga0495622_0005077_5123_5887 244
173 3300046694 Ga0495649_0035474 Ga0495649_0035474_1309_2073 244
174 3300046694 Ga0495649_0036050 Ga0495649_0036050_340_1164 244
175 3300047317 Ga0495604_0087473 Ga0495604_0087473_373_1134 244
176 3300047321 Ga0495676_0143364 Ga0495676_0143364_371_1135 244
177 3300047323 Ga0495683_0114662 Ga0495683_0114662_230_994 244
178 3300047472 Ga0495686_0145060 Ga0495686_0145060_273_1037 244
179 3300048091 Ga0495626_0067680 Ga0495626_0067680_20_784 244
180 3300048909 Ga0496106_0000067 Ga0496106_0000067_54289_55167 244
181 3300048924 Ga0496121_0004616 Ga0496121_0004616_9391_10269 244
182 3300049459 Ga0495678_021427 Ga0495678_021427_1800_2564 244
183 3300006038 Ga0075365_10021595 Ga0075365_100215951 245
184 3300044842 Ga0466957_0008968 Ga0466957_0008968_1354_2121 245
185 3300046460 Ga0495638_0009097 Ga0495638_0009097_2765_3595 245
186 3300047319 Ga0495674_0006015 Ga0495674_0006015_601_1422 245
187 3300048905 Ga0496102_0569864 Ga0496102_0569864_96_917 245
188 3300061719 Ga0466962_0023410 Ga0466962_0023410_40_807 245
189 3300003792 Ga0055540_1004341 Ga0055540_10043414 246
190 3300006038 Ga0075365_10042837 Ga0075365_100428374 246
191 3300006042 Ga0075368_10052787 Ga0075368_100527872 246
192 3300006048 Ga0075363_100285180 Ga0075363_1002851802 246
193 3300009545 Ga0105237_10006598 Ga0105237_100065989 246
194 3300014969 Ga0157376_10231782 Ga0157376_102317822 246
195 3300028017 Ga0265356_1002577 Ga0265356_10025772 246
196 3300028023 Ga0265357_1010645 Ga0265357_10106451 246
197 3300037418 Ga0395900_0018724 Ga0395900_0018724_1534_2307 246
198 3300044684 Ga0466966_0000608 Ga0466966_0000608_16902_17753 246
199 3300044694 Ga0466963_0000868 Ga0466963_0000868_12563_13414 246
200 3300044694 Ga0466963_0074406 Ga0466963_0074406_925_1704 246
201 3300044719 Ga0466971_0030745 Ga0466971_0030745_1515_2366 246
202 3300044765 Ga0466970_0048850 Ga0466970_0048850_249_1028 246
203 3300044842 Ga0466957_0013981 Ga0466957_0013981_1144_1995 246
204 3300044842 Ga0466957_0014339 Ga0466957_0014339_3741_4520 246
205 3300045836 Ga0466958_0084714 Ga0466958_0084714_1060_1911 246
206 3300041486 Ga0451807_0068990 Ga0451807_0068990_50_820 247
207 3300050489 nmdc:mga03683_14462_c1 nmdc:mga03683_14462_c1_256_1059 247
208 3300053108 Ga0500562_003558 Ga0500562_003558_96_866 247
209 3300028800 Ga0265338_10208043 Ga0265338_102080432 248
210 3300031711 Ga0265314_10054311 Ga0265314_100543113 248
211 3300044684 Ga0466966_0067987 Ga0466966_0067987_1347_2153 248
212 3300035083 Ga0373926_0022558 Ga0373926_0022558_72_848 249
213 3300037068 Ga0373925_0013643 Ga0373925_0013643_3103_3885 249
214 3300046507 Ga0495606_0027241 Ga0495606_0027241_2599_3423 249
215 3300047323 Ga0495683_0003930 Ga0495683_0003930_7582_8442 249
216 3300002067 JGI24735J21928_10000627 JGI24735J21928_100006277 250
217 3300005455 Ga0070663_100207844 Ga0070663_1002078442 250
218 3300006051 Ga0075364_10008451 Ga0075364_100084519 250
219 3300031548 Ga0307408_100001575 Ga0307408_1000015756 250
220 3300031731 Ga0307405_10018763 Ga0307405_100187632 250
221 3300031911 Ga0307412_10012980 Ga0307412_100129801 250
222 3300046516 Ga0495628_0042453 Ga0495628_0042453_1595_2479 250
223 3300046526 Ga0495666_0001775 Ga0495666_0001775_2765_3649 250
224 3300046529 Ga0495652_0459767 Ga0495652_0459767_81_875 250
225 3300046557 Ga0495622_0067504 Ga0495622_0067504_810_1622 250
226 3300046679 Ga0495623_0141980 Ga0495623_0141980_56_880 250
227 3300047317 Ga0495604_0009505 Ga0495604_0009505_5909_6793 250
228 3300047322 Ga0495680_0005456 Ga0495680_0005456_9254_10138 250
229 3300047444 Ga0495675_0143233 Ga0495675_0143233_436_1320 250
230 3300048929 Ga0496126_0004564 Ga0496126_0004564_9146_10030 250
231 3300049460 Ga0495682_0031820 Ga0495682_0031820_245_1069 250
232 3300005459 Ga0068867_100000050 Ga0068867_10000005012 251
233 3300009148 Ga0105243_10007492 Ga0105243_100074925 251
234 3300014745 Ga0157377_10000037 Ga0157377_1000003752 251
