F442686

General Info

Members Datasets Scaffolds Average Seq Length
432 246 864 128

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0013425|Ga0495684_0013425_2319_2750
Length 143
Sequence MLGIPSACGGCAAMPTELVLQKKREAAMRYGLIVLGMLVLAAPAQAESRSAYVTMVLQAFAAKVECPGTDVVYQDLVQTTEMVRKEIAFMHTGGKMGERQDDELMSEVAMATKSTDLDQNRLGMTTWCETQKTRLAGFIRVKN

Samples

Sample ID Description Type Environment
1 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
135 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
231 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
234 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
235 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
241 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
242 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
246 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.33
Nodule 0
Rhizoplane 6.25
Rhizosphere 76.16
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495684_0013425 3300047471 Bacteria 6304
2 rootH2_10023124 3300003320 Bacteria 4371
3 rootH1_10046484 3300003323 Bacteria 13791
4 Ga0070683_100466380 3300005329 Bacteria 1205
5 Ga0070666_11287582 3300005335 Unclassified 545
6 Ga0070680_100078106 3300005336 Bacteria 2727
7 Ga0070660_100266215 3300005339 Bacteria 1400
8 Ga0070668_100242652 3300005347 Bacteria 1493
9 Ga0070671_100099461 3300005355 Bacteria 2440
10 Ga0070674_100366639 3300005356 Bacteria 1168
11 Ga0070673_101266558 3300005364 Bacteria 692
12 Ga0070709_10018778 3300005434 Bacteria 3989
13 Ga0070709_10046681 3300005434 Bacteria 2694
14 Ga0070709_10325925 3300005434 Unclassified 1129
15 Ga0070714_100002572 3300005435 Bacteria 13368
16 Ga0070714_100130795 3300005435 Bacteria 2243
17 Ga0070714_100549043 3300005435 Bacteria 1106
18 Ga0070713_100012141 3300005436 Bacteria 6307
19 Ga0070713_100061218 3300005436 Bacteria 3148
20 Ga0070713_100546817 3300005436 Bacteria 1096
21 Ga0070713_101113582 3300005436 Unclassified 763
22 Ga0070710_10003305 3300005437 Bacteria 7644
23 Ga0070710_10035248 3300005437 Bacteria 2727
24 Ga0070710_10045132 3300005437 Bacteria 2449
25 Ga0070711_100006055 3300005439 Bacteria 7265
26 Ga0070711_100012557 3300005439 Bacteria 5295
27 Ga0070711_100015604 3300005439 Bacteria 4810
28 Ga0070711_100122507 3300005439 Bacteria 1925
29 Ga0070708_100543577 3300005445 Bacteria 1096
30 Ga0070663_100444055 3300005455 Bacteria 1068
31 Ga0070678_100022772 3300005456 Bacteria 4160
32 Ga0070681_10107142 3300005458 Bacteria 2736
33 Ga0070699_101401612 3300005518 Bacteria 641
34 Ga0070679_100464813 3300005530 Bacteria 1210
35 Ga0070684_100007242 3300005535 Bacteria 8621
36 Ga0068853_100068659 3300005539 Bacteria 3082
37 Ga0068853_100453893 3300005539 Bacteria 1206
38 Ga0068853_100871872 3300005539 Bacteria 864
39 Ga0070665_100526461 3300005548 Bacteria 1194
40 Ga0068855_100176243 3300005563 Bacteria 2419
41 Ga0070702_100635128 3300005615 Unclassified 805
42 Ga0068852_102076868 3300005616 Bacteria 590
43 Ga0068859_102115168 3300005617 Bacteria 621
44 Ga0068864_100107376 3300005618 Bacteria 2483
45 Ga0068866_10697435 3300005718 Bacteria 696
46 Ga0068851_10349115 3300005834 Bacteria 860
47 Ga0068858_100626009 3300005842 Bacteria 1045
48 Ga0068858_101106025 3300005842 Bacteria 778
49 Ga0068860_100000210 3300005843 Bacteria 91495
50 Ga0068860_100277228 3300005843 Bacteria 1638
51 Ga0081455_10939350 3300005937 Bacteria 537
52 Ga0081540_1314037 3300005983 Bacteria 538
53 Ga0070717_10025114 3300006028 Bacteria 4733
54 Ga0070717_10260500 3300006028 Bacteria 1534
55 Ga0070717_10329997 3300006028 Bacteria 1361
56 Ga0070717_10423723 3300006028 Bacteria 1197
57 Ga0075365_10258793 3300006038 Bacteria 1223
58 Ga0075368_10205892 3300006042 Bacteria 833
59 Ga0075368_10533408 3300006042 Bacteria 526
60 Ga0075363_100168464 3300006048 Bacteria 1243
61 Ga0075363_100184483 3300006048 Bacteria 1188
62 Ga0070715_10001161 3300006163 Bacteria 7545
63 Ga0070715_10502360 3300006163 Bacteria 694
64 Ga0070716_100001542 3300006173 Bacteria 10329
65 Ga0070716_100074955 3300006173 Bacteria 2001
66 Ga0070716_100483183 3300006173 Bacteria 910