235 3300025935 Ga0207709_10006164 Ga0207709_100061642 251
236 3300026089 Ga0207648_10000056 Ga0207648_1000005629 251
237 3300035410 Ga0373924_0000207 Ga0373924_0000207_16735_17541 251
238 3300030521 Ga0307511_10140213 Ga0307511_101402131 252
239 3300046506 Ga0495583_0000062 Ga0495583_0000062_33320_34102 252
240 3300046507 Ga0495606_0001633 Ga0495606_0001633_6472_7254 252
241 3300046694 Ga0495649_0000247 Ga0495649_0000247_33302_34084 252
242 3300053080 Ga0500635_0003685 Ga0500635_0003685_2559_3341 252
243 3300013105 Ga0157369_10004045 Ga0157369_1000404510 253
244 3300046678 Ga0495599_0038069 Ga0495599_0038069_700_1584 253
245 iso_pu_bacteria 2510917014 2511094804 253
246 iso_pu_bacteria 2510917015 2511104503 253
247 iso_pu_bacteria 2513237082 2513551654 253
248 iso_pu_bacteria 2513237083 2513563818 253
249 iso_pu_bacteria 2515154189 2516017042 253
250 iso_pu_bacteria 2600255067 2600810605 253
251 iso_pu_bacteria 2883087390 2883094798 253
252 iso_pu_bacteria 8003955200 8003960492 253
253 iso_pu_bacteria 2501025502 2501078748 255
254 iso_pu_bacteria 2510917013 2511089392 255
255 3300046460 Ga0495638_0009011 Ga0495638_0009011_1828_2640 256
256 iso_pu_bacteria 2508501125 2509129430 256
257 iso_pu_bacteria 2510065045 2510250021 256
258 iso_pu_bacteria 2512047030 2512347588 256
259 iso_pu_bacteria 2513237151 2513962413 256
260 iso_pu_bacteria 2515154122 2515679370 256
261 iso_pu_bacteria 2526164713 2527079186 256
262 iso_pu_bacteria 2718217991 2719639180 256
263 iso_pu_bacteria 2738541296 2738820067 256
264 iso_pu_bacteria 2738541298 2738832547 256
265 iso_pu_bacteria 2738541306 2738874074 256
266 iso_pu_bacteria 2738543002 2739185704 256
267 iso_pu_bacteria 2738543008 2739220672 256
268 iso_pu_bacteria 2744054900 2746092165 256
269 iso_pu_bacteria 2744054901 2746095206 256
270 iso_pu_bacteria 2818991450 2819620924 256
271 iso_pu_bacteria 2842324504 2842331283 256
272 iso_pu_bacteria 2842348783 2842355622 256
273 iso_pu_bacteria 2842454564 2842462074 256
274 iso_pu_bacteria 2885270888 2885277247 256
275 iso_pu_bacteria 2900634093 2900636191 256
276 iso_pu_bacteria 2902682994 2902683388 256
277 iso_pu_bacteria 2904483920 2904484015 256
278 iso_pu_bacteria 2919527303 2919529963 256
279 iso_pu_bacteria 2928108538 2928109726 256
280 iso_pu_bacteria 2928135762 2928136820 256
281 iso_pu_bacteria 2928503688 2928506348 256
282 iso_pu_bacteria 2945934425 2945935473 256
283 iso_pu_bacteria 2990703756 2990703977 256
284 iso_pu_bacteria 641736151 642422135 256
285 iso_pu_bacteria 642555113 642620349 256
286 iso_pu_bacteria 8055266321 8055266656 256
287 iso_pu_bacteria 8055301274 8055305197 256
288 3300003320 rootH2_10152216 rootH2_101522165 257
289 3300003323 rootH1_10165822 rootH1_101658221 257
290 3300013102 Ga0157371_10052558 Ga0157371_100525583 257
291 3300025941 Ga0207711_10055345 Ga0207711_100553453 257
292 3300037312 Ga0395899_0039333 Ga0395899_0039333_1101_1919 257
293 3300038443 Ga0395901_0084836 Ga0395901_0084836_2341_3192 257
294 iso_pu_bacteria 2856287931 2856290268 257
295 iso_pu_bacteria 2857357740 2857362707 257
296 3300009177 Ga0105248_10112236 Ga0105248_101122362 258
297 3300039447 Ga0436361_0632299 Ga0436361_0632299_24_875 258
298 3300044765 Ga0466970_0010230 Ga0466970_0010230_2874_3704 258
299 3300048920 Ga0496117_0033575 Ga0496117_0033575_1421_2260 258
300 3300048929 Ga0496126_0002353 Ga0496126_0002353_16676_17515 258
301 iso_pu_bacteria 2501025504 2501413932 258
302 3300047320 Ga0495672_0044542 Ga0495672_0044542_818_1642 259
303 3300001979 JGI24740J21852_10003835 JGI24740J21852_100038355 260
304 3300001989 JGI24739J22299_10001082 JGI24739J22299_100010827 260
305 3300002705 JGI25156J39149_1000679 JGI25156J39149_10006797 260
306 3300003214 JGI25165J46597_1001511 JGI25165J46597_10015118 260
307 3300003756 Ga0055533_1000126 Ga0055533_100012626 260
308 3300003756 Ga0055533_1001859 Ga0055533_10018592 260