67 Ga0070716_101146651 3300006173 Bacteria 622
68 Ga0070712_100011243 3300006175 Bacteria 5668
69 Ga0070712_100036468 3300006175 Bacteria 3346
70 Ga0070712_100100008 3300006175 Bacteria 2142
71 Ga0070712_100132183 3300006175 Bacteria 1893
72 Ga0070712_100143906 3300006175 Bacteria 1822
73 Ga0070712_100185137 3300006175 Bacteria 1625
74 Ga0070712_100935487 3300006175 Unclassified 748
75 Ga0075370_10618183 3300006353 Bacteria 657
76 Ga0097620_100127997 3300006931 Bacteria 2610
77 Ga0097620_102114262 3300006931 Bacteria 621
78 Ga0099794_10003307 3300007265 Bacteria 6123
79 Ga0099794_10014587 3300007265 Bacteria 3447
80 Ga0099795_10075078 3300007788 Bacteria 1283
81 Ga0105240_10052179 3300009093 Bacteria 5142
82 Ga0105247_10034582 3300009101 Bacteria 3078
83 Ga0105247_10372278 3300009101 Unclassified 1010
84 Ga0105243_11060610 3300009148 Bacteria 816
85 Ga0105243_11295178 3300009148 Bacteria 746
86 Ga0105243_11418015 3300009148 Bacteria 716
87 Ga0105243_11643013 3300009148 Bacteria 670
88 Ga0105241_10333592 3300009174 Bacteria 1312
89 Ga0105241_11155345 3300009174 Bacteria 731
90 Ga0105242_10239871 3300009176 Bacteria 1629
91 Ga0105237_10063900 3300009545 Bacteria 3678
92 Ga0105237_10180728 3300009545 Bacteria 2110
93 Ga0105237_10236552 3300009545 Bacteria 1828
94 Ga0105237_10924182 3300009545 Bacteria 879
95 Ga0105238_10320795 3300009551 Bacteria 1535
96 Ga0105239_10673141 3300010375 Bacteria 1182
97 Ga0105239_11973416 3300010375 Bacteria 677
98 Ga0157370_10015897 3300013104 Bacteria 7636
99 Ga0157370_10196846 3300013104 Bacteria 1870
100 Ga0157374_12747687 3300013296 Bacteria 520
101 Ga0163162_10240393 3300013306 Bacteria 1942
102 Ga0163162_11326727 3300013306 Unclassified 818
103 Ga0157375_10190211 3300013308 Bacteria 2207
104 Ga0163163_10011142 3300014325 Bacteria 8140
105 Ga0163163_10283072 3300014325 Bacteria 1710
106 Ga0163163_11956670 3300014325 Bacteria 646
107 Ga0157377_10649499 3300014745 Unclassified 759
108 Ga0157379_10482623 3300014968 Unclassified 1147
109 Ga0157379_11202652 3300014968 Bacteria 729
110 Ga0157376_10457041 3300014969 Unclassified 1247
111 Ga0163161_10648195 3300017792 Bacteria 875
112 Ga0224712_10142500 3300022467 Unclassified 1056
113 Ga0207692_10003029 3300025898 Bacteria 6514
114 Ga0207692_10016672 3300025898 Bacteria 3260
115 Ga0207692_10175219 3300025898 Bacteria 1246
116 Ga0207642_10350902 3300025899 Bacteria 870
117 Ga0207710_10022846 3300025900 Bacteria 2685
118 Ga0207710_10361214 3300025900 Bacteria 741
119 Ga0207685_10155672 3300025905 Bacteria 1039
120 Ga0207699_10014193 3300025906 Bacteria 4099
121 Ga0207699_10034454 3300025906 Bacteria 2872
122 Ga0207699_10215095 3300025906 Bacteria 1309
123 Ga0207699_10222949 3300025906 Unclassified 1288
124 Ga0207654_11415625 3300025911 Bacteria 507
125 Ga0207707_10161218 3300025912 Bacteria 1961
126 Ga0207671_10259710 3300025914 Bacteria 1367
127 Ga0207671_10609193 3300025914 Bacteria 870
128 Ga0207693_10000095 3300025915 Bacteria 78764
129 Ga0207693_10066967 3300025915 Bacteria 2812
130 Ga0207693_10130512 3300025915 Bacteria 1975
131 Ga0207693_10215883 3300025915 Bacteria 1507
132 Ga0207693_11191732 3300025915 Unclassified 574
133 Ga0207663_10001869 3300025916 Bacteria 9965
134 Ga0207663_10080926 3300025916 Bacteria 2125
135 Ga0207663_10306683 3300025916 Bacteria 1188
136 Ga0207663_11065823 3300025916 Bacteria 649
137 Ga0207660_10078295 3300025917 Bacteria 2422
138 Ga0207657_10001161 3300025919 Bacteria 28036
139 Ga0207694_10447416 3300025924 Bacteria 1078
140 Ga0207700_10038251 3300025928 Bacteria 3481
141 Ga0207700_10777291 3300025928 Bacteria 856
142 Ga0207664_10141414 3300025929 Bacteria 2036
143 Ga0207664_10697331 3300025929 Bacteria 913
144 Ga0207644_10101113 3300025931 Bacteria 2166
145 Ga0207686_10184779 3300025934 Bacteria 1481
146 Ga0207709_10217593 3300025935 Bacteria 1375
147 Ga0207709_10418956 3300025935 Bacteria 1028
148 Ga0207709_10910917 3300025935 Bacteria 715
149 Ga0207669_10402861 3300025937 Bacteria 1072
150 Ga0207669_10632709 3300025937 Bacteria 873
151 Ga0207665_10000132 3300025939 Bacteria 49462
152 Ga0207665_10040622 3300025939 Bacteria 3104