309 3300003758 Ga0055532_1000001 Ga0055532_1000001912 260
310 3300003760 Ga0055527_1000014 Ga0055527_100001493 260
311 3300003761 Ga0055535_1000001 Ga0055535_100000193 260
312 3300003762 Ga0055542_1000001 Ga0055542_1000001911 260
313 3300003763 Ga0055529_1000001 Ga0055529_100000193 260
314 3300005339 Ga0070660_100016738 Ga0070660_1000167382 260
315 3300005455 Ga0070663_100064192 Ga0070663_1000641923 260
316 3300009011 Ga0105251_10000947 Ga0105251_1000094721 260
317 3300009551 Ga0105238_10653705 Ga0105238_106537051 260
318 3300015262 Ga0182007_10000155 Ga0182007_100001553 260
319 3300025226 Ga0209674_100005 Ga0209674_1000051343 260
320 3300025226 Ga0209674_100092 Ga0209674_100092105 260
321 3300025228 Ga0209672_100001 Ga0209672_1000011740 260
322 3300025229 Ga0209147_100001 Ga0209147_1000011740 260
323 3300025230 Ga0209563_103707 Ga0209563_1037072 260
324 3300025231 Ga0207427_102459 Ga0207427_1024594 260
325 3300025242 Ga0209258_100001 Ga0209258_1000011740 260
326 3300025246 Ga0209646_1014181 Ga0209646_10141811 260
327 3300025254 Ga0209148_1000003 Ga0209148_10000031740 260
328 3300025256 Ga0209759_1000053 Ga0209759_100005350 260
329 3300025256 Ga0209759_1000120 Ga0209759_100012048 260
330 3300025256 Ga0209759_1000172 Ga0209759_100017224 260
331 3300025261 Ga0209233_1000016 Ga0209233_1000016700 260
332 3300025272 Ga0209455_1000001 Ga0209455_10000011740 260
333 3300025735 Ga0207713_1000841 Ga0207713_100084116 260
334 3300025904 Ga0207647_10030484 Ga0207647_100304843 260
335 3300025904 Ga0207647_10142085 Ga0207647_101420851 260
336 3300025913 Ga0207695_10344321 Ga0207695_103443212 260
337 3300025919 Ga0207657_10077245 Ga0207657_100772452 260
338 3300026067 Ga0207678_10084784 Ga0207678_100847842 260
339 3300031911 Ga0307412_10000051 Ga0307412_1000005161 260
340 3300046454 Ga0495592_0063382 Ga0495592_0063382_706_1518 260
341 3300046455 Ga0495603_0001398 Ga0495603_0001398_509_1330 260
342 3300046457 Ga0495590_0003975 Ga0495590_0003975_2078_2902 260
343 3300046457 Ga0495590_0015693 Ga0495590_0015693_52_876 260
344 3300046459 Ga0495629_0000015 Ga0495629_0000015_43768_44592 260
345 3300046461 Ga0495641_0048669 Ga0495641_0048669_1016_1876 260
346 3300046463 Ga0495653_0009072 Ga0495653_0009072_6689_7510 260
347 3300046463 Ga0495653_0014131 Ga0495653_0014131_2473_3297 260
348 3300046463 Ga0495653_0020871 Ga0495653_0020871_3956_4768 260
349 3300046471 Ga0495650_0008701 Ga0495650_0008701_4394_5254 260
350 3300046471 Ga0495650_0035295 Ga0495650_0035295_229_1053 260
351 3300046471 Ga0495650_0078735 Ga0495650_0078735_41_865 260
352 3300046472 Ga0495580_0000313 Ga0495580_0000313_18470_19291 260
353 3300046472 Ga0495580_0001949 Ga0495580_0001949_5705_6589 260
354 3300046472 Ga0495580_0006838 Ga0495580_0006838_2304_3128 260
355 3300046472 Ga0495580_0010793 Ga0495580_0010793_4830_5654 260
356 3300046473 Ga0495582_0000334 Ga0495582_0000334_9902_10723 260
357 3300046474 Ga0495605_0002255 Ga0495605_0002255_8954_9778 260
358 3300046476 Ga0495662_0071904 Ga0495662_0071904_834_1655 260
359 3300046477 Ga0495664_0000651 Ga0495664_0000651_7569_8390 260
360 3300046477 Ga0495664_0145419 Ga0495664_0145419_296_1156 260
361 3300046500 Ga0495596_0055816 Ga0495596_0055816_365_1225 260
362 3300046506 Ga0495583_0002886 Ga0495583_0002886_9952_10776 260
363 3300046507 Ga0495606_0031205 Ga0495606_0031205_2694_3518 260
364 3300046507 Ga0495606_0073732 Ga0495606_0073732_858_1664 260
365 3300046511 Ga0495608_0025582 Ga0495608_0025582_705_1565 260
366 3300046514 Ga0495618_0011193 Ga0495618_0011193_26_886 260
367 3300046514 Ga0495618_0026653 Ga0495618_0026653_40_861 260
368 3300046514 Ga0495618_0097975 Ga0495618_0097975_74_898 260
369 3300046515 Ga0495620_0015146 Ga0495620_0015146_2437_3261 260
370 3300046516 Ga0495628_0012140 Ga0495628_0012140_296_1120 260
371 3300046516 Ga0495628_0320119 Ga0495628_0320119_252_1073 260
372 3300046517 Ga0495630_0063229 Ga0495630_0063229_81_905 260
373 3300046517 Ga0495630_0084362 Ga0495630_0084362_534_1355 260
374 3300046517 Ga0495630_0234394 Ga0495630_0234394_528_1388 260
375 3300046524 Ga0495648_0042812 Ga0495648_0042812_1800_2624 260
376 3300046524 Ga0495648_0176616 Ga0495648_0176616_110_931 260
377 3300046526 Ga0495666_0000814 Ga0495666_0000814_4207_5028 260
378 3300046528 Ga0495642_0024961 Ga0495642_0024961_1281_2087 260
379 3300046529 Ga0495652_0116668 Ga0495652_0116668_61_873 260
380 3300046531 Ga0495665_0014493 Ga0495665_0014493_1825_2646 260
381 3300046531 Ga0495665_0150580 Ga0495665_0150580_221_1045 260
382 3300046533 Ga0495640_0000462 Ga0495640_0000462_22182_23003 260
383 3300046535 Ga0495586_0008858 Ga0495586_0008858_110_931 260
384 3300046535 Ga0495586_0076821 Ga0495586_0076821_205_1065 260
385 3300046536 Ga0495587_0006065 Ga0495587_0006065_955_1776 260
386 3300046543 Ga0495645_0005691 Ga0495645_0005691_6906_7727 260
387 3300046642 Ga0495634_0030365 Ga0495634_0030365_343_1164 260
388 3300046648 Ga0495611_0047495 Ga0495611_0047495_178_1002 260
389 3300046660 Ga0495625_0062665 Ga0495625_0062665_1142_1966 260
390 3300046665 Ga0495661_0101900 Ga0495661_0101900_417_1238 260
391 3300046678 Ga0495599_0026197 Ga0495599_0026197_2724_3545 260
392 3300046679 Ga0495623_0063769 Ga0495623_0063769_1422_2246 260
393 3300046680 Ga0495646_0000252 Ga0495646_0000252_19812_20636 260
394 3300046680 Ga0495646_0002434 Ga0495646_0002434_6696_7517 260
395 3300046680 Ga0495646_0118185 Ga0495646_0118185_32_892 260
396 3300046689 Ga0495613_0015810 Ga0495613_0015810_4300_5121 260
397 3300046689 Ga0495613_0193047 Ga0495613_0193047_378_1238 260
398 3300046690 Ga0495624_0000132 Ga0495624_0000132_51244_52128 260
399 3300046690 Ga0495624_0013207 Ga0495624_0013207_2492_3316 260
400 3300046794 Ga0495589_0058962 Ga0495589_0058962_532_1338 260
401 3300046794 Ga0495589_0105047 Ga0495589_0105047_110_934 260
402 3300047315 Ga0495581_0000198 Ga0495581_0000198_7044_7865 260
403 3300047315 Ga0495581_0006007 Ga0495581_0006007_461_1321 260
404 3300047317 Ga0495604_0005611 Ga0495604_0005611_4436_5260 260
405 3300047317 Ga0495604_0018264 Ga0495604_0018264_4096_4917 260
406 3300047319 Ga0495674_0386487 Ga0495674_0386487_201_1022 260
407 3300047321 Ga0495676_0009226 Ga0495676_0009226_2069_2890 260
408 3300047321 Ga0495676_0195232 Ga0495676_0195232_528_1388 260
409 3300047322 Ga0495680_0134793 Ga0495680_0134793_11_871 260
410 3300047323 Ga0495683_0082648 Ga0495683_0082648_445_1269 260
411 3300047444 Ga0495675_0077753 Ga0495675_0077753_287_1108 260
412 3300047444 Ga0495675_0093235 Ga0495675_0093235_991_1851 260
413 3300047446 Ga0495679_000045 Ga0495679_000045_113829_114653 260
414 3300047446 Ga0495679_024876 Ga0495679_024876_938_1759 260
415 3300047469 Ga0495673_0045004 Ga0495673_0045004_191_1015 260
416 3300047673 Ga0495593_0007050 Ga0495593_0007050_4067_4891 260
417 3300047673 Ga0495593_0035725 Ga0495593_0035725_1458_2318 260
418 3300048088 Ga0495602_0012039 Ga0495602_0012039_626_1438 260
419 3300048088 Ga0495602_0066980 Ga0495602_0066980_201_1022 260
420 3300048088 Ga0495602_0206758 Ga0495602_0206758_570_1430 260
421 3300048089 Ga0495614_0059321 Ga0495614_0059321_373_1233 260
422 3300048089 Ga0495614_0106385 Ga0495614_0106385_111_935 260
423 3300048091 Ga0495626_0010620 Ga0495626_0010620_3463_4287 260
424 3300048919 Ga0496116_0024471 Ga0496116_0024471_185_1006 260
425 3300048920 Ga0496117_0045490 Ga0496117_0045490_293_1117 260
426 3300048920 Ga0496117_0073371 Ga0496117_0073371_240_1046 260
427 3300048920 Ga0496117_0086110 Ga0496117_0086110_244_1065 260
428 3300048921 Ga0496118_0000248 Ga0496118_0000248_85677_86498 260
429 3300048921 Ga0496118_0027675 Ga0496118_0027675_3869_4675 260
430 3300048921 Ga0496118_0037767 Ga0496118_0037767_40_864 260
431 3300048924 Ga0496121_0264279 Ga0496121_0264279_53_877 260
432 3300049460 Ga0495682_0009376 Ga0495682_0009376_1869_2693 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