153 Ga0207661_10009341 3300025944 Bacteria 7027
154 Ga0207651_11013687 3300025960 Bacteria 742
155 Ga0207703_10324113 3300026035 Bacteria 1411
156 Ga0207703_10731243 3300026035 Bacteria 942
157 Ga0207639_10513422 3300026041 Bacteria 1096
158 Ga0207678_11081608 3300026067 Bacteria 710
159 Ga0207641_10547732 3300026088 Bacteria 1128
160 Ga0207683_10075712 3300026121 Bacteria 2979
161 Ga0207683_11410206 3300026121 Bacteria 644
162 Ga0207698_11849866 3300026142 Bacteria 619
163 Ga0207698_11862356 3300026142 Bacteria 616
164 Ga0209179_1075282 3300027512 Bacteria 742
165 Ga0209588_1021305 3300027671 Bacteria 2035
166 Ga0209588_1067249 3300027671 Bacteria 1158
167 Ga0209813_10450252 3300027866 Bacteria 526
168 Ga0268264_10000233 3300028381 Bacteria 106118
169 Ga0268264_11172995 3300028381 Bacteria 777
170 Ga0307517_10408141 3300028786 Bacteria 717
171 Ga0307515_10248703 3300028794 Bacteria 1535
172 Ga0307511_10096523 3300030521 Bacteria 1968
173 Ga0307511_10147174 3300030521 Bacteria 1364
174 Ga0265330_10313216 3300031235 Bacteria 662
175 Ga0307513_10353673 3300031456 Bacteria 1216
176 Ga0307513_10450728 3300031456 Bacteria 1011
177 Ga0307509_10038652 3300031507 Bacteria 5204
178 Ga0307509_10341297 3300031507 Bacteria 1225
179 Ga0307509_10476466 3300031507 Bacteria 937
180 Ga0307508_10000010 3300031616 Bacteria 255747
181 Ga0307508_10152174 3300031616 Bacteria 1918
182 Ga0307508_10357843 3300031616 Bacteria 1051
183 Ga0307516_10015237 3300031730 Bacteria 8099
184 Ga0307516_10425730 3300031730 Bacteria 985
185 Ga0307415_100358400 3300032126 Bacteria 1231
186 Ga0373934_0014565 3300035086 Bacteria 2982
187 Ga0373944_0183093 3300035089 Bacteria 752
188 Ga0373923_0014133 3300035111 Bacteria 2993
189 Ga0373945_0003280 3300035116 Bacteria 5074
190 Ga0373945_0005212 3300035116 Bacteria 4155
191 Ga0373953_0008853 3300035117 Bacteria 3436
192 Ga0373953_0084960 3300035117 Bacteria 1320
193 Ga0373954_0179801 3300035118 Bacteria 1037
194 Ga0373954_0327270 3300035118 Bacteria 756
195 Ga0373956_0434943 3300035119 Bacteria 626
196 Ga0373957_0012874 3300035120 Bacteria 2826
197 Ga0373957_0027423 3300035120 Bacteria 2069
198 Ga0373957_0182399 3300035120 Bacteria 870
199 Ga0373943_0003749 3300035170 Bacteria 6910
200 Ga0373946_0015028 3300035171 Bacteria 2929
201 Ga0373946_0054067 3300035171 Bacteria 1688
202 Ga0373946_0545245 3300035171 Bacteria 598
203 Ga0373955_0013958 3300035172 Bacteria 3899
204 Ga0373955_0015816 3300035172 Bacteria 3700
205 Ga0373955_0437684 3300035172 Bacteria 796
206 Ga0373924_0014554 3300035410 Bacteria 2976
207 Ga0373924_0066082 3300035410 Bacteria 1519
208 Ga0373924_0278942 3300035410 Unclassified 741
209 Ga0373931_0134406 3300035691 Bacteria 1427
210 Ga0373935_0000931 3300035692 Bacteria 15819
211 Ga0373935_0319892 3300035692 Bacteria 1101
212 Ga0373935_0326127 3300035692 Bacteria 1090
213 Ga0373927_0001680 3300035695 Bacteria 16545
214 Ga0373927_0016488 3300035695 Bacteria 4871
215 Ga0373927_0054021 3300035695 Bacteria 2598
216 Ga0373927_0084855 3300035695 Bacteria 2054
217 Ga0373933_0001341 3300035724 Bacteria 14499
218 Ga0373933_0074448 3300035724 Bacteria 2071
219 Ga0373947_0000556 3300035725 Bacteria 21796
220 Ga0373947_0102995 3300035725 Bacteria 1796
221 Ga0373947_1174894 3300035725 Unclassified 523
222 Ga0373937_0027890 3300036401 Bacteria 5109
223 Ga0373937_0040758 3300036401 Bacteria 4234
224 Ga0373937_0146932 3300036401 Bacteria 2207
225 Ga0373937_0418100 3300036401 Bacteria 1272
226 Ga0373925_0004569 3300037068 Bacteria 10458
227 Ga0373925_0018284 3300037068 Bacteria 5094
228 Ga0395900_1138046 3300037418 Bacteria 697
229 Ga0395905_0720206 3300037471 Bacteria 900
230 Ga0395901_1306139 3300038443 Bacteria 687
231 Ga0436360_0385017 3300039438 Bacteria 3103
232 Ga0436360_0875396 3300039438 Bacteria 1750
233 Ga0436361_0202135 3300039447 Bacteria 7504
234 Ga0436363_0667696 3300039450 Bacteria 1162
235 Ga0451791_0960208 3300041451 Bacteria 641
236 Ga0451795_0418406 3300041456 Bacteria 544
237 Ga0451839_0536310 3300041496 Bacteria 866
238 Ga0451851_1020683 3300041507 Bacteria 816
239 Ga0451853_3181471 3300041512 Bacteria 571
240 Ga0466961_0035896 3300044693 Bacteria 3182
241 Ga0466963_0536010 3300044694 Bacteria 827
242 Ga0466968_0283482 3300044735 Bacteria 793
243 Ga0466959_0157955 3300045049 Bacteria 1595
244 Ga0466958_0205869 3300045836 Bacteria 1253
245 Ga0495592_0069719 3300046454 Bacteria 2563
246 Ga0495603_0000032 3300046455 Bacteria 59469
247 Ga0495603_0025657 3300046455 Bacteria 3564
248 Ga0495629_0000094 3300046459 Bacteria 77297
249 Ga0495629_0010054 3300046459 Bacteria 6903
250 Ga0495638_0255827 3300046460 Bacteria 963
251 Ga0495641_0002902 3300046461 Bacteria 13224
252 Ga0495641_0279656 3300046461 Bacteria 751
253 Ga0495651_0291741 3300046462 Bacteria 1097
254 Ga0495651_0294057 3300046462 Bacteria 1092
255 Ga0495653_0066103 3300046463 Bacteria 2720
256 Ga0495653_0072678 3300046463 Bacteria 2568
257 Ga0495580_0003216 3300046472 Bacteria 13979
258 Ga0495582_0000030 3300046473 Bacteria 77594
259 Ga0495605_0189856 3300046474 Bacteria 899
260 Ga0495639_0000003 3300046475 Bacteria 118479
261 Ga0495639_0001388 3300046475 Bacteria 10867
262 Ga0495662_0000008 3300046476 Bacteria 71128
263 Ga0495662_0168499 3300046476 Bacteria 1079
264 Ga0495664_0006834 3300046477 Bacteria 6315
265 Ga0495664_0028161 3300046477 Bacteria 3280
266 Ga0495664_0064166 3300046477 Bacteria 2189
267 Ga0495594_0000381 3300046499 Bacteria 22212
268 Ga0495596_0136313 3300046500 Bacteria 953
269 Ga0495583_0051925 3300046506 Bacteria 1867
270 Ga0495606_0008693 3300046507 Bacteria 8747
271 Ga0495606_0421638 3300046507 Bacteria 690
272 Ga0495618_0021589 3300046514 Bacteria 3970
273 Ga0495618_0084529 3300046514 Bacteria 2027
274 Ga0495628_0067697 3300046516 Bacteria 2788
275 Ga0495628_0392832 3300046516 Bacteria 1014
276 Ga0495628_0818580 3300046516 Bacteria 651
277 Ga0495630_0002304 3300046517 Bacteria 13287
278 Ga0495630_0026088 3300046517 Bacteria 4325
279 Ga0495630_0252879 3300046517 Bacteria 1346
280 Ga0495632_0103445 3300046519 Bacteria 1341
281 Ga0495648_0115679 3300046524 Bacteria 1450
282 Ga0495648_0329484 3300046524 Bacteria 705
283 Ga0495666_0044888 3300046526 Bacteria 2133
284 Ga0495666_0124478 3300046526 Bacteria 1206
285 Ga0495652_0061179 3300046529 Bacteria 3180
286 Ga0495652_0068683 3300046529 Bacteria 2968
287 Ga0495665_0000001 3300046531 Bacteria 156121
288 Ga0495640_0003675 3300046533 Bacteria 12328
289 Ga0495640_0010988 3300046533 Bacteria 6974
290 Ga0495640_0015949 3300046533 Bacteria 5637
291 Ga0495587_0169345 3300046536 Bacteria 1241
292 Ga0495645_0048261 3300046543 Bacteria 3102
293 Ga0495645_0177066 3300046543 Bacteria 1464
294 Ga0495622_0001401 3300046557 Bacteria 12229
295 Ga0495667_0025016 3300046559 Bacteria 4024
296 Ga0495667_0421604 3300046559 Bacteria 840
297 Ga0495667_0546972 3300046559 Unclassified 723
298 Ga0495634_0003065 3300046642 Bacteria 13605
299 Ga0495634_0107737 3300046642 Bacteria 1794
300 Ga0495634_0144401 3300046642 Bacteria 1508
301 Ga0495634_0348082 3300046642 Bacteria 888
302 Ga0495611_0095331 3300046648 Bacteria 1377
303 Ga0495625_0150028 3300046660 Bacteria 1568
304 Ga0495625_0258346 3300046660 Bacteria 1128
305 Ga0495635_0002647 3300046663 Bacteria 12246
306 Ga0495635_0007865 3300046663 Bacteria 7446
307 Ga0495635_0064189 3300046663 Bacteria 2521
308 Ga0495588_0056004 3300046674 Bacteria 2035
309 Ga0495657_0262405 3300046675 Bacteria 1037
310 Ga0495657_0561621 3300046675 Bacteria 662
311 Ga0495599_0063252 3300046678 Bacteria 2312
312 Ga0495599_0068439 3300046678 Bacteria 2216
313 Ga0495599_0214379 3300046678 Bacteria 1179
314 Ga0495623_0004849 3300046679 Bacteria 8825
315 Ga0495623_0162410 3300046679 Bacteria 1312
316 Ga0495623_0499151 3300046679 Bacteria 643
317 Ga0495646_0006907 3300046680 Bacteria 7204
318 Ga0495646_0022100 3300046680 Bacteria 4015
319 Ga0495646_0243533 3300046680 Bacteria 965
320 Ga0495647_0001376 3300046681 Bacteria 7504
321 Ga0495647_0008073 3300046681 Bacteria 3538
322 Ga0495658_0000790 3300046683 Bacteria 17043
323 Ga0495658_0154096 3300046683 Bacteria 1413
324 Ga0495613_0008665 3300046689 Bacteria 7543
325 Ga0495624_0012751 3300046690 Bacteria 5738