41

260

0.89

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

36

259

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z0m-assembly1.cif.gz_C echa5 mycobacterium tuberculosis 0.9401 9 232
4qfe-assembly1.cif.gz_D crystal structure of an enoyl-coa hydratase from mycobacterium smegmatis 0.938 8 232
3r9q-assembly1.cif.gz_A structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9374 8 237
3qka-assembly1.cif.gz_E crystal structure of enoyl-coa hydratase echa5 from mycobacterium marinum 0.9306 5 245
4qfe-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase from mycobacterium smegmatis 0.9277 8 232
ID Description Score Start End Superfamily
3qkaE01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9101 5 200 3.90.226.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9095 8 67 3.30.300.220
3fduC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8987 8 191 3.90.226.10
3r9sB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8982 11 190 3.90.226.10
4f47A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8929 11 201 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7Z0F8C8-F1-model_v4 deleted 0.9798 1 260
AF-A0A7Z0F8C8-F1-model_v4 deleted 0.9761 1 260
AF-A0A6J5K6L7-F1-model_v4 Sugar efflux transporter 0.9664 1 221 GO:0005886
GO:0022857
AF-A0A3C7W3E4-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9626 8 162 GO:0004300
AF-A0A424IJI6-F1-model_v4 Crotonase/enoyl-CoA hydratase family protein 0.9625 9 257

Feature Viewer

pLDDT pTM Quality
94.39 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map