326 Ga0495624_0052400 3300046690 Bacteria 2579
327 Ga0495600_0176346 3300046809 Bacteria 1378
328 Ga0495600_0299681 3300046809 Bacteria 1014
329 Ga0495581_0000011 3300047315 Bacteria 63980
330 Ga0495581_0011606 3300047315 Bacteria 5099
331 Ga0495604_0179759 3300047317 Bacteria 1481
332 Ga0495604_0348327 3300047317 Bacteria 985
333 Ga0495604_0818522 3300047317 Bacteria 586
334 Ga0495674_0000031 3300047319 Bacteria 115867
335 Ga0495674_0183463 3300047319 Bacteria 1742
336 Ga0495672_0078002 3300047320 Bacteria 1854
337 Ga0495672_0110654 3300047320 Bacteria 1475
338 Ga0495676_0065790 3300047321 Bacteria 2812
339 Ga0495680_0023980 3300047322 Bacteria 5067
340 Ga0495680_0098094 3300047322 Bacteria 2187
341 Ga0495680_0164067 3300047322 Bacteria 1612
342 Ga0495684_0494350 3300047471 Bacteria 842
343 Ga0495684_0533139 3300047471 Bacteria 802
344 Ga0495686_0210966 3300047472 Bacteria 1110
345 Ga0495593_0000231 3300047673 Bacteria 29745
346 Ga0495593_0613851 3300047673 Bacteria 546
347 Ga0495602_0395071 3300048088 Bacteria 987
348 Ga0495614_0031092 3300048089 Bacteria 2298
349 Ga0495614_0103957 3300048089 Bacteria 1244
350 Ga0496100_0056114 3300048903 Bacteria 2576
351 Ga0496101_0018290 3300048904 Bacteria 4764
352 Ga0496101_0076354 3300048904 Bacteria 2468
353 Ga0496101_0400283 3300048904 Bacteria 1081
354 Ga0496102_0017934 3300048905 Bacteria 6210
355 Ga0496102_0280035 3300048905 Bacteria 1572
356 Ga0496103_0278232 3300048906 Unclassified 1077
357 Ga0496104_0006343 3300048907 Bacteria 10402
358 Ga0496104_0226614 3300048907 Bacteria 1781
359 Ga0496105_0125423 3300048908 Bacteria 2116
360 Ga0496105_0189501 3300048908 Bacteria 1682
361 Ga0496106_0001152 3300048909 Bacteria 19595
362 Ga0496106_0124358 3300048909 Bacteria 2018
363 Ga0496106_1430626 3300048909 Bacteria 533
364 Ga0496107_0548756 3300048910 Bacteria 856
365 Ga0496108_0030183 3300048911 Bacteria 4493
366 Ga0496109_0586234 3300048912 Bacteria 1051
367 Ga0496110_0195169 3300048913 Unclassified 1838
368 Ga0496110_0899306 3300048913 Bacteria 791
369 Ga0496111_0091897 3300048914 Bacteria 2224
370 Ga0496112_0113745 3300048915 Bacteria 2677
371 Ga0496113_0036327 3300048916 Bacteria 3609
372 Ga0496114_1312939 3300048917 Bacteria 610
373 Ga0496115_0174519 3300048918 Bacteria 1777
374 Ga0496115_0604891 3300048918 Bacteria 871
375 Ga0496116_0069263 3300048919 Bacteria 2244
376 Ga0496118_0039123 3300048921 Bacteria 3789
377 Ga0496118_0064292 3300048921 Bacteria 2693
378 Ga0496119_0070844 3300048922 Bacteria 2043
379 Ga0496121_0000407 3300048924 Bacteria 85728
380 Ga0496121_0000994 3300048924 Bacteria 50714
381 Ga0496121_0006985 3300048924 Bacteria 13732
382 Ga0496121_0220467 3300048924 Bacteria 1336
383 Ga0496121_0316379 3300048924 Bacteria 1053
384 Ga0496122_0486296 3300048925 Bacteria 603
385 Ga0496124_0002590 3300048927 Bacteria 23408
386 Ga0496124_0268172 3300048927 Bacteria 1252
387 Ga0496124_0473676 3300048927 Bacteria 847
388 Ga0496125_0066369 3300048928 Bacteria 2852
389 Ga0496125_0163717 3300048928 Bacteria 1506
390 Ga0496125_0196532 3300048928 Bacteria 1326
391 Ga0496126_0011274 3300048929 Bacteria 9274
392 Ga0496126_0097985 3300048929 Bacteria 2569
393 Ga0496126_0281048 3300048929 Bacteria 1379
394 Ga0496126_0365661 3300048929 Bacteria 1177
395 Ga0495682_0003970 3300049460 Bacteria 6451
396 nmdc:mga03n38_52871_c1 3300050490 Bacteria 1819
397 nmdc:mga0yw44_98620_c1 3300050492 Bacteria 1858
398 nmdc:mga04h51_485811_c1 3300050495 Bacteria 526
399 nmdc:mga07m45_606553_c1 3300050496 Bacteria 632
400 Ga0495601_0132833 3300053077 Bacteria 1621
401 Ga0495601_0308575 3300053077 Bacteria 1030
402 Ga0495601_0348879 3300053077 Bacteria 962
403 Ga0495601_0577416 3300053077 Bacteria 722
404 Ga0495612_0042307 3300053078 Bacteria 1859
405 Ga0495612_0249810 3300053078 Bacteria 789
406 Ga0500635_0020633 3300053080 Bacteria 2020
407 Ga0495655_0004698 3300053083 Bacteria 2358
408 Ga0495619_0051464 3300053085 Bacteria 2721
409 Ga0500578_0200344 3300053086 Bacteria 1222
410 Ga0500651_0179311 3300053093 Bacteria 1259
411 Ga0500651_0199030 3300053093 Bacteria 1183
412 Ga0500566_0061747 3300053094 Bacteria 2120
413 Ga0500648_149029 3300053097 Bacteria 1247
414 Ga0500650_0100132 3300053098 Bacteria 1356
415 Ga0500556_0013453 3300053104 Bacteria 2477
416 Ga0500595_002049 3300053119 Bacteria 10293
417 Ga0500595_002123 3300053119 Bacteria 10107
418 Ga0500595_006382 3300053119 Bacteria 5004
419 Ga0500595_073215 3300053119 Bacteria 1013
420 Ga0500614_160418 3300053123 Bacteria 681
421 Ga0500559_0311171 3300053136 Bacteria 739
422 Ga0500568_0007982 3300053139 Bacteria 5139
423 Ga0500590_204960 3300053148 Bacteria 830
424 Ga0500603_051398 3300053150 Bacteria 1129
425 Ga0500603_159243 3300053150 Bacteria 703
426 Ga0500638_005749 3300053162 Bacteria 4987
427 Ga0500636_0067042 3300053177 Bacteria 2085
428 Ga0500636_0179980 3300053177 Bacteria 1136
429 Ga0500636_0200783 3300053177 Bacteria 1055
430 Ga0500637_0001263 3300053178 Bacteria 10591
431 Ga0500596_008649 3300053735 Bacteria 1617
432 Ga0500661_000917 3300055283 Bacteria 5527
433 Ga0495684_0013425
434 rootH2_10023124
435 rootH1_10046484
436 Ga0070683_100466380
437 Ga0070666_11287582
438 Ga0070680_100078106
439 Ga0070660_100266215
440 Ga0070668_100242652
441 Ga0070671_100099461
442 Ga0070674_100366639
443 Ga0070673_101266558
444 Ga0070709_10018778
445 Ga0070709_10046681
446 Ga0070709_10325925
447 Ga0070714_100002572
448 Ga0070714_100130795
449 Ga0070714_100549043
450 Ga0070713_100012141
451 Ga0070713_100061218
452 Ga0070713_100546817
453 Ga0070713_101113582
454 Ga0070710_10003305
455 Ga0070710_10035248
456 Ga0070710_10045132
457 Ga0070711_100006055
458 Ga0070711_100012557
459 Ga0070711_100015604
460 Ga0070711_100122507
461 Ga0070708_100543577
462 Ga0070663_100444055
463 Ga0070678_100022772
464 Ga0070681_10107142
465 Ga0070699_101401612
466 Ga0070679_100464813
467 Ga0070684_100007242
468 Ga0068853_100068659
469 Ga0068853_100453893
470 Ga0068853_100871872
471 Ga0070665_100526461
472 Ga0068855_100176243
473 Ga0070702_100635128
474 Ga0068852_102076868
475 Ga0068859_102115168
476 Ga0068864_100107376
477 Ga0068866_10697435
478 Ga0068851_10349115
479 Ga0068858_100626009
480 Ga0068858_101106025
481 Ga0068860_100000210
482 Ga0068860_100277228
483 Ga0081455_10939350
484 Ga0081540_1314037
485 Ga0070717_10025114
486 Ga0070717_10260500
487 Ga0070717_10329997
488 Ga0070717_10423723
489 Ga0075365_10258793
490 Ga0075368_10205892
491 Ga0075368_10533408
492 Ga0075363_100168464
493 Ga0075363_100184483
494 Ga0070715_10001161
495 Ga0070715_10502360
496 Ga0070716_100001542
497 Ga0070716_100074955
498 Ga0070716_100483183
499 Ga0070716_101146651
500 Ga0070712_100011243
501 Ga0070712_100036468
502 Ga0070712_100100008
503 Ga0070712_100132183
504 Ga0070712_100143906
505 Ga0070712_100185137
506 Ga0070712_100935487
507 Ga0075370_10618183
508 Ga0097620_100127997
509 Ga0097620_102114262
510 Ga0099794_10003307
511 Ga0099794_10014587
512 Ga0099795_10075078
513 Ga0105240_10052179
514 Ga0105247_10034582
515 Ga0105247_10372278
516 Ga0105243_11060610
517 Ga0105243_11295178
518 Ga0105243_11418015
519 Ga0105243_11643013
520 Ga0105241_10333592
521 Ga0105241_11155345
522 Ga0105242_10239871
523 Ga0105237_10063900
524 Ga0105237_10180728
525 Ga0105237_10236552
526 Ga0105237_10924182
527 Ga0105238_10320795
528 Ga0105239_10673141
529 Ga0105239_11973416
530 Ga0157370_10015897
531 Ga0157370_10196846
532 Ga0157374_12747687
533 Ga0163162_10240393
534 Ga0163162_11326727
535 Ga0157375_10190211
536 Ga0163163_10011142
537 Ga0163163_10283072
538 Ga0163163_11956670
539 Ga0157377_10649499
540 Ga0157379_10482623
541 Ga0157379_11202652
542 Ga0157376_10457041
543 Ga0163161_10648195
544 Ga0224712_10142500
545 Ga0207692_10003029
546 Ga0207692_10016672
547 Ga0207692_10175219
548 Ga0207642_10350902
549 Ga0207710_10022846
550 Ga0207710_10361214
551 Ga0207685_10155672
552 Ga0207699_10014193
553 Ga0207699_10034454
554 Ga0207699_10215095
555 Ga0207699_10222949
556 Ga0207654_11415625
557 Ga0207707_10161218
558 Ga0207671_10259710
559 Ga0207671_10609193
560 Ga0207693_10000095
561 Ga0207693_10066967
562 Ga0207693_10130512
563 Ga0207693_10215883
564 Ga0207693_11191732
565 Ga0207663_10001869
566 Ga0207663_10080926
567 Ga0207663_10306683
568 Ga0207663_11065823
569 Ga0207660_10078295
570 Ga0207657_10001161
571 Ga0207694_10447416
572 Ga0207700_10038251
573 Ga0207700_10777291
574 Ga0207664_10141414
575 Ga0207664_10697331
576 Ga0207644_10101113
577 Ga0207686_10184779
578 Ga0207709_10217593
579 Ga0207709_10418956
580 Ga0207709_10910917
581 Ga0207669_10402861
582 Ga0207669_10632709
583 Ga0207665_10000132
584 Ga0207665_10040622
585 Ga0207661_10009341
586 Ga0207651_11013687
587 Ga0207703_10324113
588 Ga0207703_10731243
589 Ga0207639_10513422
590 Ga0207678_11081608
591 Ga0207641_10547732
592 Ga0207683_10075712
593 Ga0207683_11410206
594 Ga0207698_11849866
595 Ga0207698_11862356
596 Ga0209179_1075282
597 Ga0209588_1021305
598 Ga0209588_1067249
599 Ga0209813_10450252
600 Ga0268264_10000233
601 Ga0268264_11172995
602 Ga0307517_10408141
603 Ga0307515_10248703
604 Ga0307511_10096523
605 Ga0307511_10147174
606 Ga0265330_10313216
607 Ga0307513_10353673
608 Ga0307513_10450728
609 Ga0307509_10038652
610 Ga0307509_10341297
611 Ga0307509_10476466
612 Ga0307508_10000010
613 Ga0307508_10152174
614 Ga0307508_10357843
615 Ga0307516_10015237
616 Ga0307516_10425730
617 Ga0307415_100358400
618 Ga0373934_0014565
619 Ga0373944_0183093
620 Ga0373923_0014133
621 Ga0373945_0003280
622 Ga0373945_0005212
623 Ga0373953_0008853
624 Ga0373953_0084960
625 Ga0373954_0179801
626 Ga0373954_0327270
627 Ga0373956_0434943
628 Ga0373957_0012874
629 Ga0373957_0027423
630 Ga0373957_0182399
631 Ga0373943_0003749
632 Ga0373946_0015028
633 Ga0373946_0054067
634 Ga0373946_0545245
635 Ga0373955_0013958
636 Ga0373955_0015816
637 Ga0373955_0437684
638 Ga0373924_0014554
639 Ga0373924_0066082
640 Ga0373924_0278942
641 Ga0373931_0134406
642 Ga0373935_0000931
643 Ga0373935_0319892
644 Ga0373935_0326127
645 Ga0373927_0001680
646 Ga0373927_0016488
647 Ga0373927_0054021
648 Ga0373927_0084855
649 Ga0373933_0001341
650 Ga0373933_0074448
651 Ga0373947_0000556
652 Ga0373947_0102995
653 Ga0373947_1174894
654 Ga0373937_0027890
655 Ga0373937_0040758
656 Ga0373937_0146932
657 Ga0373937_0418100
658 Ga0373925_0004569
659 Ga0373925_0018284
660 Ga0395900_1138046
661 Ga0395905_0720206
662 Ga0395901_1306139
663 Ga0436360_0385017
664 Ga0436360_0875396
665 Ga0436361_0202135
666 Ga0436363_0667696
667 Ga0451791_0960208
668 Ga0451795_0418406
669 Ga0451839_0536310
670 Ga0451851_1020683
671 Ga0451853_3181471
672 Ga0466961_0035896
673 Ga0466963_0536010
674 Ga0466968_0283482
675 Ga0466959_0157955
676 Ga0466958_0205869
677 Ga0495592_0069719
678 Ga0495603_0000032
679 Ga0495603_0025657
680 Ga0495629_0000094
681 Ga0495629_0010054
682 Ga0495638_0255827
683 Ga0495641_0002902
684 Ga0495641_0279656
685 Ga0495651_0291741
686 Ga0495651_0294057
687 Ga0495653_0066103
688 Ga0495653_0072678
689 Ga0495580_0003216
690 Ga0495582_0000030
691 Ga0495605_0189856
692 Ga0495639_0000003
693 Ga0495639_0001388
694 Ga0495662_0000008
695 Ga0495662_0168499
696 Ga0495664_0006834
697 Ga0495664_0028161
698 Ga0495664_0064166
699 Ga0495594_0000381
700 Ga0495596_0136313
701 Ga0495583_0051925
702 Ga0495606_0008693
703 Ga0495606_0421638
704 Ga0495618_0021589
705 Ga0495618_0084529
706 Ga0495628_0067697
707 Ga0495628_0392832
708 Ga0495628_0818580
709 Ga0495630_0002304
710 Ga0495630_0026088
711 Ga0495630_0252879
712 Ga0495632_0103445
713 Ga0495648_0115679
714 Ga0495648_0329484
715 Ga0495666_0044888
716 Ga0495666_0124478
717 Ga0495652_0061179
718 Ga0495652_0068683
719 Ga0495665_0000001
720 Ga0495640_0003675
721 Ga0495640_0010988
722 Ga0495640_0015949
723 Ga0495587_0169345
724 Ga0495645_0048261
725 Ga0495645_0177066
726 Ga0495622_0001401
727 Ga0495667_0025016
728 Ga0495667_0421604
729 Ga0495667_0546972
730 Ga0495634_0003065
731 Ga0495634_0107737
732 Ga0495634_0144401
733 Ga0495634_0348082
734 Ga0495611_0095331
735 Ga0495625_0150028
736 Ga0495625_0258346
737 Ga0495635_0002647
738 Ga0495635_0007865
739 Ga0495635_0064189
740 Ga0495588_0056004
741 Ga0495657_0262405
742 Ga0495657_0561621
743 Ga0495599_0063252
744 Ga0495599_0068439
745 Ga0495599_0214379
746 Ga0495623_0004849
747 Ga0495623_0162410
748 Ga0495623_0499151
749 Ga0495646_0006907
750 Ga0495646_0022100
751 Ga0495646_0243533
752 Ga0495647_0001376
753 Ga0495647_0008073
754 Ga0495658_0000790
755 Ga0495658_0154096
756 Ga0495613_0008665
757 Ga0495624_0012751
758 Ga0495624_0052400
759 Ga0495600_0176346
760 Ga0495600_0299681
761 Ga0495581_0000011
762 Ga0495581_0011606
763 Ga0495604_0179759
764 Ga0495604_0348327
765 Ga0495604_0818522
766 Ga0495674_0000031
767 Ga0495674_0183463
768 Ga0495672_0078002
769 Ga0495672_0110654
770 Ga0495676_0065790
771 Ga0495680_0023980
772 Ga0495680_0098094
773 Ga0495680_0164067
774 Ga0495684_0494350
775 Ga0495684_0533139
776 Ga0495686_0210966
777 Ga0495593_0000231
778 Ga0495593_0613851
779 Ga0495602_0395071
780 Ga0495614_0031092
781 Ga0495614_0103957
782 Ga0496100_0056114
783 Ga0496101_0018290
784 Ga0496101_0076354
785 Ga0496101_0400283
786 Ga0496102_0017934
787 Ga0496102_0280035
788 Ga0496103_0278232
789 Ga0496104_0006343
790 Ga0496104_0226614
791 Ga0496105_0125423
792 Ga0496105_0189501
793 Ga0496106_0001152
794 Ga0496106_0124358
795 Ga0496106_1430626
796 Ga0496107_0548756
797 Ga0496108_0030183
798 Ga0496109_0586234
799 Ga0496110_0195169
800 Ga0496110_0899306
801 Ga0496111_0091897
802 Ga0496112_0113745
803 Ga0496113_0036327
804 Ga0496114_1312939
805 Ga0496115_0174519
806 Ga0496115_0604891
807 Ga0496116_0069263
808 Ga0496118_0039123
809 Ga0496118_0064292
810 Ga0496119_0070844
811 Ga0496121_0000407
812 Ga0496121_0000994
813 Ga0496121_0006985
814 Ga0496121_0220467
815 Ga0496121_0316379
816 Ga0496122_0486296
817 Ga0496124_0002590
818 Ga0496124_0268172
819 Ga0496124_0473676
820 Ga0496125_0066369
821 Ga0496125_0163717
822 Ga0496125_0196532
823 Ga0496126_0011274
824 Ga0496126_0097985
825 Ga0496126_0281048
826 Ga0496126_0365661
827 Ga0495682_0003970
828 nmdc:mga03n38_52871_c1
829 nmdc:mga0yw44_98620_c1
830 nmdc:mga04h51_485811_c1
831 nmdc:mga07m45_606553_c1
832 Ga0495601_0132833
833 Ga0495601_0308575
834 Ga0495601_0348879
835 Ga0495601_0577416
836 Ga0495612_0042307
837 Ga0495612_0249810
838 Ga0500635_0020633
839 Ga0495655_0004698
840 Ga0495619_0051464
841 Ga0500578_0200344
842 Ga0500651_0179311
843 Ga0500651_0199030
844 Ga0500566_0061747
845 Ga0500648_149029
846 Ga0500650_0100132
847 Ga0500556_0013453
848 Ga0500595_002049
849 Ga0500595_002123
850 Ga0500595_006382
851 Ga0500595_073215
852 Ga0500614_160418
853 Ga0500559_0311171
854 Ga0500568_0007982
855 Ga0500590_204960
856 Ga0500603_051398
857 Ga0500603_159243
858 Ga0500638_005749
859 Ga0500636_0067042
860 Ga0500636_0179980
861 Ga0500636_0200783
862 Ga0500637_0001263
863 Ga0500596_008649
864 Ga0500661_000917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a56-assembly1.cif.gz_A-2 crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca 0.5534 26 121
4a56-assembly1.cif.gz_A-2 crystal structure of the type 2 secretion system pilotin from klebsiella oxytoca 0.4728 26 121
5z2h-assembly1.cif.gz_B structure of dictyostelium discoideum mitochondrial calcium uniporter n-terminal domain(ddmcu-ntd) 0.4441 26 78
6hcg-assembly1.cif.gz_P klebsiella pneumoniae type ii secretion system outer membrane complex. puld, puls and pulc hr domain. 0.3898 26 121
4z5r-assembly2.cif.gz_E rontalizumab fab bound to interferon-a2 0.366 25 115
ID Description Score Start End Superfamily
4a56A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Chaperone lipoprotein PulS/OutS 0.5534 26 121 1.20.58.1630
af_P49718_660_734_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.49 26 78 1.10.10.10
4a56A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Chaperone lipoprotein PulS/OutS 0.4728 26 121 1.20.58.1630
3d5lB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4602 27 76 1.10.10.10
af_F1RBR0_526_606_1.10.1240.40 Mainly Alpha;Orthogonal Bundle;Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1;ENT domain 0.4434 26 95 1.10.1240.40
ID Description Score Start End GO Terms
AF-A0A431R4L9-F1-model_v4 deleted 0.9437 16 128
AF-A0A431R4L9-F1-model_v4 deleted 0.9194 16 128
AF-A0A4Q8QMS9-F1-model_v4 Uncharacterized protein 0.8445 1 128
AF-A0A0E3VX23-F1-model_v4 Uncharacterized protein 0.8436 23 128
AF-A0A4Q8QMS9-F1-model_v4 Uncharacterized protein 0.8378 1 128

Map